5KX5B

Crystal structure of tubulin-stathmin-ttl-compound 11 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
430
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Design, Synthesis, and Cytotoxic Evaluation of Novel Tubulysin Analogues as ADC Payloads.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 167
structure length 427
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kx5B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kx5B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kx5B01
4X20B 4I4TB 4U3JB 4X1IB 5JQGA 4E6EA 2GVIA 4TUYA 3HKEA 3RYFB 2RHHA 2Q1XA 3WGKA 2BTQB 3JALA 3HKBB 4YJ3A 4I50A 3VO9A 3R4VA 3HKDA 3JAKB 5EZYB 1FFXA 5KX5B 3VO8A 4DXDA 5LP6A 5IJ9A 4EI7A 4O4IA 5JQGB 3JARA 2R751 4EB6B 3CB2A 4F6RA 3VPAA 4I55A 3HKEB 4TUYB 1Z5WA 5JVDA 3N2KA 2XKBA 3RYHB 5IJ0A 4YJ3B 4I50B 3M8KA 4X1YA 3HKDB 1FFXB 4O2BB 3JAWA 4DRXA 5JCOC 5LP6B 5IJ9B 5JH7A 3JATA 4O4IB 5LA6A 4X1KB 3JARB 1W5AA 1W5EA 2RHLA 4O4LA 4F6RB 4FFBA 5MN4A 5JVDB 4WBNB 3N2KB 3RYCA 1TVKA 4LNUA 5CA1B 5IJ0B 3C8LA 3WGNA 3ZBPA 4X1YB 5J2TB 5EYPA 3JAWB 4IIJB 5LP6C 5LOVA 5LXTA 4XCQA 5JH7B 3JATB 1RQ7A 5LYJA 4O4LB 3WGJA 3WGMA 4TV9A 4O4HA 3ZIDA 4ZHQA 1OFUA 3RYCB 4EI9A 3JALB 2VAMA 4O2AA 2R6R1 5J2UA 5LOVB 4B45A 2XKAA 5LXTB 1SA0A 5GONA 3RYIA 5LYJB 4M8IA 5C8YA 4HNAA 3RB8A 4O4HB 4I55B 5BMVA 5FNVA 3JASA 2RHJA 5CB4A 5ITZA 5IYZA 2VXYA 5KMGA 5J2UB 4DRXB 4ZOLA 4U3JA 4X1IA 1TUBA 5LA6B 4O4JA 3RYFA 3UT5A 5C8YB 2VAPA 4IHJA 4ZI7A 3HKBA 4FFBB 1W5FA 3HKCA 1TVKB 4LNUB 5ITZB 5EZYA 5KX5A 1W59A 5KMGB 5EYPB 3N2GA 5MN5A 4EI8A 4ZOLB 4EB6A 5CA0A 1JFFA 1Z5VA 1TUBB 3UT5B 4O4JB 4U39A 3E22A 3VOAA 4IHJB 4ZI7B 4TV9B 5M7EA 3RYHA 4ZHQB 3HKCB 1W5BA 2RHOA 3M89A 4TV8A 1RLUA 4O2BA 4B46A 4O2AB 4YJ2A 3N2GB 3ZBQA 4X1KA 5CA0B 1JFFB 1SA0B 5GONB 1FSZA 4X20A 4I4TA 3WGLA 3E22B 3RYIB 2BTOA 4KWEA 4WBNA 5MN6A 1RQ2A 4HNAB 5EIBD 2BTQA 5CA1A 3VOBA 5BMVB 5FNVB 3V3TA 3JASB 5EIBC 4TV8B 5J2TA 2Q1YA 4IIJA 5CB4B 5IYZB 3JAKA 4YJ2B 5JCOA 1W581 2VAWA
chains in the Genus database with same CATH superfamily
5LJLA 1VBNA 1FTWA 1OROA 1XTUA 4CKBB 4IZIA 3KCQA 1A5BB 1C7RA 4JI6B 2KQUA 4WESA 1YTFD 4OYYA 1AR5A 2P30A 4O4JF 3TCNA 3MN1A 4QM7A 1MQAA 3RAFC 4A1OA 3OEHA 5DH9A 1O87A 5AOBA 4WECA 2NUPA 4LCBA 2ZTLA 4Y9TA 3OLZA 4NS4A 4F46A 4KQKA 1EVKA 5AW7A 1MZVA 4BKRA 3W9UA 2WA1A 3EZ6A 3I1JA 2Z30A 1PVDA 1LTQA 1JJIA 3CUWA 4O1MA 3FPBA 4PO3X 3KJXA 4LQ4A 3JQAD 4FGJA 2AK2A 4LFCB 1MRZA 5HHTA 3UNXA 4BVTA 1O0CA 5ESWA 4FS3A 4WZBE 3WKDA 4O4IF 4HWTA 4YACA 3L0DA 5KAMA 5H16A 3THYB 3A4LA 4UU0A 2RIRA 3ZN0A 1UZAA 4DUZO 1SK8A 4EJSA 1TRKA 1U2DA 2YIDA 2ZQMA 3V3TA 1DWPA 2H06A 2VDMB 4XSGA 3IUPA 4RFSB 1NJ1A 4K03A 4JXJA 3GG2A 4NK4A 1ZA1A 2A0XA 4ES6A 2XE4A 2C92A 3NEJA 5TJ9A 1PJBA 5IJ0A 1OFTA 1R8QA 1VF7A 3QMPA 3AEXA 2G40A 5GV8A 2PCJA 1P45A 1ISHA 5BN5A 4G25A 3FDZB 3G82C 2Q0AA 3ITNA 4MR7A 1QCCA 1P1IA 3KZKA 3ONWA 1WPGA 2RCNA 3GWGA 2I33A 4GKAA 4FX2A 5CBGA 4G4IA 5DNYB 3GLHE 1NLYA 2CUZA 1SU6A 2H1LA 1VPVA 1J8QA 4IJKA 1FP1D 4NG4A 5BNIA 2EKPA 4JI7O 1GLGA 2ZI5A 4X92A 5FUWA 4NF2A 1YE3A 1NI5A 3ZWMA 1MT0A 1VIVA 4DR4B 2JBAB 4PCLA 4TL9A 3TJTA 4I3FA 3PJRA 3NDBB 2QT9A 5LMUB 1F51A 4N1AA 1QTIA 4U5QA 4EKYA 2DFDA 3B6ZA 4OUDA 2YC4C 3KQSA 3O83A 2FRDC 1QVVA 2Q4TA 1Y34E 2NT3A 4NZYA 2ZYSA 5LQJA 2YIBA 2F3UA 2Z8XA 3LZCA 5GTDA 1PR4A 4EY3A 4LFAB 2ZBGA 2B98A 3H8VA 3ZXXA 4MPTA 1QZZA 1TNDA 4K8OA 1P5RA 1FZTA 3SS8A 2C5BA 1WCWA 1A7KA 3EGOA 3USZA 1N7HA 5HUHA 1TCUA 2J6CA 4EHNA 3KZ1E 4QGAA 1DG9A 2AKAB 1Q0HA 2AZTA 1C30B 2MSKA 3IP6A 3HHPA 2QRPA 3RFRA 3GUYA 2J1LA 3SF0A 5H70A 1RT9A 3MNFA 4PHCA 3P0HA 3AHHA 2V74B 3P4EA 3EASA 2Z8YM 3KXPA 2ZYTX 4FKMA 4DC9A 5DHQA 2QTMA 2ZRMA 2Z8YA 1W42A 4DEXA 1I30A 2Z5GA 3K92A 3VZSA 3EC2A 3ADPA 1KJ8A 2IHUA 1NIPA 1Y8QA 3VNUA 4R16A 2W0SA 4DBLE 4QODA 1SXIA 1RC1A 3V48A 3IALA 3QPAA 5KYYA 3H4IA 3V1KA 2YZNA 4X8AA 3DEFA 4S05A 5JUWA 5NLLA 2WJ3A 3CWCA 4CM8B 1H93A 2UZHA 3EG9A 5LP6F 2IYRA 3FWZA 3M2TA 3RT3C 4HZGA 2WLLA 2FI1A 2CYCA 1WP7A 5ALJA 2ODNA 1HY3A 4PAMA 4R54A 5IJAA 1NH2B 2H48A 1YVUA 4BVSA 3N8DA 2FPXA 5EIAA 2O0KA 1QYXA 1M1XB 3H2BA 3PDHA 2O54A 3ISJA 5K8CA 2ZXEA 3BDIA 3TF5A 2NLOA 3DL7A 3HXOA 3ZHBA 4P1ZA 5HR5A 3EULA 4Z0PA 3MTQA 3ZDQA 5DX0A 4E6PA 2JGIA 2NUTA 4NPAA 1PT9A 2XMGA 1H7MA 1Q90D 4PSAA 2LKCA 3UYKA 4PRZA 1TX4B 5LN1A 2B21A 2F3SA 5FQOA 4BNTA 2ECPA 5ECYA 1QYIA 1SRQA 4EDHA 4DW0A 4ER5A 2FPPB 3CXRA 2JLSA 5THQA 3NGMA 4W5HA 4ZCLA 3PEFA 4E5YA 2X0NA 3D6VA 1D2RA 3EWIA 5IAAA 4DV2O 1UOEA 1CF4A 1LD3A 1V1MA 5CM9C 4MIOA 1KAHA 2P4QA 2F17A 3AFHA 1XTTA 2LCFA 1Y7PA 1NXPA 4KRGA 2H5LA 3DBRB 4ABMA 3UPTA 1E2EA 1R8YA 4JAUA 2XRZA 2G83A 3GPIA 4NI5A 2FPSA 1DQPA 3GVHA 4LMAA 4AT1A 2J5BA 4MS3B 1RW4A 3WIVA 3PPWA 5GIOE 3NHRA 4NHOA 5IVIA 3WMWA 1E2IA 1LB1B 3ZD8A 2CNDA 4EVSA 1NTMH 3TAHA 2R97A 1IHOA 2PQ2A 4L75A 2EIHA 4D8YA 2JJYA 3TNJA 1IE3A 5KNCD 3V2HA 3OF3A 1RRPA 2H92A 1SKAA 3NWOA 2PUFA 2FPMA 1FSSA 2DLCX 1YHQF 4KWHA 2DETA 2Q4BA 2ENUA 3CVOA 2W2KB 1YI1A 4FKZA 4BVBA 1RXUA 4ZEOA 4EGCB 5IARA 3IA2A 1OLSA 1YRHA 3TQSA 4LMPA 1Y5NA 4AG6A 1P5FA 1T9ZA 2JJ2A 4R8MA 4W4TA 2CUNA 1SUSA 2I6XA 2WWIA 1DXHA 2PH7A 3OI7A 1UOQA 3HVRA 