5KX5B

Crystal structure of tubulin-stathmin-ttl-compound 11 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
430
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Cytotoxic Evaluation of Novel Tubulysin Analogues as ADC Payloads.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 167
structure length 427
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kx5B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kx5B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kx5B01
3VPAA 3RYCA 3E22A 4X20A 4YJ3B 3HKBA 4TV9A 5JH7A 3C8LA 3RYHA 3RYIA 4U3JA 5JQGB 3HKDA 3UT5A 5LXTB 4TV8B 4ZOLB 3V3TA 1TUBA 4HNAA 5EYPA 5CA1B 3VOBA 3HKEB 4FFBA 5EZYB 5LYJB 5IYZB 4XCQA 5KMGB 5JVDB 2VAPA 4X1IB 2VAMA 5BMVB 3RYCB 5KX5B 4B45A 5C8YB 4U39A 4DXDA 4O4LA 3HKDB 2RHJA 3N2KA 5LOVB 5FNVA 2RHLA 4O4IA 4TV9B 3HKBB 3JATB 3JALB 5EIBD 1W5BA 4B46A 5JQGA 4X1YA 4X1KB 1TUBB 1W581 5EYPB 4ZI7A 4I55A 5LYJA 2VXYA 4YJ3A 5JH7B 1FFXA 4O2BB 1JFFA 4U3JB 1RQ2A 1RQ7A 4E6EA 4O2AA 4WBNA 4FFBB 5LXTA 5BMVA 3JAWB 2R751 5LP6C 2BTOA 4I4TA 5GONA 5JCOA 1FSZA 5CA1A 1OFUA 4YJ2A 3N2GB 4ZHQA 5JVDA 1Z5WA 1W5FA 4F6RB 4X1KA 4DRXA 3M89A 4ZI7B 4O4JB 5KX5A 3WGMA 4EB6B 3CB2A 3HKCA 4O2AB 4I55B 1TVKB 5LOVA 3JAWA 2XKBA 3R4VA 5MN4A 4KWEA 1FFXB 4M8IA 4EI7A 5EIBC 5LP6B 1JFFB 4O4HB 4LNUA 4I4TB 5GONB 4WBNB 5ITZA 3ZBPA 5J2TA 2VAWA 5CA0B 3M8KA 3N2GA 2BTQB 4TUYA 5J2UA 4X1YB 4IHJA 4I50B 3WGLA 4YJ2B 1SA0A 3RYFA 4EI8A 4O4JA 3VOAA 3JAKB 4O2BA 1W59A 4F6RA 3VO9A 5LA6B 4DRXB 3JARB 3WGKA 3JASB 4X20B 1RLUA 3ZIDA 4EB6A 4ZHQB 3RB8A 3RYHB 4LNUB 5IJ9B 5ITZB 2GVIA 5JCOC 5MN6A 1W5AA 1Z5VA 5MN5A 5IJ0A 5CB4B 4TV8A 4IHJB 4IIJA 3E22B 1TVKA 5M7EA 2RHOA 4TUYB 5J2UB 1W5EA 2RHHA 3RYIB 3HKCB 3UT5B 1SA0B 3RYFB 3JASA 2Q1XA 5CA0A 3JAKA 4ZOLA 5LP6A 2R6R1 2BTQA 4O4HA 3WGJA 5IJ9A 5J2TB 4I50A 3HKEA 4O4IB 5EZYA 3WGNA 2Q1YA 5KMGA 3ZBQA 4EI9A 4O4LB 5CB4A 4HNAB 2XKAA 3N2KB 3JARA 5FNVB 3VO8A 4IIJB 5IYZA 3JALA 3JATA 4X1IA 5C8YA 5IJ0B 5LA6A
chains in the Genus database with same CATH superfamily