4WNAA 2WQ7A 1T3GA 3JZDA 2YRFA 3UMSA 3OPMA 3NJRA 3PPYA 5A3JA 4LPSA 1PO7A 1J6UA 5I9MA 2XLCA 3AG4C 1ABBA 3QHAA 5DKFA 2J7KA 3OMAB 1CDOA 5K3OA 4UJ5A 1TYCA 3P9ZA 1L0BA 3K5PA 4OHOA 4EFLA 4MQ5A 2A9HA 3REFA 3GJ8A 4MV1A 4BX3A 1R6AA 2HA3A 3KKMA 3PSAA 5K8UA 2B8TA 5CMLA 2YNMD 3FSRA 1G8HA 3AJ9A 4CDGA 2ZZNA 3EZGA 4JAVC 2FU5C 4IL6Z 1J8MF 2JVIA 1ACJA 1FUUA 4V0LA 2A94A 2QPAA 1B6TA 3LX5A 2RH5A 3LBNA 3FCCA 5I51A 2MYNA 2C2KA 1KKCA 4IIJF 3NHPA 4BNLA 3GLTA 1MA3A 4Z4HA 3P32A 2CBGA 1US8B 2HVKC 4JNCA 1HMYA 1F8XA 5CGZA 1NULA 1GIAA 1I5EA 4M9UA 1B6SA 4TTIA 3CLTD 3GRAA 1Q6ZA 1FFWA 1RJ9B 2KG7B 4MUIA 4NVRA 3T4PA 4ZZ3A 2HU2A 3AUXA 2B1QA 4MW4A 5IVKA 4YIKA 1C7JA 4LDJA 4E51A 1N2CB 3WHPA 5HG0A 4CM4B 3NMUF 1ODEA 3WYFA 2HWWA 2EFHB 1XTVA 1ZR2A 2OD9A 1C1HA 2JGAA 4WZAB 5CXSA 1BE1A 5HKKD 4Z53A 1JDNA 4EITA 2DPHA 5DYYA 3VSDA 4LRUA 1QRSA 4KVZA 3IAM1 3ZJYA 2FKNA 1KNKA 4RTOA 2IIVA 1ZH6A 2F48A 1ONPA 1AZTA 1JQEA 3GD5A 3NEAA 4XX0B 2ZREA 3RUDA 2Q3DA 2YZGA 1F5NA 4LYYA 3ZVLA 3BREA 2QROA 3CXCU 3ZOPA 4J7UA 3VC1A 4LF8B 1U1IA 2GCIA 2PZ8A 5T67A 5FORA 4F6EA 4BCBA 2HT6A 4ZVSA 5FHQA 3C70A 3D0RA 2ZBPA 4WXMA 2BEKA 4Z4IA 5CDFA 4IINA 1QMGA 3F3MA 1PD1A 2WHEA 4Q3AA 3LKVA 1FCJA 2P4KA 1CF2O 4R69A 3MRSA 4XJTA 2V1UA 1E4VA 3DKKA 2PL1A 2X5NA 2Q5IA 1A3CA 2FHPA 1KFKB 3ZDZB 1AY0A 3KUKA 1URFA 5BW8A 2VQFB 2CHSA 5G0VA 4OF4A 1HT2E 3RE3A 1H9AA 3MMZA 3N3BC 2I2DA 3FF1A 4ZOLA 4IWXA 4E13A 1QQCA 5AKHA 1QG6A 2RCYA 4CLOA 1P7CA 2Q29A 3A0BZ 3X1YA 2JLAA 4NPHA 2XBMA 4UZSA 5JALA 5KVAA 1JIUA 1PJSA 4RFLA 1FUIA 4JYMA 4P2GA 3VR4D 3EVAA 2H1WA 2HUPA 5FOQA 4M9CA 3WGLA 1W5SA 2X77A 5JS6A 3TXXA 3EISA 3T12A 1UKEA 1EDBA 1U0HC 1B6RA 4TWKA 2OWOA 3MS7A 4K9DA 1RR6A 4H3HB 1U0LA 3D4IA 2ZAUA 1PAUA 3TINA 2PR7A 3G2IA 2FZKA 1F6DA 1KSHA 2C5FA 3DZKA 1MQSA 4BQIA 4GWLA 3TFQA 2DUJA 4RIHA 1O6CA 5A0TA 2JGFA 2GAJA 3LI2A 4HX2A 3VHXB 2N9UA 2R8XA 5IYCO 3NONA 4GPD1 2JBWA 3ASNC 1B8OA 4KQ9A 4PAOA 4N8DA 3ZMVA 2ZVYA 1PL7A 3H5IA 3H5AA 4M46A 3WAKA 3TAUA 5B66Z 4RJLA 4V2IA 1RSOB 1U28C 4L1KA 4DCNA 4EG7A 1H8EG 3QG5A 1VG1A 4IF6A 3QP9A 2BTEA 4JF3A 2WHPB 4I6EA 4QL3A 3BXHA 4JJGA 3PSHA 2OCXA 3A27A 5CVVA 2MSCB 5DSZA 3WP1B 5H4HA 2QMEA 4H27A 3EIHA 1XCJA 2WTNA 1H8HG 4CL2A 1YJQA 2OGWA 2DMXA 2CLLB 1P8JA 5DI3A 3IT3A 1ZITA 3L70H 1OT3A 3HUFA 2EFCB 3RG8A 4XPIB 4HFNA 4PN3A 2RJZA 3AI3A 1A27A 3G2JA 4YDQA 3DM5A 3R76A 4JOBA 4LKRA 5F5NA 4MTGA 1Y42X 2AN1A 5FAKA 1ZDMA 4ARZA 2PTGA 1OI3A 3ESZA 4TKVA 1E61A 3V4RA 3A1NA 2ZWPA 2X5OA 5LZ9A 5EY5B 2JIZG 2Q0HA 1LQ2A 1JKFA 2O8BA 5ITZB 2KTVA 3MCVA 3EN0A 2PKRA 3OEHD 5BQPA 2ILMA 2C4KA 3E82A 4OXIA 4BFUA 2QSYA 3RVDA 4HYOA 2VDJA 5HBGA 1JR2A 2PLAA 2CJXA 1T24A 3HU5A 5K3CA 5TQ2A 4QOJA 1NW6A 4C04A 1RCTE 4WFIA 3EFBA 1EHIA 3ETGA 2NYAA 3B9QA 4F5DA 1S4MA 1HSOA 3WL5A 2OOKA 1GFIA 4R41A 1G9SA 4BQQA 4F1JA 1N92A 3DAGA 3I5MA 3MCZA 3QRWA 4KQ1A 4KDRA 3UATA 1M10A 3LK6A 3E7FA 1NFQA 4KLAA 5I01A 1EK2A 2MYUA 4OQLA 3DOFA 4YAFA 1RQXA 3OJCA 1ZGCA 2HUNA 1G0OA 3JALB 3KOOA 1AF4A 3UFXB 3LNMB 4BCCA 1EJ2A 3NWJA 2YRWA 4YCAA 2ZWMA 3CR8A 1DXYA 5EWRA 2CLMB 2GN4A 5E4FA 1IHXA 1NLFA 2ZJ8A 2PXHA 1VP3A 2XQKA 4TS3A 4WNCA 1M1YB 5EZYA 2YWGA 2OHHA 1D4OA 4AF7A 1B74A 3BFJA 1YDHA 1GQYA 3MJRA 3UQYS 3M6AA 3CVVA 4ICIA 1IEXA 1N0JA 5JYBA 4I5DA 3Q2KA 3C3TA 4CQMD 1MF7A 2DWOA 4X6LA 4DGQA 2I3DA 1INLA 1U7DA 4G4SP 3ROXA 3ABMC 3FXAA 1UKBA 1KMHA 4D8UA 5BQ5A 3DBVO 3O3OB 1GOTA 2SECE 2O8DB 2B5VA 3HP4A 1UQUA 4AQ7A 4DR2O 2PPLA 1QFXA 2X40A 4LE2A 4L4YA 4YNBA 3NBXX 2CLEB 3I2JA 1U2QA 1H6BA 1XN4A 4QJ3A 4IKPA 1Z8FA 3SU8A 1RC0A 4FHFA 1AS0A 4IJ6A 4BTVA 1W48A 1JIKA 3ND5A 4CQNA 3BL8A 3KVNA 3LTNC 1P33A 5JRJA 2WU3A 4BFYA 3AESA 1AMOA 2HHCA 1FU4A 5F64A 3HGMA 2YIBD 2B82A 1C80A 2O1SA 4MUXA 2Z5FA 3MLAA 1DJLA 3ZOKA 2BFCB 3GQBA 3JZMA 4H6PA 5EC8A 3C48A 4CCYA 1CE8B 2FR8C 1OIXA 2BRUA 3O9ZA 4JUDX 2WYWA 4R8SA 3LNNA 1QPZA 3OZVA 2P4SA 1T0KB 3QKIA 3D8TA 4KN8A 4KU4A 1Q6HA 2QLLA 1VF6A 2HSEA 3RWRD 2ZJ4A 4G41A 4BATA 2Y76A 2GBFA 1YJ9V 4AULA 3TCXB 2WUGA 2QWOB 5LGNA 3G8AA 1WXGA 1GZ4A 2VYVA 3X2EA 4IZHA 2HYIC 3F6EX 5IH3A 1U6JA 4M2LA 3WRWA 4HNAA 3DM9B 2OY0A 5DHRA 2W6NA 1WDWB 3T9FA 3UH0A 1VPDA 2PZFA 3AM3A 4J16A 3A4MA 3IH5A 2J3IA 4Q21A 4D8WA 5KOJA 2EJ7A 3CRCA 1KSFX 4Z2YA 2QU7A 3UO3A 4WK4B 3NT5A 4MRNA 4YRLA 4PC3A 1EM1A 4RZXA 3P0EA 4TV8B 4UFPA 4PINA 2YOFA 2IPMA 5D2CA 4HFMA 5E4TA 4IIGA 5G40A 3SHFA 3BJRA 4ZOLF 1X9HA 3GB9A 1QVRA 1NV9A 3BJMA 1XZGA 4MVQA 4JB8A 4RTPA 1AR1B 3AR5A 2CMHA 1P2DA 2GPSA 2DLNA 1VLZA 3TX6A 1JYEA 4HB2A 4L8LA 5H02A 4QARA 3COSA 2ZJAA 2HEIA 1USIA 3OZWA 6CHYA 1USVA 4YMTA 5DXFA 4GPTA 4J0FA 1TF2A 3K9GA 2QZSA 1RP3B 1W96A 5DNVA 4PBTA 1J00A 3CC4F 2WW8A 2RB4A 3CRQA 2E55A 4C76A 4FM0A 3UAOA 5GIOC 5A4DA 2HCRA 2WFLA 2X1VA 3F0GA 2EGUA 1J2UA 4HEQA 5IVDA 4YQFA 1PUIA 2WJGA 4EVIA 2VCHA 2ZK7A 1SQFA 4WV3A 2XB8A 1POWA 3BS4A 2PKQP 1NFRA 2ZUDA 4TTQA 4IUYA 1TFUA 3ICEA 4RA9A 2QWPB 3TB6A 4BEWA 1OBFO 2NUAA 2B8WA 1WJGA 1CZKA 3EODA 4KWTA 4TWRA 4E5MA 4FQ8A 4OJNA 4NL4H 3GDHA 1KYOF 4RHEA 4DEVA 1DUIA 4ZALA 4J42A 4UQOA 4KTTE 2O3TA 1Y1RA 1LU9A 3IAFA 4D5GA 1UBOS 4MQBA 1NF2A 4ZQFA 4AILC 1T5TA 4Q24A 5BVHB 1QAHA 1L2TA 1NLUA 3TMAA 4WTOA 1P3Y1 1GVHA 2DCMA 4HWSA 4M0EA 1S01A 4BCDA 3A1CA 1F48A 4HD8A 3ONFA 3MFQA 4PBSA 3KT0A 3C5VA 3H4VA 3H5RA 1K0FA 2P5UA 2PTHA 5L4LA 5BRJA 3ZZMA 4F4DA 4E07A 3QV2A 5EIBD 1L7MA 2DE0X 1ADBA 1XVTA 2CFCA 3BGSA 3KVRA 2HMUA 3VKUA 1N8NA 3BPZA 1U0BB 4IW3B 3IBFA 3LOQA 1I6MA 1VKNA 4DJFC 2JJ2D 1QH9A 4HG2A 5HXUA 2ODEA 2UZ3A 2HF8A 4YRNA 5BWMA 3OC6A 4H16A 1E98A 2WJ6A 4M9QA 3HFGA 3UC5A 4ZT5A 4I9GA 2DW4A 4UDYX 1NSTA 5B1EA 2VDPB 2QJWA 4QBFA 4V24A 4B3DA 3IJ4A 5A1JA 2HYDA 4Y2PA 1K98A 3JQRA 2Q9BA 2O5RA 2FX2A 5LZ8A 4ZTZB 1KTVA 4CLRB 3JASA 1H4QA 3C5WP 4WCFA 3DWEX 1YB2A 1N2CE 1CZHA 4JYAB 5HY2A 1XZEA 3OQPA 3CCRV 3CCJV 5ALTA 2BF7A 4MR8A 2WYHA 1E3DA 3IUEA 4RVHA 3JQAA 2GF0A 3PXBA 4IX1A 5EWJB 4WZAE 5K0CA 1J2TA 5AVTA 1KDTA 3HB3B 2Z4TA 3WLLA 4Y9SA 3AK3A 1OCOC 4ND4A 1OH7A 3CC7V 4B6JA 2I4NA 2X42A 1DCKA 2A1UA 5KJEA 3KQUA 3DZGA 1X13A 1KZYC 4LCUC 3QM1A 3HKEA 3FPHA 1IAQA 4DK0A 2PL5A 1S72F 5IXYA 4RQEA 4KR9A 1H8EA 1VLVA 4TMFA 4C3VA 4KHPB 3JVDA 3DTVB 3QE3A 5KSWB 4I5EA 1G4AE 2J46A 1NYLA 5AXAA 2XQFA 1AE1A 1KC3A 5IY5B 3IFXA 5KVQA 2MQEA 3QLEA 5ALWA 1D2EA 2ILTA 3BAAA 5LLSA 1L4YA 1H8HA 4DUZB 1MEOA 2PT7A 2D54A 4AKIA 1KH2A 4JI1O 2FFJA 4DUYO 3IBSA 5TLSA 2BFDB 4XGNA 3ADCA 2J0QA 1F23A 3CUKA 2RFLA 3ZWOA 2H11A 3G2MA 5AW5A 1WZIA 1Y81A 2YN4A 4AMGA 4U6NA 2A7WA 4JLDA 1M1UA 3STVA 5JNVA 3EQ8A 4B5KA 2FWMX 4XUDA 2UZ1A 2JIZA 2AN5A 3CNQS 4G63A 4CBVA 2XGMA 3AVTA 3K9LA 4QO7A 1YS1X 1W36B 2EC5A 2WSMA 3BSWA 3OIWA 5ENDA 3OMLA 1A96A 1AKQA 1QYCA 2G1KA 1WSWA 2WNHA 3G23A 4JI7B 1N3IA 5CA3A 1PG0A 2X0EA 1OAOC 4WZ6A 3EPJA 3EVNA 2GS9A 3A37A 1D5WA 1WW8A 3URKA 1VQ5V 5CCXA 3A8TA 1F9EA 1VJ0A 5FPSA 4CEHB 2PLNA 2XUKA 2VSQA 4FOLA 3GU3A 2E4WA 4RE5A 3I4LA 3FZGA 3QVMA 5B1NA 1ID1A 2HF9A 3FDFA 3M9LA 3TE7A 4OSEA 1G8PA 2GHQA 1ECBA 2YWDA 4CU2A 3KM0A 5EJFA 1VB3A 1VQ4V 2XDWA 5DCVA 3GLHB 2FZ4A 4G1VA 1AKUA 5K4AA 1U7WA 1UC8A 3K0SA 3F9IA 3VGJA 2BUAA 3BMCB 1T3ZA 1SPXA 2PD6A 4U2DA 1HDRA 2PV7A 4NAUA 3BWYA 3PR2B 1GD1O 2B5WA 3PUWA 1FKAO 4R8CA 4IIBA 3C5EA 3HA5A 2QVZX 2YZMA 2PMDA 4WH0A 2ZWIA 2H7VA 4BVHA 4EZEA 5BSUA 4C43A 4M60A 1P1BA 4CQJA 3KRTA 2JHCA 2IOYA 3GWOA 1KRHA 1T2VA 3VRHA 4UTNA 1B93A 1Q0QA 2YEVA 2BGUA 5CHYA 2HF7A 1L1FA 1NW9B 4UXJA 1KJNA 4A0FA 2IZOA 3AL3A 4ZCMA 3THWB 4PSDA 1JA9A 1SHLA 2IVZA 1TQ8A 4X95A 2GNAA 2YZ2A 4TZ0A 3AY0A 5U9CA 1XQ1A 4KPUB 3FI9A 1K2VN 1JHZA 5KX5B 3H7IA 1W44A 3NP9A 1VMDA 2FZVA 2D5BA 3LUHA 1X8JA 4UULA 4IYJA 4ZHQF 4IXNA 4LN1A 5IAJA 1UBRS 5T8KA 3SN6A 4L16A 1EJ0A 2OFXA 3NBAA 1S9DA 4MQLA 4V0OA 1Z0AA 2V3WA 2X7JA 4PG8A 1O96B 5G4UC 2J9FA 3TOZA 1MB3A 4RULA 3IEQA 1J39A 3P9IA 3TGLA 2FQXA 3BT7A 1WKVA 3W5JA 4HDSB 2EYUA 2YJ6A 4ZCTA 4MLDA 4BO0A 4RMJA 4ENSA 2Q2WA 5I7HA 2QN8A 2PYDA 5H83A 2ATEA 3Q12A 3DAOA 1DEAA 4N6OA 2I71A 3C2QA 3TPFA 1E8NA 2RHRA 4BNYA 2HY7A 4RPLA 4TRRA 4FNMA 4XJVA 4DQXA 3H11B 2SKCA 3II6X 1EQAA 1KC8W 1S2LA 4PQYA 1DBVO 1M1YE 2EFEB 1R37A 4URFA 4UCOA 3VNSA 1HOXA 3A2LA 4P31A 5DSTA 1K4KA 1FTQA 1ZNYA 3BM5A 5H3LA 4HVLA 2AI2A 2NGRA 3EXFA 2FOLA 4R1PA 4UD6A 2AXPA 4DV2B 2QV7A 3FAVB 1Y6RA 4BWVA 4GBGA 4UFZA 4IGIA 3F7MA 5LBQA 1CNEA 1S9HA 5TEWA 1AGNA 3UHFA 5HIIA 1XR3A 2IZZA 2V9CA 4JJFA 1P1JA 2JCGA 4LDRA 3EPRA 1RWXA 1P77A 3AEKB 1OLXA 4E88A 4PX2A 1MHTA 5AYVA 4YCLA 4TTJA 4R71A 1MKYA 3VDQA 3DFKA 1IN6A 2CWJA 4GSLA 2VP9A 3T0FA 1HGXA 1GITA 3NDJA 2RGUA 4RX1A 1HM5A 2I99A 1ZRHA 3EMKA 1SR8A 4W5RA 3SHOA 4PX9A 2AMTA 4OQZA 4BB0A 4F45A 4ZV4A 4ML3A 5EXSA 1E20A 1R3JC 5IJ9A 3B1VA 1VQ9V 2HA0A 1KC1A 3C7DB 2WJAA 2ZAMA 3RI3A 2OG2A 3MF4A 3HBFA 2X4DA 2DAPA 2REQB 3EYAA 4P4UA 5KPDA 3HBAA 3KXIA 3CW2A 5SY6A 2QUIA 3D4OA 1UBTS 4IJUA 1UMBA 4XGIA 2IUUA 2GYYA 4JUBA 3PN1A 1SWWA 4CN8A 2PSHA 3U3JA 2OUKA 1E1CB 4MVJE 4J07A 3ZE9A 2QX4A 5CA1F 2XVZA 1EBFA 3UT5B 2HNAA 5E0KB 2YIAA 3DMFA 4IIYA 2JAOA 2EDAA 2CVZA 5JHHB 1HT3A 1DBQA 3IQWA 3A06A 3NHZA 1S5PA 3BD6A 2QLMA 1AJPA 3MK31 2WHRA 2KE5A 1UM8A 1X7WB 1RDFA 1GSOA 1XTKA 1ML3A 4J4TA 2VUIB 1R5NA 5CXUA 2VSXA 3DV0B 2XKBA 1ZUD1 4LCEA 1SKMA 4RQFA 4NYJQ 2DMRA 4OP2A 3I76A 1HXHA 2H1FA 4NTYA 4OYRA 3PPXA 1KIMA 4A8JB 4HEHA 2C2HA 2W8BB 2HCFA 3OOEA 2LV8A 1GG2A 4NZ9A 2P2NA 2I4OA 4XVRA 4G5YA 2POCA 4K6HA 4CMAA 2B8EA 3TQHA 1NAIA 4PZCA 2OWEA 5KHOC 1D1TA 2I5PO 3T95A 4GOKA 1GTL1 2HP3A 3N2GA 2NQ8A 4J1NA 4NESA 3C14C 4OA5A 4WOCA 3D36A 1N75A 4I1YA 2XWJI 3QFSA 1UKCA 1A4RA 2E1PA 1J2RA 2HX0A 1MC5A 4EHIA 2PG3A 4ACAA 3PA8A 4TYMA 3JWHA 1X7YA 4RORA 1W85A 5FTMA 3FIJA 1KI9A 1F20A 2EG5A 1Q7TA 4HLUC 4UB6Z 1JYFA 3DXRA 1XFAA 3CUVA 1A5SB 4CH4A 3G0HA 2E75B 4GOMD 1P2TA 5B30A 4MH0R 5KQGA 2HRRA 1F4LA 4ETNA 4BZXA 4DARA 3TEJA 1BXGB 1K8QA 2ZIXB 1YQWA 4WRRA 1AMNA 3DULA 1CJMA 4FLWA 3R24A 3UGQA 3K1JA 3TNLA 1QH0A 3I61A 3BCCH 4C7OA 2CNKA 5TF4A 1K73W 4P3XA 1EI9A 5FIUA 3ILHA 4OQPA 2PRYA 4N39A 4DLZA 2W2TA 5I7AA 4G85A 4P2ZA 2GBCA 4RY8A 4UCTA 1WP9A 4HLCA 2HRQA 3N2IA 3FYUB 1P6XA 2QE7G 2OCPA 3GFRA 4ZIRB 1A82A 1P75A 3IVRA 3COJA 1L7RA 3CO5A 1KI4A 4J9UE 4RXMA 3KU1A 3VR4A 5TQVA 3P7MA 4LNHA 1U40A 1UPAA 1AROP 3G0DA 4BFXA 1JTEA 1O94C 2JJ8A 2J4DA 4DNPA 3FB6C 2XHBA 3SQDA 4WLVA 2A3QA 2J3QA 3QBVA 1NVPD 5JH7B 1IJFA 3P9RA 3Q40A 2Y3IA 3NHSA 1GR1A 5GJBA 4FCTA 3BK7A 1NUPA 3IQZA 1VRCA 3VZBA 5HXAA 4NU8X 4GX5A 3CW8X 