1OHHG 3DXFA 1AV6A 1H8ED 2ZS8A 3W6OA 2IIVA 4PSVA 4F4FA 4NXNO 1P81A 2X1VA 4FFKA 1CB7A 3TECE 3B9QA 3I5DA 4M0UA 4BCCA 3KG2A 2W8BC 2MK3A 1RCTE 2C7VA 3AY7A 5HZMA 3G0HA 3OSZA 4GBGA 3TXSA 2HCTA 2VDUE 4IXDA 4YAJA 5A7HA 4W4KA 3FMIA 2J9GA 1DC3A 4PDLA 3RUFA 3F6CA 3F7MA 1Q3EA 2HGSA 4DKJA 1NU1H 4HDMB 2DR2A 4JJ7A 4X3LA 1P0FA 5DCUA 4IXMA 2IJKA 3IR6A 1CG6A 3PC8C 2YNMD 1L0LH 4HAYA 3RBZA 1PT5A 1YS4A 3EF3A 1Y7LA 5LD2C 3A1WA 4FIZA 4C05A 4DILA 1BC5A 1FX0A 2EBFX 3ECCA 3PR2B 1UQTA 5E79Z 3VR5H 2IPAB 3O9ZA 3UK2A 4CMEC 3PYMA 1CQIB 3ZIAD 4IVPA 4ZJYA 4ZYWA 2R1VA 2W6JG 1I24A 4Q3NA 4I55A 1RVDA 3ZDZB 2D0IA 1XTJA 2ZBRA 4UVGA 5K0NA 4D80A 1AKYA 5ARCA 1JEDA 3T54A 3Q72A 1DRVA 3RR2A 4EDHA 1CEQA 2EW1A 1YFLA 3GRUA 1TAGA 4KAJA 3E3LA 3I6BA 5CT8A 4BRSA 1VQ6F 3BB4A 4IP0A 1NXXA 3DCYA 2PUAA 3F9IA 3OQPA 2WHXA 1LPOA 2GZMA 3PUIA 5E7IA 3OBWA 1NQ5A 3ROQA 5B4TA 4BBAA 4FUQA 5L3GA 1P9OA 2BGLA 3I6YA 3OG9A 4JXKA 4AP6A 4JF3A 4Z51A 1P3DA 3DM9B 2OCXA 2AXQA 2C9BA 3E82A 1KVQA 1W2WB 2DTEA 2Q6VA 3F90A 1E3IA 2X4DA 3GRPA 4HJRA 4QAJA 3UG6A 2GYWA 3V48A 1PT9A 1U0HC 2QXUA 4LOAA 1YZBA 2ZPTX 3IT2A 4Q4JB 4MYRA 2J33A 4XZ3A 3DHWC 4Z8XA 1GR0A 2EQ5A 2V98A 4YB8A 3GJRA 5LZ4A 2WUGA 3TSZA 3S81A 2OHGA 5CBGA 4EI7A 2OSVA 3EVZA 3RAPR 1ZG3A 1WB8A 3CPWU 3JSAA 3KE9A 3RNOA 4I4TB 3CUYA 3PCRB 4OQEA 2WB4A 4DMRA 3D6NB 4Z54A 5BSEA 5IUJC 4EHBA 2EJTA 1VQPV 2FRXA 4ACAA 4AULA 1ZN8A 3ZHBA 2WWGA 4YREA 3J80N 1ML3A 2RH5A 4MS1B 3HTXA 4YTEA 4O8CA 1PDOA 3BG5A 1E9AA 1YBAA 3E7PA 4Q7MB 2JCGA 4KE7A 4UVEA 4W7SA 2WWWA 4XIJA 4KKVA 2P1DA 2EEPA 2ZM5A 5FLYA 1WA8A 3R8CA 3V7QA 3ESDA 1JQDA 2G0AA 4LKOA 4DIDA 1OFTA 2AMVA 2N3ZA 5CM9C 3ZCPA 2BSKB 3SEAA 2EP8A 4HNHA 4IZOA 4RSHA 2CL0X 1ZSPA 4E6PA 1OIXA 1FS4A 1P8AA 2PAAA 3JQCA 1VJCA 5IMSA 1Q1ZA 3BQMB 2XMPA 4D46A 1NI4B 1UC9A 3N05A 4MTLA 1CNMA 1I33A 2AMYA 1L4YA 2AFVA 3KP1A 1G98A 2JFNA 3G6KA 3UV6A 1GGMA 1YL5A 4CF6A 5EUMA 3H5NA 1R9JA 3PNYA 1X7WB 2Q0XA 4J0FA 4JU9A 1GR1A 1U0LA 1XVIA 1GTG1 1SJ9A 2W98A 3HBMA 3CMAF 4HFRA 1QM5A 1JR2A 2HRDA 3SYTA 3HDJA 5CB6A 4P4SB 2PBRA 1MMFB 1P9NA 3GJ4A 5TIIA 4UU1A 3TGLA 2ODAA 2PVPA 2B8TA 3CINA 4BY9E 1RJFA 3LS2A 3CC7V 2FPIB 2IP4A 4HAMA 2PZSA 1W49A 3ZD8A 1CEEA 4ZTBA 2Z08A 1MVOA 2JJ1G 1BH6A 1Q6ZA 2Z98A 4GPBA 