1RKBA 2W0XA 1Y3IA 3PU6A 3PFFA 3DLAA 1JQ3A 4QD3A 1IEWA 1JDPA 3HCFA 1NOIA 1P2BA 4QG7A 2GOYA 5HJEA 1DJNA 3P8ZA 2GD2A 2IBTA 1KAMA 1XC7A 1CXZA 4BQSA 1NQVA 3SC2A 3LF1A 4R98A 2PAFA 1U11A 5G4LA 3LY5A 3WTCA 5EAZA 1EQUA 4DVJA 5EL0A 3ABIA 2BBOA 2FPKA 1B3BA 4US0R 5TR9A 4N6NA 2BCJQ 3UHJA 2BEWA 1TC1A 2AD5A 3BZWA 4LHEA 5C1OA 3WHKA 2V0GA 1GPYA 4EG6A 2O2EA 5FLXN 1M6VB 3BQMB 1B3RA 1LZKA 2VZ8A 1MIOB 4BRSA 5B6PA 5BWLA 2VTBA 4N48A 5JV5A 2F23A 3QLTA 3WMEA 4B09A 3HKBA 2R5WA 1XRMA 2HPAA 3ZTYA 2C42A 1QIJA 2Y0EA 3ILXA 1L6RA 4YROA 2BBWA 2NZXA 3FCUB 4QFMA 1G5HA 2P40A 4N5MA 1L7DA 2YOHA 2UAGA 1XMJA 2VJOA 3FWHA 2FQQA 1OCCB 4LX0A 1ZHOA 2Z9DA 3C6MA 4FFNA 4W63A 1DCFA 4G0NA 5FBRB 3JARA 1K8AW 3IUSA 4TMWA 2YQZA 1BVRA 3K72B 1JQBA 4U5XA 4G9BA 1U3GA 3GF4A 1UJ2A 1H38A 3T06B 3DQQA 2DYYA 3BXPA 1U8ZA 4KIFA 1VOTA 2R00C 4LCKA 1GKYA 1DSSG 2RD2A 3VPHA 1QP7A 6ABPA 1XEAA 4BB6A 1VRVA 3GRCA 4MYUA 2B8JA 2CE2X 2GM9A 5BO5A 4HH3C 3HAXD 3R9XA 1UBJS 3C3XA 3ELCA 3NHAA 3SDSA 2JK0A 1H8ED 4ZIBA 4YJHB 3VI4B 3LS2A 4B5LA 1Q95A 5JQWA 3W9SA 4D3YA 1LC3A 1A2QA 4GXTA 5A9SB 3UWPA 1MMMA 1G60A 2CN1A 3ITEA 3FD6A 1KQFA 4G0WA 4IIJA 3JAKA 4K3AA 1PZNA 1Y3FE 3MJSA 3ZMSA 1U9IA 1H8HD 1Y67A 3RYFB 4BBJA 4L72A 1U1GA 4QYXA 1PT8A 3UCSC 1CP2A 4FE4A 3FUXA 4TUYB 2IYLD 1QMPA 1V26A 4P5PA 4CQMA 1V7CA 2BV3A 4YFYA 1YJBA 3QTLA 1TUEA 2PX2A 3DFMA 3LX6A 1KK3A 4WX2B 5IKEA 3VV2A 3CP1A 2ZD9A 1OYYA 1IBKO 4DT1B 3HDJA 1HW7A 4O4HA 1YHNA 3WNVA 4XFKA 1FW8A 4CI0B 1SEPA 2QXTA 5CEEA 5ALVA 1RQPA 1KYQA 5AVMA 5AW1A 2D74A 4BV8A 1ACLA 3VYTB 3VTKA 1P5ZB 2ZW9A 2JIZD 3ANMA 4C0QC 4NMXB 1PVVA 1PJLA 4FFBB 3L4JA 1KYTA 1QU3A 5J43A 4PSKA 3HCDA 4JZ2A 2JVJA 3V2UA 1CD5A 1C1YA 2EQAA 1AKMA 4D2IA 3E6AA 4JLBA 3GELA 2BZ1A 1SOMA 2O07A 2WWWA 1V5IA 2ISSD 1W9MA 4AX8A 3LYBA 1T9CA 4G0OA 3BF7A 1O95D 5FTNA 3P9SA 3R0JA 1XJ5A 3AVOA 4OX9Y 4MQFA 4EB8A 5A7GA 4Q05A 4CZZA 3NYQA 4OD0A 3WDSA 3HKDB 1M6WA 2YJNA 2PRZA 3OCYA 3TECE 3ZGNA 4BNJA 2H18A 3OFNG 1WQ4A 3HB1A 4Z7NB 3AIKA 2VPXA 3M0EA 5A4FS 5JJNB 1Q1QA 4DPMA 2ZXFA 5JJCA 3PXXA 3JSNA 2Z1DA 4FD3A 4GUDA 3QWIA 1K7YA 3T1OA 1E3SA 4ZT2A 3VC7A 4TYQA 3HXLA 3OTOB 2HS3A 4K9LA 4UUQA 1WB7A 4EO4A 2VJCA 4RV5A 3GRUA 4M9RA 1IPHA 3LLCA 2WKWA 4G97A 2WWRA 4TS9A 1SKUA 3K16A 2ZDHA 1Z13A 1KKDA 4AW9A 4JJ6A 1CYDA 1SQXH 1NHWA 4YCBA 4JYZA 4D6PA 4BMZA 2DQ3A 2Z5LA 4F71A 5EJEA 4BO6A 4B81A 2BHTA 3V32A 1NN3A 1NJ5A 2PM8A 3EOBI 2R84A 3LSTA 3OETA 4KV9A 2K87A 3I2YX 1LRLA 3FPEA 4ZT3A 4G0UA 1TMKA 1NXWA 2FB9A 1DG3A 3S1SA 4CETA 4DRZA 4TPKA 4XE5A 3TM5A 4UAGA 3VJKA 4E12A 4ZXPA 4MWTA 3FOAA 1I5OA 1ESDA 1DAMA 4Q9NA 2SCUB 1QAOA 1P6UA 3ZTTA 2QVBA 2GTAA 3DLPX 3IVGA 2NNUA 3V7FA 3O1HB 4M99A 3SS9X 2FZLA 2B33A 1SIUA 3VMFA 3ZU2A 4CMKA 1JQ0A 1G3MA 2VAVA 5EJ6A 1G7CA 3ZIAG 1JHMA 4IFTA 4C7JA 3H6HA 2RARA 1QIDA 1G21E 2QLFA 1XWFA 4D3SA 3EX7C 3CCQV 4PYLA 2R8ZA 2OV1A 3G68A 4YP5A 5CURA 1UFYA 5KJ6A 1OYVA 3RTAA 1OFIA 3VPAA 3NI2A 4N65A 5A9TA 3WLJA 3U4IA 2B35A 4RETA 3FSJX 5I4IA 1L7EA 4G01B 1E9RA 4JI3O 1VMGA 2QMQA 9LDBA 3Q9UA 4JDPA 3UICA 3JQEA 1IDOA 2PUJA 3GDOA 4FT2A 1Y74A 2VZLA 4C6TA 3FLBA 1WP8A 3UAWA 3B1WA 3M1AA 5PNTA 1OVGA 2Q1TA 3VNVA 3HCRA 5TRTA 3KWMA 2JKVA 2XDYA 3OBIA 4H3VA 3L72H 2FZWA 4JPRA 2PT9A 4PHGA 3L0YA 4AWAA 3T99A 2HJRA 2E37A 4EK9A 3W3AH 4NU0A 3GO4A 3D3EA 2W6JG 4DXAA 2WIFA 2DPMA 2AE1A 1NPYA 3QWAA 4X9XA 1VF5B 1Z0KA 1T3SA 4EA8A 4E09A 1HBJA 1JMYA 2XH8A 2P91A 5IN5A 2DBVO 3WJRA 1KOLA 1YQTA 2CDYA 3Q11A 4N0EA 2UXBO 5FUMA 4B3MB 4UCRA 3HDQA 3O8QA 2QE7A 3STUA 5C8XA 2WTMA 3V8MA 3OZDA 2QUHA 5IM4F 3F47A 3FYTA 3RU7A 4MITA 1LBIA 1NUSA 4B6SA 5TVKA 2BFBA 4O1HA 2Z9BA 4DAOA 1ZUWA 4OOFA 3QI7A 1XXLA 4WJZA 4F2PA 2NMVA 2QJTA 2PKEA 2X58A 2DBYA 5ALZA 3DO8A 3HMQA 4FFRA 4AXXA 1ENZA 4UDNA 5EYPB 4LJSA 3O95A 4H6WA 4R1TA 1G4HA 3EMVA 3OJLA 2AYZA 3ZKAA 1BNCA 2BLNA 1SU4A 3OG9A 3QE2A 1SUCA 1LPNA 4A15A 3C7KA 2IC5A 1AG9A 3WLMA 2O7NA 3ORSA 1Y76B 1TYZA 3ZWQA 3A4VA 5AVZA 3VR3A 1ZN7A 3GOQA 4XIJA 1CW2B 3TJRA 4DKXA 4CV1A 4FW8A 1PF5A 2X2FA 1Z2PX 3VI3B 2NSJA 3B51X 1AXEA 2R1TB 1A7UA 3H19A 3Q87B 2QLTA 4ECEA 2MJLA 5E9JA 4U7OA 4XPZA 4UPVA 3PA6A 1SOWA 1R5JA 3N6VA 2HHHO 3OZRA 2ERXA 3R3HA 4MVUA 1QO9A 1KDOA 4A2CA 5C5IA 3KJKA 5BOSB 3PC8C 3DLCA 1VGRA 5J9FA 3R7SA 2WM9B 1SN7A 3I72A 3WXMB 1YKGA 1H6CA 2HLHA 5J2UB 4OBEA 4MA5A 2IXAA 1C2TA 3KR9A 1RU3A 2IU4A 3CH4B 2NWQA 1ZK4A 4X0EA 1I1HA 5AK0A 5BN3A 3DWIA 2IIQA 2QBYA 4DRYA 1GZ7A 3GT4A 4XWAA 1S8AA 4AJKA 1V9CA 3G1UA 3Q2IA 4YS6A 4O4HF 3INYA 2JGNA 3GPCA 1U31A 4B43A 3MQFA 4ZGWA 3IIIA 2IW5A 1X9IA 3T94A 2AW3A 3R4VA 1JPJA 3U7QB 2X7HA 3W6OA 4DV0O 3NV9A 1XUOA 4BMVA 5BR8O 1M74A 1KERA 1P5HA 1JN0A 1XDCA 5IXJA 1PDOA 3IR6A 2X9GA 3JVEA 3RJ9A 4EW2A 4AECA 1LDMA 1JDBB 3KZIZ 1ETHA 4JI1B 2Q5ZA 2PQ6A 4DA9A 3SQNA 3AG5A 1X6VA 5KEIA 4WLEA 3H1PA 5JZBA 3L8CA 1HYBA 1B43A 1L7VC 1RFYA 4MJLA 3D02A 4OBBA 1E58A 4ZICA 4BP1A 3TKYA 1NBOA 4TN1A 1QD9A 1M73E 1W87A 5JSYA 3O91A 2C4MA 1Q19A 3S03A 3B6IA 1EG2A 5TISZ 1NM5A 3ELUA 5IHPA 2BI4A 3QHDA 3DEHA 3L79A 3SR0A 1FP2A 1ULZA 3ZPXA 1NQXA 3K14A 3JD0A 3DDHA 2J59A 4E6EA 4UNRA 3G5MA 1IJKA 1QNFA 5CJPA 4WXPA 2NYUA 1QR9A 1PFGA 4YCNA 1A0OA 2AHOA 1TZBA 1V4VA 4EOGA 4W82A 2ATXA 5G3YA 2ZRAA 4OLHA 1XTQA 5FQNA 1EH5A 4M7OA 5HQJA 2RGCA 4RNDB 2OK7A 4WOJA 3HRKA 4B4WA 1BXZA 3KUXA 3E7XA 2VGNA 1J0XO 4R9UC 2GZHA 1NKVA 3FBGA 1WL8A 4MW2A 4MYCA 3V8PA 1EX7A 2YY5A 3E5NA 4QFDA 5DBFA 1TK3A 2G82A 4Z9FA 4YUWA 3SYMA 1QZUA 3AFOA 5CFRA 4RIGA 1EVJA 1K7DA 3L6DA 1IBCA 4B6QA 4MAFA 3TPCA 3Q6NA 4HDAA 4Z3DA 1C8BA 4B6RA 3QITA 1YJ9F 3GN1A 4GUAA 3NOQA 4CW7A 5C35A 2P41A 4I55F 3RBAA 4QPKA 3A58B 1Z6TA 4IOKA 1WPBA 3NB0A 5JAPA 2RB5A 4ZEXA 3K15A 3ZZTA 3E9MA 5T7BA 3GZJA 1HSZA 5EP2A 1JDVA 2YVAA 1UFKA 4OKIA 3O85A 1XJQA 3PVCA 4FMBB 4GLFA 4XDLA 1W5AA 2ZR3A 3H2GA 1RMQA 2BSXA 4P83A 2DLDA 3HRIA 2D13A 4NMMA 4PC1A 3WV4A 3AWIA 3M7MX 4MVZA 1LSJA 2EOAA 3CXCF 2JEXA 5F3DA 2G9UA 2PZGA 1PK8A 1W57A 5H5JA 5IY5C 4BQOA 1O97C 2NPFA 1RPRA 1J8YF 3B3FA 1T36A 4E2LA 2ZBRA 3ENKA 5KIAA 2XHEA 4HNSA 2BFMA 4LJ8A 3HO6A 3OFNA 2E6UX 2G25A 2GKGA 1E2QA 3MLEA 3EIUA 4RPCA 3R0IA 4NZNA 1Z4PX 3AXTA 1DC6A 1D2HA 4KN6A 3AH8A 3UIEA 1EJBA 2RB9A 1FFXA 5CCEA 3U09A 3DLHA 2GCOB 4F04A 4RK5A 3K35A 3UMGA 3ZRVA 1U8AA 3LM8A 4NECA 1SCJA 4AS1A 1GGNA 4DR1O 1FEZA 1DFIA 2X0LA 1V16B 5EHXA 1DE0A 1W36C 4GPZA 2VJNA 5DISB 4C1BA 3VAYA 5ILGA 2QTZA 1XCBA 4Q7KA 4DCJA 4XWOA 4QZVA 2IHYA 3NHBA 4HB3A 4J1SA 3KQKA 3PFWO 4M1ZA 3ISTA 5CLIA 1Y37A 5I9SA 1C29B 1TYDE 4N3NA 3E0QA 4CYMA 1YMUA 4CH6A 2JZCA 3G6WA 3O92A 2HBYA 5M04A 4HVCA 2EBWA 3FTDA 4A0HA 1QX3A 1GPH1 2BGNA 2O6HA 4ERNA 3IV6A 3PNQA 4XKJA 4YDRA 4S1NA 3KEQA 3L7IA 1MX3A 3DVAA 1Z37A 4J90A 3A1DA 5ALPA 4PQFA 4CS4A 1PG5A 2B5OA 2LR0A 2FSFA 2O4UX 2O2CA 3PE6A 4JK3A 3K70B 3UJ3X 1JXQA 1SUPA 4PYNA 5FCDA 3ZIAA 1XK6A 3H1FA 4UTVA 4UBNA 1USUA 1SHJA 2A9PA 2VF8A 2JNBA 2YDXA 3F3SA 5KTKA 4DIFA 3WJ2A 1KKLA 5K8TA 4EA6A 2QZ4A 1WY7A 4NDZA 3LC7O 2PGDA 1NS1A 5CVTA 2JW5A 1IHDA 1ADYA 3DEJA 2BJHA 2H85A 5CEJA 3RW0A 1KMNA 3KB6A 3FWYA 4NMWA 2DQYA 4XDHA 1NQ3A 1FNSA 3H5NA 4DV5O 4EL0A 3H04A 3G5AA 2H52A 3KR1A 3BRSA 2GH1A 2IQIA 4BZQA 4OBXA 2Q5FA 2A9OA 4B35A 3EVKA 4Q1DA 2ZCVA 1N5DA 4HUQB 4EFDA 2OESA 1M2VB 5CFOA 3BSSA 1FOEB 4NXNO 3H9BA 4A36A 3CCRF 3CCJF 2COEA 4RHFA 4MCHA 2W6JA 4MV5A 3UTDA 1T43A 1BJTA 4NBRA 5EN4A 2Q6LA 3E0XA 2D1RA 1EVIA 3TSAA 3DDSA 3CC7F 1UPFA 2V5AA 2GWHA 5AT1A 3WY9A 1DRKA 4Z4FA 1VI2A 3E23A 5C8YB 3IPYA 4KFUA 3IDAA 2V9PA 3ICWA 4RF3A 2XB6A 4KQIA 2I8CA 1C4XA 1KNQA 4XA8A 4FMTA 5EHGA 1A9XA 1BEEA 1ZVQA 4DN6A 1CR1A 3PFKA 4DBLC 4MVOA 4MB2A 2ZB7A 1RKUA 1Y9ZA 3KIPA 4LWZA 1UPTA 2X1HA 3U0ZA 1SWVA 5CXXA 3AJ8A 3VO1A 1AJEA 3L6UA 4LF7O 1DL5A 2AQHA 3BGOS 4D3FA 5CDTA 3F5TA 1IHPA 4F4IA 1HL7A 3MBOA 1NA5A 5AJYA 2P75A 1JJAA 5GVRA 4FNGA 3ETCA 1NBEA 3D59A 4Y8VA 4EKWA 1W8IA 2L2QA 4DR6B 4N5NA 4X7MA 3N2KB 4ZOAA 5I7WA 2G38A 4QT4A 3VYRB 3Q41A 3DPSA 5DP1A 4JLOA 5FOVA 4PNZA 4WKOA 1MO6A 3OT7A 4G5RA 4DKJA 1AKRA 4DSOA 2DG2A 3V1YA 4EY6A 1SXJB 2HLPA 4M76B 3K0TA 1U0OC 1KXZA 1E1KA 2IP1A 3Q3JB 2JLUA 3OMIB 4EG3A 3OBWA 5C8VA 2FDCA 5FD8A 4W1QA 4RH1A 3CCFA 3Q3HA 2JGEA 1ZMRA 3ZHZA 1J2YA 4B7XA 1UKVY 4RZ2A 3U40A 5JYDA 5BSKA 1KOFA 4GOND 2I87A 4A73A 4LF5O 1O89A 3F0DA 3RWMB 3H1AA 1SQ5A 4YRDA 3VUEA 5FPHA 3IQFA 4H18A 1RM1B 4AP5A 4ZHQA 1NU1H 4QGFA 2XYHA 2DHCA 2IHBA 5CYGA 3WHIA 4E5DA 3E9RA 2IU3A 3NM6B 5EQJB 1VQ4F 1J5EB 4EH1A 2EZPA 4X41A 4EATA 1SB9A 3G5LA 2IUYA 3G8CA 4P7GA 3ZWPA 1TYEB 2OYCA 1SAYA 2LDBA 2GDZA 4HDRB 5K0GA 2JD1A 1E9VA 3I8SA 2IEBA 3Q3EA 4A27A 4ZMBA 3CF4G 2ERYA 3LQYA 2G3YA 2IYPA 1VQPV 4J03A 4X54A 2YW2A 2FF5A 1Z2OX 1WB9A 4CODB 2FSPA 1L4UA 2IYZA 3HP7A 3DOJA 4ICGA 3N8KA 5GV7A 1ZXLA 4N54A 1ZD8A 5IABA 3EWNA 3MGKA 4URYR 4X66O 1Y6FA 3MCQA 4BO2A 1SCDA 1XREA 4NZZA 3TLEA 3MCUA 4M87A 4A0RA 4P0TA 3ZZ1A 1ZH0A 3HU3A 4DNXA 3CVXA 3A4IA 3GEMA 2FMKA 5J4HA 3E1GA 1P60A 4AUEA 1IY2A 4O29A 3W7VA 4CFYA 2YIMA 5HE9A 4WEOA 3TDNA 5FLXA 2XODA 1ZUNB 1VXOA 5TE9A 4FIZA 4M1QA 2EKQA 2DULA 4G2NA 4A8JC 3MWEA 3F3KA 3NDPA 3QXJA 2W8BC 4U7NA 4UDOA 2AKYA 3E3OA 4WUTA 2J4CA 4AI8A 1JKXA 3IAYA 3D5EA 5BY2A 3IDOA 3N7TA 3EK2A 1Z8NA 2VOJA 3RVYA 2QE7D 4GMDA 5IE9A 1SBIA 1GZDA 4TKZA 1YBMA 1MXHA 5CW2A 1GCGA 2ZIZA 4F4CA 1DT5A 3P2JA 3KELA 4D9HA 3PIIA 1BX0A 4ZKDA 4G5GA 1GKUB 4ZOEA 1ZRNA 5JAZA 1K3UB 3JYOA 4I08A 2UUBB 1T2CA 3TX2A 3T7EA 3LW7A 1YJ5A 3HJNA 3OU7A 1GUZA 1TJNA 2F8LA 1ZM4A 2CTQA 1YRAA 4NYIR 2EULA 2GUZA 2YWXA 1VQLV 1E18A 1FXHA 2QI9C 2VHEA 2CYBA 1OGYA 5DGXA 2EAUA 3FRHA 4B33A 1WPRA 2C4HA 2OM2A 3B6JA 3QTYA 5CNKA 3ZDDA 3AY3A 4KX3A 2X41A 1H69A 3BIJA 4TOIA 2QKYA 4BGUA 2R86A 4WN3A 3VR3D 1V3UA 2G36A 1OJHA 1U7HA 4LX8A 3AFIA 1R5OA 4BZPA 2HP8A 3CLUD 4MSUA 3UG6A 3GN2A 3V7YA 2FPGA 3STXA 1YR6A 5H6QA 1WXFA 3IDQA 3GBVA 2V7WA 4JOQA 1ZC4A 2FX5A 3CNLA 3DAFA 3E3LA 2E18A 4EY4A 3DTNA 5JAUA 5CA1A 5IJWA 3FYUC 4QJFB 2CGEA 5KU7A 1S2GA 5JQGA 2J6HA 3WAJA 4TQ9A 4G8DA 3CX3A 4IDPA 3E53A 3NBUA 2IZ5A 2G07A 3T1YO 5ECDA 1QGZA 3T9BA 2EKLA 2BW0A 4BKUA 5M3BA 4PA4A 4X00A 1FNMA 3BMQB 3ROZA 2BKVA 5CG2A 2I2WA 2WUFA 4ZDWA 1XL0A 5A2GA 4JSTA 2DT5A 3DP9A 3ZCTA 1NURA 3T38A 4CKYA 2AVDA 4PSUA 3GDGA 1YRBA 1QG0A 4CKWA 5IZ4A 1KVRA 3P20A 1X3SA 3TW8A 2DQ0A 3ZS8C 4LE0A 4UPEA 4UTRA 4J1QA 3D0OA 4PFKA 1K7EB 2D5IA 2WF6A 4GW3A 3KX2A 4DYVA 4OO3A 3CFYA 4WVFA 4JLKA 4MRSA 3WQBA 1MB9A 1MNGA 4I4IA 5ER6A 1W4LA 5IUNC 3LWZA 4G1UC 5HPYB 