4DCUA 4OAOA 2E74B 1QKIA 4INJA 3ROGA 1VHDA 3MVEA 3DVQX 3EGWA 3WIVA 2K1SA 4DV2O 1HTWA 2PKEA 4QUGA 3D1VA 2A6PA 3LWQC 1Z17A 2I55A 2ZR2A 3NDRA 3BWMA 5BR8B 5EWRA 1I4TD 3DVAB 4WMLA 1T36A 2YXEA 3SZOA 1X8LA 3QE9Y 1L0NH 4CFZA 3DB2A 4CEHA 3HB7A 2C7BA 2OB1A 1DUIA 1SCNE 4LRTB 3GBPA 3T1NA 1DO0A 5DGDA 3CWQA 2F1HA 5F7XA 5LMCA 4QNMA 3D3NA 2KHZA 5IC4A 1F6WA 4JBIA 3GLGE 4PLFA 5AT1A 3SE0A 5DP2A 1RWBA 5BT8A 1KAHA 4KR3A 1RQGA 4O1IA 4PO8A 5LOVB 1BE3H 1KQPA 1RXSA 2O52A 2VDNB 4DR3O 2G5PA 5CYOA 1Z4QA 4HXFB 1PNVA 4PZDA 3W5JA 3S1LA 1MC4A 1W34A 3VPCA 4A26A 4NYKA 1Z83A 1NS1A 4UB6Z 1C8LA 2C3PA 3LECA 2AG8A 3P9KA 5C81A 1CUZA 2VZEA 4RLSA 2DT8A 2XRMA 3GT4A 3QFCA 4UCVA 3RVZA 2B2NA 2AVDA 4MJXA 4M89A 3RTAA 3C9SA 5KNCD 1G21E 4D9KA 2BYTA 1KTVA 3OJLA 1UM8A 4YLGA 3R8XA 4BLVA 3DE7X 4W4LA 1CP9A 1KJZA 3CN9A 3LUKA 3QMMA 4N7MA 4RGVA 4KMOA 1AI5A 1V48A 3SQWA 1DKMA 3DVAA 1MQ9A 5CVUA 1K9MH 4J91A 3FTPA 3AK3A 3D6VA 3KOXA 1QIMA 1SXJD 5E7QA 4AZTA 4AZVA 1Q77A 3GLUA 4OOFA 2UU9O 4DTIA 1NTMH 1ECLA 1B0ZA 1KKMA 2ODTX 5DP1A 1ULBA 4JLOA 3CMMA 1MU0A 1KP2A 2J3KA 1B14A 4P32A 5H70A 1PR5A 3I9V1 1RMYA 2BKXA 1ZH6A 2G25A 1FYVA 3ZU2A 1GPNA 1AV7A 2EILB 4IGKA 4AJ4A 2XZTA 4IJ5A 3QVOA 4HSGA 1ZWLA 1JA9A 2R0QC 2WA1A 2WJVA 2COUA 1MPXA 3FNGA 5DU2A 1JLRA 4UU7A 2VP4A 5IVDA 2DPXA 1X7WA 5EEHA 3ICWA 3GRYA 3ZY2A 3CRVA 3GAZA 3NWPA 3PITA 2HIMA 3MC1A 1VCNA 1USWA 4J0HA 4N18A 4F6RA 4DC0A 1APBA 4N41A 3OR6C 1G7SA 4OQZA 5IM4A 5LLDA 1QU9A 1XNJA 1XA4A 5AKKA 4ETIA 4D56A 5KDOA 5JTUA 4CEJA 4IFEA 4GW3A 2QXYA 2ZJAA 2C2WA 1SOAA 3IIMA 3KXPA 4M88A 3ZWYA 2JDIG 1LRLA 1K66A 1GEEA 4PC3A 4R8VA 4N7BA 3NBUA 3PRKE 4EUEA 4F1WA 2YKGA 4V0QA 1EGQA 1NVPB 2VFAA 2CVLA 4ZIRA 4YIHA 5L45A 3A3KA 1NX9A 5TLSA 3LDUA 3OLCX 1DG1G 1MPTA 4MA0A 2GK6A 4I9NA 1MAVA 3IOCA 1Q12A 2AN4A 4M54A 1WKCA 4ZU3A 521PA 5BY1A 3TJMA 3WMWA 4ZIBA 1XXLA 2HIGA 4M0MA 1ISIA 5JWHA 4PBTA 5TISZ 3DSQA 3CNNA 4YT2A 1JT2A 3DWGA 1AS3A 3EVCA 1IBLB 4IGEA 5BMOA 1W1IA 1FP1D 4MGEA 2DFDA 2E89A 4IYRA 2DLCX 2CY0A 2H29A 5C8YF 4GO1A 2VWKA 4K35A 4CQLA 2HD4A 1D6MA 1DB3A 3T7DA 3N2KB 4S1TA 5C18A 3MSXA 1VE3A 1U2GC 1B76A 3DWFA 3RFFA 1GU7A 4ZI3A 2C8VA 2ANCA 2O57A 3WGHA 2DFVA 3LLVA 2UYPA 2FFRA 2I8AA 3DKPA 3P9SA 2D7DA 1Q0UA 2O2IA 2VJLA 1L7VC 2P4KA 1IV1A 3GI1A 4Z1MA 5KAPA 2XQKA 3R8FA 1HM5A 3GR6A 3H0KA 3G49A 1VLJA 1RYEA 4B7AA 2PFGA 3IOYA 4TKZA 4D4GA 1DO2A 3IIJA 3SQNA 4K6GA 2FKNA 4EUFA 1V5IA 4UFPA 5A03A 3ER9A 3SIUA 4K6MA 3FKJA 4TLCA 3AT1A 4TN1A 3IAS6 3EIXA 5CA1B 1K5PA 2EFGA 2VJKA 1N8RW 2ZBPA 2H1WA 2HLPA 2NXEA 1XRNA 1ZJZA 2HU8A 1XZHA 2JFHA 4LH6A 3LA8A 3GUVA 3SYAA 3GLQA 4X9QA 4YJHB 2Q67A 3R41A 3KR2A 4QGFA 4J07A 1H23A 2RB5A 4KXVA 3KT0A 2Q6IA 4KVGA 3ZOKA 4DXDA 2PH7A 1BYIA 3MM4A 4J29A 4RKEA 4UM8B 3I61A 3B6JA 4GPTA 1HDIA 4FEEA 1JNXX 1JY8A 4G5HA 3JALB 2C8LA 4FM2A 3KQOA 4R8SA 5ADUS 3H86A 5BXZA 1K9MW 4UUOA 2PLRA 5HKBA 5LYJA 2OSBA 1VCOA 3LPAA 3Q0IA 2WFMA 1GQOA 3IDFA 5E6RB 5L3EA 1AQNA 1JLLB 4CM5A 5DHAA 4K8RB 2OCCB 4CJXA 2VJPA 1SM4A 1ZNZA 3UJPA 4KREA 3D4OA 3VJKA 4F84A 2YY6A 5BYAA 1WDTA 2W2OA 2Z0MA 3FSEA 1NBMG 4AJ9A 1T0AA 3BAFA 4W5WA 2VDWA 1QYDA 1YVRA 4HS4A 5BSMA 3QWHA 5JNVA 5CH8A 2O8DB 2DYKA 1Q21A 4HC4A 5K8CA 3LW7A 1T25A 2ODPA 3BXXA 5GZ6A 1IRIA 1PW7A 2FK7A 2PZAA 3RFCA 4RIEA 5HXZA 4HV4A 3RODA 1E2HA 5D00A 3TSOA 2QLBA 3ZO8A 4PHZA 1JPVA 5T3YA 1EFVB 2PUHA 3ZU3A 4K9LA 3IT0A 3PSAA 4OFWA 3PHHA 3QX8A 4QFBA 2HA0A 3AR8A 4XTRA 4BBZA 1SPBS 2XX3A 5BW8A 1W0KG 1P17A 2NUBA 1WEHA 2Q62A 3DO5A 1UANA 3PFGA 4IMPA 5FL7G 4B4OA 2RMKA 2V0CA 4P3XA 2ABWA 4UEOA 5FCDA 3EVTA 2ZJ8A 1QHGA 2ZQ5A 4L0QA 1ZVMA 4R8KA 2C5FA 2NSLA 2ZIEA 4M8SA 1ORTA 1TLFA 2BCGY 3Q4HB 3UO2A 1KI4A 4NULA 4OV6B 3EC7A 3ROZA 3X44A 1TO2E 1UBRS 1H7MA 3ORHA 5DDIP 3MUEA 2E7ZA 4P93A 2WILA 4AY4A 4IOLA 3BL8A 2XB6A 3HFJA 2C96A 1QFYA 4D79A 1FPOA 1U7TA 4RANA 2CHTA 1GZDA 4PNEA 1T8PA 4EGQA 1BWSA 1DIRA 3ETJA 2KB1A 3BKWA 4EHDA 3OTWA 2HJ9A 1Z8NA 2Q9AA 1PSZA 3KS9A 3JZFA 4QYMA 2BKAA 1R0YA 5ALRA 5FRDA 2ODNA 1T0HB 1X6VA 1PLKA 1QO0D 3RYIB 5EBLC 1YEWA 1XVTA 1AR4A 3DE1X 4N8SA 4RD0A 1C14A 3G6EF 1ODTC 1UQRA 1MNAA 1ZK3A 2HSEA 4FSHA 4FMDB 1NJ6A 4UB8Z 1SIWA 4NAHA 2G9RA 1GL9B 1EBUA 2L35A 4J1SA 1T6NA 1NBMA 3PNPA 1TZBA 4HBNA 2I6SA 2JIBA 2WRZA 3FPBA 4PHFA 4WDQA 1OH6A 1NYRA 1MTOA 4MI1A 5K2MA 1RNLA 4LWQA 1VQ9F 2AR0A 3NBMA 5IYZA 1DQRA 