5DW3A 2BFEA 1VQ9F 1OX6A 3WJ1A 4ADSG 5AUPB 1I6WA 2N75A 3LFUA 4L3OA 3F6PA 3RLIA 1R5BA 1XROA 2YV5A 1OSNA 2KGWA 1Z5PA 5ULLA 3DW1X 5TQ0B 4DSAA 3QKRB 3NHMA 1Z9BA 5DMXA 4CXMA 4OB6A 1JX6A 1IBKB 3KL2A 3SPJA 3KBBA 2XUIA 4NJMA 3KZXA 1ZU4A 1UR5A 2RGXA 3P94A 3O9OA 1XMPA 4E7PA 3UW1A 2CL0X 2QAJA 1I2MA 1QGUB 2XMZA 1YC5A 4UVBA 1PJ2A 1SZQA 1CUHA 2Z08A 1O95A 2HJ9A 2BGRA 1V5FA 3TUZC 1F7YA 4XAQA 4B2LA 1Q20A 3F78A 3RSSA 1GCOA 5I47A 1U5BA 3REQA 3K8QA 3Q7QA 2XD9A 5EUBA 1T34A 3D9QX 5BOVA 5CBFA 1NF9A 1E2FA 4ZANA 3THXB 2BEVA 4X5OA 1VJDA 3NOOA 1XEWX 2OSBA 4MIKA 2P6PA 2W2QA 1WMSA 3IE2A 2PKWA 1PW7A 1C4WA 4QUBA 1HDXA 5DT9A 1TIBA 1CUFA 2VDOB 3GI1A 3N8HA 2ACKA 5DTIA 4BJ3A 1A7AA 5I6DA 4GRIA 4U2KA 3D6HA 5HX7A 4YMIA 2J87A 1Y5LA 1VMKA 4LJ4A 1FTYA 5F3WB 4Q34A 4XWTA 3D6FA 1OCCC 2UYQA 2P90A 1R3DA 3RHSA 4Z54A 5C8DA 3G6KA 1BGXT 1WLSA 4JA0A 2QMHA 1PNQA 4XQCA 4CG2A 2FCAA 3A0RB 4AU1A 1NTOA 3ZIDA 1H9BA 1PHRA 3KVOA 5CM2Z 5IF3A 3R3SA 3RASA 4YRAA 2FV8A 4RVOA 5FUVA 1GUAA 2ZUBA 1EWVA 4X63A 2IYYA 2WILA 4HAMA 3C0KA 2JS7A 3NKFA 1WMEA 2OIGA 2P0YA 4AS3A 5CYPA 5FTJA 2I3ZA 4B7ZA 3JTMA 2LO1A 5JNLA 1KKUA 4Q9DA 2JAWA 1K68A 3P1JA 2BDEA 2D5LA 3D3WA 1C8LA 2CXTA 2HQOA 2LNDA 1NQTA 2V1DA 2L0XA 3ZV5A 2A4KA 3ABRB 3TXQA 1Q0SA 3H9QA 3LDCA 3HSSA 1E7MA 4A7PA 5EERA 4JLNA 3I7TA 5ICEA 4ZVMA 1TGOA 2P9JA 5JI3E 4O63O 3C6YA 3OHMA 3GAZA 3OFSA 3OFND 4WXYB 4MW1A 5ERXA 3GK3A 3H1EA 5LQKA 3GEGA 1Q82H 2TMYA 3KB2A 4WKNA 5FLKA 2B9EA 5F2KA 4MIEA 4OHCA 3ZW8A 3ENZA 4KN9S 1BW9B 4EM6A 1GN4A 3RUCA 1JFTA 2BFOA 4X1IA 3GP5A 4QYMA 3VYTC 4Q39A 4XEUA 2G06A 3WBFA 1YUMA 5JD5A 5E9AA 3WLNA 4BN5A 1UFRA 3F2VA 4URHA 2H4HA 2MOKA 2WINI 4EABA 1UH5A 4OPAA 4BVQA 2B9ZA 4GLLA 3N07A 1BZKA 2ZBFA 1Y33E 1IBRA 5JWRA 1UP7A 3MDOA 4OJKA 1I6LA 1Y4DE 3TTXA 3X1ZA 1M7BA 4GT1A 3PE4A 2P0EA 1G21B 1EFPA 3UGKA 3LW8A 1QHHB 4FMCB 1N2JA 3AKYA 3AR8A 5DHPA 2O14A 3KD3A 5SZHB 4TQAA 1V96A 4MQMA 1J7JA 2QX9A 3C1UA 3MUNA 2AYYA 2Q4EA 3ERCA 3DLIA 4CKZA 1OPRA 2Z4SA 3ZIAD 2WJYA 2A0WA 3DV2A 4C5CA 1CTQA 1EFCA 3ACDA 1RYDA 3EW7A 2G04A 5FI3A 3T2MA 3BA1A 3GP3A 2C03A 4GQAA 4EECA 4LH7A 4IS3A 4GGOA 5LM3A 3B9RA 2EX0A 5L3SA 4Q66C 4DYHA 3PJEA 1T1SA 4FZVA 2H7XA 2OBNA 4PPYA 3RUIA 2E82A 3TQQA 3H3FA 4ZAVA 1N4AA 5CX1B 3I52A 3CF4A 2GDJA 3ZJ5A 5IYZF 5E3JA 2J3EA 2GCPA 1N2GA 2OK8A 2ORED 2VSFA 1ZBQA 1YS9A 4UEJA 2ACWA 5I7UA 5JQGF 4ZVTA 3T3EA 2H4JA 2O8FB 4HDMB 4JKYA 3JQCA 1D09A 2ETXA 5EQTA 3TD9A 5KU1A 1Q74A 3D6AA 4B3FX 3DTYA 4EI8A 2VDWB 2Q7GA 3UJ8A 2KKWA 1Q22A 3I2FA 4L9AA 5BR7A 4NCHA 2W6JD 4DMFA 3U4HA 1GLVA 2JCSA 3ZHXA 2QPTA 3DGEA 2A86A 1GG9A 4F3RA 3RVOA 5KTRA 2XA1A 2UUCO 1SXJE 1NW8A 3EZXA 4I7ZB 3SBDA 2HHHB 3GMIA 3O4VA 4DNOA 3P2MA 2R6HA 3W7XA 4X45A 3CW9A 1DQNA 3C8ZA 3K5OA 3M1LA 4MDHA 5JEEA 3SE0A 2DEUA 4FLYA 2BGLA 1C3OA 2QYOA 3QW2A 3EGDA 1PBNA 4MI9A 4FVTA 1SOUA 2GV9A 3TRJA 5LU8A 3T5AA 1VTKA 1UFQA 3ED5A 2GPYA 3L18A 4D9IA 4Q3KA 2H8GA 2A9FA 4PI0A 2X3FA 3MXOA 3HB7A 2BM9A 1WXQA 4I6JA 4Q03A 3LVQE 4R7TA 4PTYA 2QTVB 4C0JA 3UK2A 1QJ4A 2CCJA 1B76A 4L4XA 4RTNA 2W2LA 4F0JA 4F1KA 1CERA 1DF5A 3PQEA 3WRVA 5E6UB 1BHBA 4CDNA 2Q0SA 3SP1A 1RP1A 3TLXA 3LU1A 3DR3A 1M6HA 3WICA 1R0ZA 4XB1A 1M7GA 4URWR 3WDLA 4QE7A 2BTQB 2BSKA 1E1DA 3S27A 2X9VA 3DD5A 2RE8A 4P9PA 4NV0A 2X14A 2PTMA 2OR3A 1CS0B 2RK3A 3TI9A 2WIBA 3ON1A 5DYTA 2Q68A 4L57A 3N87A 4FGUA 3KQLA 3PTZA 3LC0A 1OWPA 5FL3A 3GJ4A 1G8KA 2I62A 4FBGA 3K0FB 3E5RA 3SNKA 4H0CA 4DLTA 4BLWA 3U7GA 3ANNA 3TBKA 4OL0A 1XXHB 4OAQA 2VEDA 1QCDA 3CSDA 5FTLA 4FZ1A 3CCVV 2B4KA 4QYTA 4YLEA 4AMZA 3ME5A 3ZDXB 1K75A 1FUKA 3Q9LA 3E70C 2DX7A 421PA 5HOQA 1DADA 3KYDB 2O0HA 3VPFA 3HR4A 2WU0A 1EUDA 4C3ZA 4NNOA 1DX6A 3NAGA 3PWSA 2DVMA 2HI0A 3P97A 4AN0A 1N0HA 2FXVA 5CJJA 1NT2B 3FFQA 3UENA 1QGAA 2QDOA 5AKIA 2AMJA 2YWCA 4YRCA 2UYNB 4EG0A 1JY8A 3TLGB 4YA6A 2BFAA 1A76A 1RPAA 4A4DA 3IPAA 5IDQA 4W5JA 4E94A 2AFHA 4NE2A 2II6A 1IN8A 5EGNA 4L5AA 4DWVA 2FN8A 3STLC 1VKRA 2JBHA 2NYVA 3K9FC 3EVFA 4K2AA 2CJYA 3B1XA 1Z4QA 4N0QA 1Z2GA 2FVYA 1RJGA 1M8KA 3RS3A 3GEDA 1NYTA 1PV4A 2V59A 3BHPA 1T5LA 2ZT6A 5K6TA 4DIMA 2Q3CA 5C1DA 1N4DA 2QRHA 1E9FA 4EGAA 1CKEA 2YJZA 2ZULA 4L5IA 5BW5A 1RS0A 3EGXB 2BJWA 3NRCA 1E0SA 2OV4A 2P2YA 3CM0A 1P7VA 2XXAB 2AX4A 3HCEA 4Z0TA 1G8GA 1EK1A 5K99A 4EAQA 4YUZA 3VKFA 1YNSA 2RAPA 1ZU5A 5AW9A 2H94A 4D4IA 4M37A 4QXPA 4ZVLA 3R7NA 1BJKA 1JPVA 3OPXA 1T13A 3AERA 3NP7A 3RYTC 3RJTA 1W41A 1LBHA 2JRCA 2Z2JA 2BPOA 1NJIH 3C6ZA 5IAEA 3UV6A 5BMVF 2AQKA 2IEDA 3VYWA 2V7BA 1Z0UA 5DHFA 4NV3A 2CNOA 3ZHVA 4BV9A 4E5PA 2ZAIA 3ZU5A 5JOQA 1F8GA 1JDBC 4HYEA 2JLQA 2LVBA 4YK7A 3T7DA 2I80A 1IMOA 4PRLA 5IM4A 3CCQF 4DLVA 3ZE0B 1ZAYA 1ZM2A 4A2PA 4EJ0A 3Q0IA 3TLKA 4J7KA 3EVCA 5FO0A 1XTPA 1YR9A 1CRZA 2M6YA 1STOA 2W4IA 4PPQA 3ZK7A 5J59A 1T5IA 1RBMA 3CVWA 3AG1B 3MCTA 4JD5A 4C0AC 4W8GA 4NCJA 3M6WA 3OT1A 1I0ZA 4FFPA 1QZ3A 1ZLXA 1TLLA 2AOTB 4G5OA 3GCXA 1NW3A 3C87A 2AEEA 1DJOA 3U1VA 5FLEX 3K9WA 4MWBA 3PVZA 5B4UA 2EKDA 5JMTA 4FP9A 4IHQA 4TKUB 4XI9A 4MV4A 3FZYA 3Q8XB 3E8MA 3V5NA 2BH2A 2C2YA 1BWRA 4S2EA 5AG2A 2A4MA 5G0SA 5C3UA 4JU8A 4MNTA 1SERA 3EH2A 2IUTA 1YK1A 1YNOA 4JJIA 4YO8A 1HURA 3RYCB 1OHHG 4W1PA 1O08A 1IXKA 2EINB 1CY8A 