2M6SA 2DFKB 1XD2B 3FHTA 2XQIA 3ESXA 5AM4A 3ZN0A 3OAAG 2VSFA 5CLQA 1UL1X 3E61A 1I2AA 4HGPA 4TTJA 3VPAA 5JD4A 2BSXA 4PLVA 1V9CA 2O8BA 4R0VA 1HL3A 4M37A 4FKZA 1OCOC 4RW0A 3BIWA 1YHNA 2F95B 4BB0A 1NNUA 2JAHA 3GUHA 3KLNA 4PGAA 2QMZA 4WCFA 1JTVA 3JQ6A 1JAXA 3S3TA 5JYDA 4OK6A 2N1MA 1KVRA 4AWBA 1SC3A 1FYEA 2OCAA 4Q37A 5CLJA 1BU8A 2BPOA 1U7UA 3BIJA 1CXZB 1WOMA 3K16A 1JDVA 2F9MA 1EESA 1WXFA 1QJ4A 5BV2P 4EYQA 2H59A 1E3TA 3FHOA 3OZDA 4UPDA 1M57B 2GZ1A 4JJGA 2FU5C 4P7GA 3M34A 1YZVA 3V8RA 4MB6A 5ADHA 4Q3CA 4KFTA 1LLUA 5TARA 5E1DA 2ATVA 3FFBA 3MW8A 4FYXA 5IDXA 1AGPA 1DIHA 4GNKA 5HIMA 3AB3A 2LFRA 1ND6A 3CPWF 5T6BA 1MV5A 1W4ZA 1G8GA 2FR0A 3QPUA 3I6MA 4EG3A 4JDUA 2FPLA 2PGXA 5LJLA 1TZ2A 3OEWA 3HXMA 2LQTA 1J95A 1MEJA 4CUJA 5AW9A 5D5QA 1CY4A 3CCUF 4Z0NA 2W6OA 7MHTA 3E20B 4MVUA 1E1YA 2FPXA 2HSZA 4NI5A 4NCIA 3STTA 4PD4F 1L5VA 2XNKA 4AROA 2ZJZA 2JFFA 3LDHA 3MUNA 1NJSA 1XRLA 3GX1A 3E9QA 4QPCA 1Z4NA 2IEIA 4JT4A 5TGTA 4MW3A 4ZHQA 2C94A 3AG2B 1WA8B 1BE0A 3D59A 2W4QA 1E89A 4Y6GB 4MS3B 4DC1A 4OP2A 4UHDA 2H1FA 5GINC 3I9JA 3MAJA 4N3NA 4GSLA 2IIPA 1TCBA 1V96A 2IKQA 1LPPA 2COKA 3MUOA 1RHMA 1D5CA 4J7ZA 5BN4A 1IONA 3FJYA 4XFDA 1K5GA 4W1QA 3ZQ4A 4CIBA 5TQ2B 3AEKB 1E32A 1XMOB 4NXMB 3G5MA 3AFOA 4DCVA 3MWDB 2CSXA 4LF6O 5KUMA 2O2JA 1IEWA 3EPPA 2HMWA 3MMSA 4NU8X 2H9IA 1GNTA 1XO1A 2ZVQX 5HTOA 1I01A 2D0PB 4Y2RA 4J2TA 3VZQA 3GCDA 1PO7A 1DS6A 2B82A 2QVXX 1OWPA 2ORVA 4U0KA 3U39A 5GJBA 1W93A 3H5AA 2P11A 4HEHA 4I3GA 1JXMA 4J0CA 4LZAA 5HTKA 4DPLA 2IH5A 1Q82W 1SESA 1FDSA 1O96A 3THOA 4FEGA 2NAPA 4ZMBA 5IWAO 1JG2A 1UWLA 1WCV1 3CCSF 1JJAA 1NWCA 1X1EA 1CU1A 3GXOA 1PWZA 4YMWA 4ZEWA 1YVPA 2JLVA 1WU7A 2PSFA 3T7KA 1BMFA 2HDNB 4N0MA 4OBEA 3WLOA 2OWOA 1XQ1A 4YJKA 3F6PA 1D4FA 2NO0A 1PNQA 5I01A 3AP3A 4C6SA 1GTSA 2JIQA 3IERA 4TWBA 3WNVA 2NWQA 3Q9NA 3RAEC 3GAAA 1PX2A 2YHIB 3QKUA 4E3ZA 3Q40A 3HE3A 3PFBA 1HE3A 3C3YA 3SJCA 4PDVA 2HVYD 4DJAA 2BTQA 2COEA 3NFYA 2P6RA 3H1BA 2IYZA 2XUMA 4I1UA 3G5AA 1FX0B 5LYYA 1KYQA 2BF7A 4NMLA 2POQX 3N76A 1GFZA 2MSLA 4XR4A 3V4PB 3NH9A 5BV0A 3ONNA 5FEUA 2HXGA 4IIJB 3K30A 3KELA 3IP5A 3NT5A 5DCLA 4BNTA 4D3FA 2PXXA 4UTNA 2QE7G 1L5SA 3R9WA 3E22A 4D2IA 3ILHA 3L0BA 1KYOF 3K1AA 4MVMA 1RZRD 1VQNF 4WCFC 5KTRA 4AKGA 3L05A 3DDHA 1XMQO 2C77A 3EXG1 3FYHA 3NXKA 3CEIA 3L84A 4OAPA 4Q12A 3RC3A 2BI8A 2BGRA 2X0JA 3PR1A 5COBA 1Z4OA 4PC1A 1YMUA 2K6GA 5F5NA 4O0MA 3PJFA 4RLQA 4WOCA 4XBFA 4MA5A 4JIMA 5KHHA 3K8QA 1GM5A 4ZD6A 5ENVA 1KKCA 1G2OA 2VAMA 1Y9EA 2WT4A 4DMUB 1L7BA 3H1GA 2O8BB 2FWPA 1E92A 2IEBA 3DHEA 4JC0A 4XAQA 3TQIA 5A9GA 5IY5B 1EVZA 2B4RO 3GGGA 4ALKA 5AJWA 1YJAA 2CLIB 5KSYA 1T0PA 2O7NA 1YS9A 4C4WC 3PB3A 1C9YA 1M4UA 4HQ6A 4YXFA 4O4HF 2XH8A 2O2DA 3UN1A 3DBRA 4LJ8A 3SYLA 4ZPJA 2VP9A 1EJBA 2FSFA 3N6VA 2HMVA 3NHUA 1HA3A 5KQLA 5T4HA 1A5AB 3M1LA 1XMJA 4Q4HA 2C4KA 2Y4OA 4GR9A 3CRW1 3UJAA 3NC0C 3VYSC 3L7AA 5AUQA 2VDOB 4BQQA 2QRMA 3EXEA 4YCLA 3GPDG 4OU4A 4LCUC 2P3QA 5FXMA 1SETA 5CXSA 3U7FB 1O95D 2Y6VA 3D2BA 5G1PA 3NEAA 3HXPA 4OMFG 5E4JA 2HJHA 4C3VA 4D45A 4A0SA 6PFKA 4NJOA 1N9GA 1M2OB 2QB5A 2J3JA 5AHXA 3QLJA 1C7EA 3PHJA 1T5SA 4KXFB 4WECA 1MNQA 1U4SA 2H9YA 3B70A 1G2QA 4NYJR 3F74A 4JB8A 3TQCA 3UKJA 4F3RA 5SYAA 4DIKA 3IKEA 2HWYA 2CTQA 4HX5A 3TMAA 1UZUA 1ULTA 1LBIA 1EK2A 1RYNA 2XOXA 5EJIA 1FDRA 1EGMB 4WJZA 4DT1A 1HETA 4WLEA 4MT8A 4BTVA 4H0LB 1U98A 2R8PA 4ILKA 2FR1A 4LF8O 3LIPA 3W5UA 1G7RA 1W75A 2XXJA 2W6QA 2QWOB 4LJKA 5AD1A 4UBNA 3RF7A 4AURA 1U8YA 1L5OA 1GTOA 3A8TA 4BNDA 5CK5A 1X80A 3MJSA 1X19A 5KTSA 1HE2A 2YJGA 3ZN1A 4KLAA 4DR7O 1JECA 1UMBA 3ON5A 1AHHA 2D5LA 2PSHA 3BJIC 3HR4A 3VC2A 3J7AC 1IWBB 3NKVA 5ALXA 2RAPA 3NHSA 5CFZA 3RUIA 1V7PC 2OZBA 2JPDA 1QZ3A 2EZ8A 1X14A 2V9PA 4D96A 1USGA 4BQSA 2GBOA 3K4PA 5KPDA 2F4VB 4H4EA 4OIMA 4RD2A 1Q1EA 2GBGA 4I4TF 5KI6A 1Z5UA 4OXSA 3KU4A 5AO9A 3S1AA 3Q15C 3QPBA 5LQUA 4ZOLA 1SBQA 1Q7BA 2O3SA 3F5FA 1DXHA 1W8DA 1TM7E 4Z99A 3WGGA 1Y1SA 1G1MA 1QTIA 1DBFA 2IL1A 3PXEA 1PFGA 3RTDA 2ZSAA 1T3TA 5KO2A 3ZP7A 1BNCA 1G21B 4KXNA 3FPAA 3HDGA 2BDUA 3RTGA 4BASA 4CU2A 4IIBA 3V7YA 1LJLA 1O97D 2XGSA 1U2DC 5B3JA 1SG0A 4GPEA 2AOUB 3ROTA 1CQJB 3EARA 3DYBA 5D3KA 4Q7JB 3W6PA 3SIRA 2NP6A 2FUG1 2CHGA 3CLTC 2XVXA 1NN3A 2PN1A 4EKWA 3EXIB 2YV2A 3E2EA 2I6GA 3L1IA 5JHGB 1NRWA 2ZTHA 4URUR 4IQGA 3UK6A 2HEPA 