3RREA 5BT8A 3AF2A 3MJTA 3TIGA 4I1PA 3L7KA 1X42A 3LY9A 1FRNA 4I5SA 1HC7A 2PZEA 3NHJA 3ESJA 1ZEMA 2RBEA 5JR3A 3W2IA 5DP2A 3KQVA 3P4UA 3QU2A 3N0XA 3WGOA 2NTVA 3SXPA 1W8DA 2IEGA 3LXUX 5TT0A 4OJTA 1CIVA 3KYCB 2IE0A 2JGJA 4TTSA 1QE0A 3CINA 4QE3A 3JR7A 3RRFA 1P4GA 1WDLA 1YE8A 3JQ7A 1PQ4A 4N0PA 5G0UA 3FOCA 4JL6A 1GO2A 1X1SA 2AUTA 4YX9A 4ZZIA 1X2EA 1JQLB 1NBWB 3FFAA 3ZXYA 2IXBA 1OI2A 5A05A 1VCIA 2VYFA 1SUBA 3NOXA 3MWJA 2NU7A 4S0XA 5JSUA 4DV5B 3H2SA 3AEUB 3RRJA 4Q9HA 1B6GA 3D01A 3NDIA 4DJJA 4UVCA 2F3PA 1OZGA 4U7HA 3PHGA 4JY7A 3K8ZA 2ZG6A 5FJJA 3DJFA 4L27A 1RC8A 3H1TA 4DR2B 4G07A 5CITA 5FA6A 2SKDA 5BR4A 3LHDA 1VCNA 3JR3A 2I2AA 5BXZA 1C0IA 4NR0A 3ZQKA 4Q3EA 4WFGA 1ENYA 3HGQA 4H44B 2O0JA 5FFFA 1XSEA 4NXNB 4J2TA 1OAKA 4B85A 1CJUC 2BFPA 3KTFA 2ZUCA 1CRWG 1GY8A 1YVWA 1D2AA 1JJFA 4N3BA 3WTBA 1QLEB 3EBPA 5EJ9A 3HDVA 2R7NA 2OCIA 1F4NA 1RZ3A 1ULBA 1Y1TA 3SFZA 1IN7A 4QPPA 1CLUA 1HT1E 2OBFA 4X1YB 1R0BA 1XALA 2GXUA 1VCMA 1J42A 4BEVA 4O4LB 2QGNA 3WNBA 4JB0A 2NPOA 1Q5OA 4FFSA 3DZCA 1WUHS 3ROTA 2OKGA 1R4ZA 2GO1A 1ST2A 2LCIA 1XQ6A 5EKSA 1Z2DA 5TPWB 3WKAA 4WY8A 1JG7A 2IA5A 3TEMA 4RU1A 2CJPA 1KY2A 4MV6A 2P9FA 4H60A 1LPSA 1K34A 1J7HA 3LUFA 3WWEA 5IT5A 4HQ6A 1K8RA 2JFBA 2XDAA 5BZBA 2P2GA 1FSZA 1KO8A 4P33A 4MICA 4JR0A 4QEZA 3AB8A 4JQZA 1WOYA 4P0PB 2G4VA 3UWOA 3MUOA 2RGEA 4I55A 3K5IA 2E74B 1EX1A 3CCEV 2GDSA 7REQA 3SJBC 2EJCA 1KAGA 3JQ9C 3K70C 3P2IA 2J0UA 3RD5A 2PA0A 2NAFA 3QYPA 1E2KA 1BX3A 1Q2UA 2V0CA 3BCSA 1TEHA 2JH9A 1EZ1A 2AOUA 2GN2A 5G0WA 3MWGA 4HQKA 4EL5A 2FSHA 1KBQA 2J9ZB 2PWAA 4P4SA 2JLXA 1K2WA 2TYSB 1XG5A 1G5IA 4KFSA 2YKGA 3WB0A 2C2XA 4TLBA 3DOUA 5ALQA 3VH3A 2BE3A 4L3VA 3W5UA 1R2QA 2AG6A 1XDWA 5T6BA 2DUWA 5E9WA 2G71A 4MO9A 3LLUA 3HKCB 2WIJA 2Q6OA 1V7QA 1YS7A 2QLBA 3IHLA 1LSOA 1JJ2U 1EUCB 4BVLA 1DEXA 4Y30A 3EXIB 2IH3C 1QV6A 2R5FA 4OGGA 1EAMA 4LF5B 5SYNA 3PG5A 4NYKA 2JFZA 3KSMA 2MINB 3L7YA 5DCLA 4UVGA 2DKFA 1FMFA 1GNVA 3JQQA 2P9ZA 4E11A 1AILA 3I4FA 3L05A 3DG9A 1K3EA 3WSWA 3R9KA 3ABKB 1KH3A 2FW9A 5JVDB 1IDSA 3O4RA 4YRGA 1ZGHA 4BVJA 4KFTA 3O7WA 4EPTA 5BP7A 4BB9A 1KJJA 3WI7A 4KL1A 2V5VA 2Q50A 3X2FA 3RS5A 2XKAA 5KJFA 5HXZA 1IZYA 5F9MA 2R8YA 5K8JB 3TUJC 4RVSA 3CMAV 1NQWA 3A9CA 5LA6B 3K2IA 5E9QA 3U62A 1NR7A 2PI5A 1XD2A 1KEUA 4C2UA 5K8IA 3Q15C 5EKDA 1NF3A 2WE8A 2XOEA 1GFWA 5HJ5A 2R8BA 1BKDR 1NY6A 1CETA 4BECA 1IL0A 2X3UA 2WZQA 3H6GA 1KYZA 2ETVA 2P7HA 4MJ7A 2P2CA 2R1VB 4WKCA 4AZSA 5AR1A 5DLDA 4PYJA 1FSFA 3UJHA 5B2FA 2JH3A 1UM9A 2BKXA 1DV1A 4HH4A 4KI7A 2K4MA 2XWPA 3F6MA 2ZJ0A 4M1WA 3RLFA 2WJWA 1RXCA 5AI5A 4ZU3A 3EXG2 3CUUA 4EHLA 1DLJA 3Q1LA 4PVCA 5ESDA 3ASVA 4RO0A 1XA3A 4UVHA 4MYRA 5HFLA 1EFHA 1UCFA 1GPKA 2NU8B 3RFFA 4TRNA 3H5WA 1F8UA 1D0VA 3KHTA 1KQ3A 1XI1A 4ER7A 2Y1LA 1OV6A 1SXJC 4ZC8A 1S7CA 4KIGA 4E5NA 2K2QB 2YZKA 1WDTA 4M1KA 2UYGA 3BUSA 1DC5A 3QIVA 2YV3A 2FGKA 1WR8A 4RIFA 3EZNA 1REQB 3WPXA 4YC7A 3SWWA 3EDOA 4A1FA 2VBGA 1V54B 4F6RA 1SQPH 5H5NA 2ZJBA 2QR3A 5A5EA 4KMMA 3FYHA 4R9VA 3O7MA 4CNQA 4ZC1A 5D3MA 3SI7A 1WCV1 4EI2A 3QSYA 1DIGA 1ZIPA 1QF9A 1VRWA 1S2OA 3EH1A 2Z5UA 4F4LA 1N5LA 3KWFA 4L5JA 1FLAA 3K0KA 4II3A 4Y2RA 1RM1C 3W2TA 4IIDA 5DXAA 2BKUA 2XZOA 2E0IA 5TS2A 2JI4A 3SCZA 4MGIR 1D6MA 4RD4A 3ANXA 4CFSA 3BSYA 4RO2A 2B7BA 5CBKA 1RM5A 2XT9A 1A8IA 5G02A 2V98A 1N34O 3T1YB 5ILOA 1DAIA 3LHKA 4KITB 1XXHE 1J1UA 5AW2A 4C4YA 4DG8A 3H2KA 4BIOA 5FHRA 3ZD9A 4KRFA 3LDEA 1TJ3A 2IH1C 2ZXWB 2GTPA 1PS9A 2F1MA 2F8MA 2KBEA 1SULA 2ADPA 2Y67A 3B5IA 1CP9A 4ODIA 3WK4A 1S1MA 4N4AA 3RFUA 2X0RA 1R74A 4CH5A 4R1SA 2WUWE 3RADC 4DUYB 4MA0A 1LWOA 3I9FA 5AXDA 3MJEA 5ALHA 4I8XA 4RV9A 4KNWA 4M7WA 5LP1A 5J3JA 2W2LD 4ND5A 6NULA 4PYOA 3HNPA 4M21A 4CC6A 1XPOA 4BJ1A 5HZKA 4ZI2A 2C3YA 3DEZA 1JE0A 5EMJA 1R16A 1N9GB 1KI8A 1NXQA 4RK4A 2HBQA 4YUXA 2A3NA 1H23A 3TTTA 1XA0A 2QX6A 4B0OA 2EBOA 3MS2A 4YBRA 4K88A 3ZNNA 1L4LA 3ZBTA 4MWOA 3T7KA 2OP1A 4ZHYB 1YR8A 2HRZA 3IEVA 1JEQA 4YIOA 1OHHA 3IS3A 2VPWA 4GYCB 4P22A 2AUNA 2HRUA 5IDWA 2H3HA 1M34B 3RSQA 2ONCA 4C22A 2G77B 3GRVA 2NADA 1SKQA 3DDUA 4W7SA 1W49A 5K03A 3K06A 1NR1A 2PMKA 5EINA 1CR2A 1PD0A 2OZEA 1E4EA 2WT4A 3GPDG 1Y3BE 2A92A 2H17A 3L07A 1RHQA 1GRNA 3VBCA 1S8OA 4Z9BA 1OFUA 2F1OA 4NKGB 2GAAA 3K12A 3GEHA 1BSVA 1AQ6A 3W5VA 1S5JA 1G8AA 5CFMA 3ES9A 2B2CA 5C7OO 5DM70 4D3XA 3NFYA 5I5EA 1WQ3A 1EFVB 4TWJA 2CBZA 3OW2U 5BYJA 4M7RA 4RD6A 4YRBA 1MZFA 1LLQA 3KTOA 2HSGA 3O8BA 4MVYA 2QSZA 2C2GA 4A3SA 1THMA 4QDOA 4PNEA 1S6YA 3HI6A 1JVMA 1PWYE 4YJ3B 1Z4KA 1JFSA 3WB2A 2Q0QA 3KPWA 1EFTA 4TZTA 3VR6H 2CV0A 2C4UA 1JPUA 3KR0A 3REOA 2C0CA 5ARCA 3TSZA 1FXVA 4EFMA 2QNIA 3VQTA 5A4KA 3PITA 1JLMA 2VHUA 4UXNA 4B8ZA 2W9XA 1J99A 4JEMA 1K5DA 3A3PA 4OX9O 1ITZA 3DDZX 4GXNA 4XDGA 2ID7A 3T0IA 3UAGA 3RYHA 4G5XA 1EN5A 1P0CA 2HEGA 3UMMA 121PA 4PLWA 4NRDA 1LWNA 3GJ7A 1H0KA 5IT9N 3ZCVA 3MYYA 1M2KA 4RNCA 2V6GA 1XLUA 4RCYA 3V9PA 2JA2A 2LPMA 4FZJA 2YUTA 5L45A 2HFJA 1IZ9A 4YT2A 8ABPA 1NN5A 1QO0A 5B36A 1SKYB 1CY2A 4HPWA 3PNBA 1E1NA 2UYOA 1V1JA 4F9TA 4HN9A 2AXTZ 3R7BA 1VDMA 4GDMA 4RPJA 3C3WA 4HRAA 3ONDA 3JS5A 3IOEA 4LRYA 5DT2A 2NAPA 1VQPF 5M2QA 3NHFA 4TM8A 3SZ3A 1YQEA 2PL3A 2Y0CA 1MJGM 5JSZB 4OU5A 