2A9JA 2NAFA 3MOIA 3UF0A 2IUEA 4X61A 4ESEA 4GE0A 1C9JA 1FD9A 1U2QA 2IA5A 5THKA 4BWYA 2DBQA 4BEBA 3BK7A 1PK7A 4P2GA 1ZA2A 3EIQA 1E2KA 1VKRA 1XD8A 2I66A 4W8OA 3VHRA 4ZAVA 3T5TA 1YCGA 4DR5O 4P38A 2AIRA 1VYHA 1KXJA 2AXNA 2D2IA 2YXHA 3I5YA 2IDJA 4FOPA 4QOHA 4BNGA 1NNI1 2C8KA 1STOA 1GPH1 4J75A 5D7BA 4C22A 3IOEA 1KFBB 2VK8A 1KJNA 4B09A 4M9RA 4HGQA 3CLTD 3AVTA 4DV4B 3E35A 1VIBA 1D07A 1FRQA 2IXEA 4Q3OA 4QQNA 1N6OA 3I1FA 1E7SA 1XTRA 2CLKB 3WZMA 2B5UA 2E5FA 3KYCA 1FA9A 2WIGA 1E1RD 2AMFA 3VKUA 3VU0A 4EMSA 1MB0A 3UHOA 3N2YA 4C0LA 3T8YA 1ODEA 2Q5LA 4WOJA 5GONA 2P41A 3A9CA 3B52X 4RK5A 3V9PA 5JPCA 5CVJA 2SCUB 3VH3A 1A5BB 4LQDA 1YQXA 3NQ41 3ZDDA 1J90A 5JS1A 1FXVA 2ZPAA 5JC1A 4POOA 2DQ4A 1WUIS 4BUCA 3LLSA 3TZ6A 4R7GA 5CBKA 4W5HA 2VP3A 3BFPA 1ZRHA 4C4AA 1AKTA 1AN0A 4W9RA 1ULHA 1MDBA 4LP8A 2HCBA 3OE5A 3PI7A 1YACA 1YQTA 4R6XA 3TBFA 2HF2A 3AG4B 3GDFA 3IJEB 5E9WA 5JMWA 4FS3A 3PC4A 1U8EA 4BMSA 2P9YA 2FR8C 2NU7B 4LGCA 1NVXQ 3P71T 1XP5A 1M6VB 3I53A 2OFXA 5CT9A 4ICGA 1P44A 3UC9A 4EW2A 4S3MA 1O6GA 1ZHOA 2Z43A 2YOGA 3OAAA 4II2A 5CGQB 3VPBA 1EFLA 3EG5A 2W6JD 3CUVA 3E9ZA 1QCEA 1UPUA 3TZQA 1YGYA 4OXNA 4LFBO 5BSRA 3P3NA 4A9AA 5BOSB 2AOTA 3LBNA 3KAJA 3ZWKA 2ZRGA 4KTTE 4Z9YA 5HZHA 2GTAA 2IGBA 2ZI4A 1AO0A 3LNMB 4QNHB 4EKYA 2MTBA 3RS0A 5K45A 3ND6A 1L8QA 1PNTA 4TV8A 1GPUA 2QT1A 3DFKA 4QU0A 3DMDA 5EERA 1ZD1A 3WO0A 1OKKA 1SO8A 2JS3A 2RGUA 5IDQA 3H97A 3AY0A 1GH6A 2ZANA 3G8DA 1FYXA 4WI1A 4TWKA 2LBPA 2OC9A 2DT4A 2I1VB 1QG4A 2J6CA 5J4LA 2ZI9A 2FMTA 4HDSB 3K58A 4PO1A 1PGOA 4E5PA 1RZRA 1P61B 1KEEA 3ZNNA 4EGSA 8MHTA 1GNQA 1QAMA 2V6JA 3EH1A 3CVJA 4PVDA 4IFTA 1CUWA 5K51A 4DMKA 5DXFA 2QTPA 3I2KA 4HNGA 2ERCA 4OJTA 4GL4A 2Q2QA 3LZCA 4GS5A 2NU8A 3TZKA 4F5EA 3SJUA 1YJ9V 2WC1A 5F76A 3V4VB 3IAXA 2PTGA 3N4YA 1LDYA 2UYOA 3G7UA 3QJGA 1H2RS 1PZMA 4HQLA 5T57A 3VDMA 4JI5O 2WHPA 2YWEA 3QVLA 1PFUA 2ONJA 3NWOA 4BMVA 2XNDD 5C4GB 721PA 3B6EA 1C29B 2GEVA 3ES9A 4ZVMA 4JQYA 4MWSA 4BMPB 1V16A 3VNUA 1FP4B 3A6GA 2JS7A 3A9TA 1FPMA 1WMBA 4Q9IA 4MQ6A 1AMUA 4CV0A 3BY6A 3L72H 3IHKA 3FGPA 2Z1FA 5DK4A 2ATCA 2VI5A 3DAHA 2VWQA 2EZUA 3QHAA 2Q3JA 2EINB 3IKMB 