3DC5A 1AP6A 4XOIA 5AHKA 1A7JA 3GBPA 1RXVA 3BRWA 3BCHA 4PLHA 3SEQA 3DQPA 3T3MB 3IPLA 4YRJA 1MJGA 3X1DA 1J07A 1II0A 2AGVA 2HR1A 4I2NA 5BQFA 3QJGA 3OBBA 4ZJYA 1CVLA 5FTKA 3S1AB 1VHJA 4GMKA 3COWA 3ZVNA 4GPAA 2GRJA 1N9ZA 4R05A 1TGVA 4B3RO 3T3NA 1MX5A 5IC5A 1SCKA 3LCCA 4QC2A 3BFPA 4AQDA 3L8HA 3IP1A 4YV0A 2CVHA 3DXZA 2YHUA 4IQFA 4BFVA 3BMNB 1IZ0A 2BI7A 4H15A 2V6FA 4CM3A 3G6EV 1FFCA 1M3SA 4GICA 1JHXA 3BDVA 4ONEA 4TMXA 4P84A 3GFOA 1ZVJA 1RPJA 3PFIA 4KLCA 4ZK2A 3QPVA 1E1RG 1YCFA 3NX4A 2XX3A 3GOHA 3CURA 2UVPA 4CMJA 4M53A 3TBFA 2QWNB 4AO7A 4DLWA 2XA2A 1NUAA 4YMHA 2PPVA 1PQYA 3DDOA 1JA8A 3QPWA 4NCIA 1XCMA 4MQEA 2VNSA 4LBYA 2RKOA 3QO5A 1VQLF 3MUFA 3DPUA 3GX1A 2HKOA 3O8RA 3S0JA 1JDZA 4J0QA 1Q1EA 2N0SA 4ZJUA 5JD6A 1C0EA 2FUCA 5BN4A 4FDVA 2PCLA 1M1NB 4HFRA 3ZE6A 3WGZA 4UU8A 1JJ7A 3GLIB 1QH1A 1AQNA 1Q6UA 1IOZA 4ZJZA 5JAMA 2UYJA 3NRBA 5C37A 2PN1A 3C1OA 4Z1MG 3TZQA 4ENUA 2XB4A 2PS0A 3T3HA 2P0AA 4RK1A 2BDUA 5COAA 4NOLA 3AK1A 2LGWA 2C78A 4HDOB 4PA3A 1EHCA 1MGOA 4CH3A 4BLSA 2OBYA 2PUCA 1D0IA 2Y1DA 5FDFA 4LRWA 1N4CA 2UUCB 3L6EA 2X8LA 3C6KA 8OHMA 4F96A 5KHJA 3TUIC 3PHBE 3OZFA 3FTEA 3K9CA 1JGTA 2B99A 3F96A 4MGEA 2E4ZA 4WFKA 2UVDA 2Q8QA 5F2VO 4OAPA 1T9BA 3RJZA 4UNIA 1C3LA 2BBSA 1UDCA 4JA2A 3ZDRA 3WMRA 4RA6A 2QQEA 4EFKA 4KR7A 3BORA 2VDUE 3B1ZA 4QBTA 1SUDA 2IJGX 1AQJA 3KYIB 1PLKA 3SC4A 1XT6A 5LB2A 2ANCA 3CCUV 2X8WA 4BEJA 5H8WA 1S4QA 4JX8A 3ZWKA 2E4VA 4PCAA 4C87A 1C1XB 4C08A 4MS2A 1L5YA 2D00A 1JIVA 4ND3A 1CF9A 3IDSA 4PZPA 1EE9A 4IBOA 4NBVA 2JGUA 1ZSVA 3V2GA 4F7DA 4EHJA 5LQNA 4F4HA 4HNUA 4WEQA 5FT9A 1AZLA 1L9KA 2J7PA 4BMNA 3HYRA 4TVBA 1PR0A 1OXMA 3I6BA 2UZ0A 3LPMA 3CF2A 2EILB 1Q1NA 3Q3IA 4IHJB 2C7GA 3F9RA 4QULA 1ADJA 3ZHQA 4YO7A 1IG0A 1PJ3A 3O94A 3QXHA 5LHGA 3TRHA 1VQ5F 5JCOA 5C4GB 5HEKA 3DAHA 3AUTA 3G0CA 4HN2A 3FTCA 1L7QA 5FJ4C 4EMSA 2ZSBA 4FLVA 3VPBA 2Q8NA 1S2IA 3LNCA 1WCIA 1OTHA 1XLVA 3RWBA 1TIKA 2I7CA 1VPTA 1CJBA 1KH1A 1EM8B 1L8QA 5MN4A 4JASB 4LQLA 4IH4A 2GAOA 3IGFA 4WADA 3WGYA 5GM1A 1V9LA 2WMYA 1CUXA 3N59A 5CU7A 4JCOA 4H0LB 4OU4A 3D8CA 2O2YA 1ZO8A 3OFJA 5FPKA 1K33A 3A1FA 1PJTA 4ZYUA 3GBSA 1OU4A 4A26A 3HJCA 2FYTA 2PYIA 1G98A 1T0PA 1CK4A 4PFSA 5JTTA 2JLWA 3MOGA 4YP9A 1EP2B 2Q07A 3EIXA 3BFVA 1KY5A 4DG9A 4RAIA 5J2TF 3THRA 4PI2A 2Q1UA 2DR0A 3BJZA 5HK9A 2RHOA 2DBZA 1MPTA 1ORIA 3R6WA 2CWWA 3PQ5A 3BQ9A 4HLDA 4AZWA 2IU0A 1ORWA 1XQYA 3QY0A 3P45A 3E35A 1EFLA 3EEYA 3MPOA 3V4DA 1LQTA 1KMMA 5AW3A 2PJRA 4V3CA 2VOEA 4I1OA 5FLXM 4EEQA 2IQ5A 3M4NA 4GOJA 5GY7A 4G27B 2PH3A 1DU4A 4CMGA 2DPYA 3TIIA 4W5QA 4H7EA 1BS3A 2M6SA 3ZHSA 5AW6A 3DYIA 3U60B 3KUCA 2N46A 2HQSC 1HQKA 1RTTA 2VUUA 1P0MA 4P7JA 3A9UA 1X38A 3DS8A 1XBIA 2OHGA 1IQ0A 3OIDA 4ZFNA 4F3TA 4RYDA 5ED4A 4O59O 5HTOA 1DBWA 2HIHA 3O4IA 4UM9B 5KTTA 6ADHA 3V4OA 1WKBA 1QQ5A 3KTAA 1HDYA 4B3CA 1EZVH 2YW9A 5KTPA 1KI3A 3O21A 4UNQA 2PWPA 3SLGA 5IDJA 3HJTA 3CT4A 4QQFA 3B52X 3ZJ4A 4F8YA 3OX4A 2FPIA 4MXDA 1JLKA 1OJ7A 5EHNA 4E0BA 4G4SO 3AHEA 3APQA 2PEZA 2D1TA 1EE2A 4OHWA 4IDFA 3O26A 1N1DA 1B23P 5CAEB 3FMPB 2G1JA 4OL9A 3M7IA 3AGPA 4RVGA 9ATCA 2CLHB 1JHUA 2COUA 1VGVA 3ZI4A 1S7GA 5K0FA 8AT1A 5LMCA 1NBIA 1VP9A 2IG8A 2DHDA 1TTTA 3S1LA 4YJGB 2ZSJA 4BNFA 2NVWA 1E6EA 1YQDA 1SZXA 3KV3O 1GG8A 2EIKB 3LBIA 1SBNE 2WVAA 3FCXA 1AZSC 3TOSA 3C3EA 5JFOA 4BW5A 5IYZA 3UHOA 2GZRA 3TD6A 3O5AA 4HNQA 4A23A 1KJIA 1X77A 5JS2A 4L0QA 5I8ZA 3SLRA 4W4KA 3A9VA 4KQEA 1T5HX 1I5XA 1ZI6A 2NM0A 4F4UA 2XDQB 3HA3A 5B1AB 3K0EA 2OXFA 4Y1RA 2RONA 3GLGA 4DA7A 2ZYUX 2Q6IA 4H4DA 3LNTA 1NBMG 4GYKA 2WKRA 3ETLA 4RDXA 3E03A 3ZDYB 3PWZA 3V1TC 1BCRA 2JIBA 4Z9XA 1HDJA 3NS7A 3ST7A 1QU9A 2HXGA 1QHNA 4BVGA 3LXXA 1F17A 1UBCA 1FUYB 1ORQC 2FTKE 2ZUTA 4MKHA 5EP1A 1JIQA 3GZNB 1JEEA 1IEQA 1QS0B 2VPPA 1OAAA 1XRNA 3RVPA 2QJOA 3GYQA 3IEUA 3LUJA 1M34E 5K0SA 3RIMA 4XDJA 3OJWA 3QU4A 2VDNB 5DE3A 2VDRB 5JNTA 2RMKB 3EXHB 5CTAA 2DWPA 2Z43A 2PGAA 1QC5A 3C39A 4TT3G 4ZMRA 3KQYA 4MTOA 1QIMA 2HPVA 4NU6A 5A4IS 2JAUA 1FU8A 1R3KC 3H84A 2FG5A 3T4EA 1X7XA 2F67A 5ECWA 3WGUA 3SXUA 4RSRA 2OZLB 1E3JA 4Z5XA 3G0GA 1QZTA 2ZS7A 4ZTUB 1CUAA 3OSZA 2CNNA 2HO4A 2OCKA 4EPXA 2VTEA 3LA8A 3MD9A 2GKOA 1RVV1 3FHTA 1GADO 1U6KA 1MOZA 2CLIB 1W47A 5KOHA 1RFGE 4DR7O 1RZVA 1EYZA 3D5TA 3SJAA 3DOHA 2BMVA 4FSHA 5DN9A 2QMUA 4ZRDA 4NBTA 3AV3A 4C01A 2HJFC 2E7ZA 4FKBA 2V03A 1UODA 1PU2A 1OHHD 2AJBA 4RHYA 1B7GO 1W19A 5I7RA 3ESAA 1T8WA 1CX9B 5B3AA 4QYIA 4KYUA 4F3NA 1K63A 2V4UA 5MFPA 1MG0A 3AOEC 3SHTA 3P9YA 1BHO1 2GTIA 4FYXA 9MHTA 3AC0A 1EXWA 2NZWA 3WBJA 2R9IA 1FPMA 2DWDC 3I83A 3Q6IA 3GUUA 4ZJPA 3IQEA 4ZP1A 2GZ1A 3AG1C 3QELB 4EW3A 1AXRA 1GU7A 1E1RA 5B8FA 2PKQO 5KOIA 2A0FA 3FNGA 2WLIB 4GC5A 3HZRA 4H7JA 2EIMB 2C57A 3N6XA 4QOGA 2CHQA 5B37A 1YULA 3IERA 3TG8A 3NT4A 3ZQUA 5U4XA 2G7ZA 3MINB 1JLLA 1O58A 1Q77A 4C07A 3G71V 1HDCA 3I4CA 3VV3A 3I45A 4Q4HA 5KHGA 4DIBA 2XCRB 2YX1A 1LBQA 2QD1A 4R6ZA 2EINC 1RAHA 1DC4A 4KE8A 2WVGA 3CCBA 1SKYE 1P7BA 5C32A 5DGTA 3U6BA 2ZU0C 3L93A 2V3CC 4B40A 1UWVA 3R3ZA 2P06A 4IJVA 5HIAA 2ZKIA 1BXRB 1IOWA 4TX1A 3ZVRA 1Z39A 4Z1MA 1J9ZA 2PVSA 3VSCA 4WNIA 2JRLA 5L3QB 2OECA 5AQEA 3NC1C 4DJTA 2G9RA 4G23A 3IBTA 2LGQA 4C05A 1GJRA