5KHAA 4NJEA 1E2PA 1TC1A 4QXOA 1JJOA 3G1TA 4WUVA 3VAYA 4EF5A 2CT8A 3STHA 4B5LA 2VWHA 2CGEA 4OJNA 4G4XA 3MRSA 2DMXA 1COWA 2QTFA 2RHCA 4QIWF 1T13A 1KJ9A 2VP0A 3DEIA 4MV4A 2H3OA 4V38A 2P6PA 5D1HA 3W3AH 1G8SA 3OZXA 3JWGA 4N5NA 1RRCA 3SVZA 4LGYA 3RUHA 3H1IH 4MR9B 2QVLA 4CQMA 4UBJA 3NTQA 5WRFA 2FNAA 2NSDA 1JPNA 3VO2A 3WXBA 1N8SA 3RRYA 2ZQZA 3M4ZA 1VHWA 2P9EA 1HLGA 1QO9A 2XNHA 2YDYA 2ZBGA 2RI1A 2RJOA 4IILA 4G41A 4Y9RA 1UJ2A 3K1TA 2P6JA 1MDFA 1SU4A 4EQZA 3S8YA 5JJLA 3KEMA 5JLJA 1YGPA 2ID4A 1DT9A 4EJFA 4HQKA 2CC2A 3D6TB 5IJXA 2R8OA 3FZNA 2RHWA 4CHTA 3QEKA 5CAEB 2SNIE 4Q47A 2D0OB 2QA5A 4DT1B 5JALA 2INGX 2Y1DA 5CCBA 4RY8A 4Q6GA 2P91A 4JP5A 1Q6UA 4YWJA 3EAGA 1KRWA 2ZK7A 4MYDA 5KKAA 5BN5A 2Q4PA 1K1EA 1MH1A 1AILA 2MDTA 3A4IA 1W87A 4GZ3A 2DHDA 1HPLA 2HMAA 5KQPA 1KF0A 1JFTA 4RIHA 1B26A 4NE2A 3ETGA 2PSDA 3FYIB 1C4XA 4P5EA 2B7CA 4RU1A 3VJMA 3TETA 4JI2O 4PIVA 2IW5A 1IWOA 1M54A 2JI4A 2X3YA 2ZWVA 4DBVO 1W42A 3VI3B 1XK7A 3SSNA 1Y8RA 1Q95A 1QC5A 1XEXA 2W2NA 4CFYA 1RM1B 3OC0A 2RJNA 1KUQA 3A1UA 1JAIA 4NCXA 3TAUA 2A58A 3BRSA 3G0DA 2GEKA 4FK8A 1PL0A 2WSSG 4V2UA 4YJGA 4YAEA 4DG8A 3AU9A 4DIEA 5KTNA 3AVXA 3FB1A 1SCQA 4W7IA 2XT0A 4X7RA 3EHEA 5BSFA 4YH1A 3SKXA 1M90W 2EP7A 3A4MA 4TQDA 2QN8A 2IS4A 3LLMA 1IOLA 3N07A 3HA2A 4ZHYB 2E5LO 2OBFA 2P3LA 4IXWA 3EN0A 5DFAA 4C3ZA 4EY3A 2NIPA 4LOIA 4LFCB 2JI9A 1ECFA 3WISA 1DCKA 6YASA 1QH0A 1VHTA 2WJJA 3A9RA 4MJ3A 5JWRA 1XEAA 2DCUA 3JS5A 2XVYA 3ZI4A 3AUTA 2QTNA 1VLVA 1VSQA 2XUPA 3LYHA 3OQJA 2XXBA 3RPEA 3R3ZA 5EWMB 1CJTC 3NBAA 1V16B 4YT4A 5JAQA 3JVIA 4FYWA 4RTNA 3MLBA 3SU8A 1MQAA 1LNSA 1OFUX 5IYBO 4KKXB 2REQB 3SHTA 3ZE8A 4A73A 2ZZNA 4JWKA 1UP7A 3OIFA 3S2GA 2C03A 5K2OA 2G67A 4MNTA 4RJLA 5F5LA 1B3RA 2WLSA 4HZ3A 3PQ8A 3W1VA 3MWEB 4AJEA 1N6RA 4FJ2A 3NVIB 4KRYA 4D9CA 2W11A 5AM3A 3UJNA 1H0SA 4EI9A 4D0RA 1QVZA 4LHYA 1ZGGA 4ALJA 5G0TA 2EC5A 3NUGA 1T9GR 4RCVA 1J0XO 2HA2A 2X76A 3ANMA 4MRSA 3DWIA 2GUWA 1E1KA 2VWGA 5EPOA 2WQ6A 3SR2C 2XADA 1E18A 1KK2A 3FGOA 4LXGA 4AIIA 3S2UA 3TCKA 1RM5A 2BLLA 4HDSA 5AJYA 1P5FA 3MGCA 5SV2A 1BQ0A 1JBEA 4OHMA 2GR9A 3EJ6A 3ONWA 2XAHA 1ZM9A 3QWIA 3MYRA 3VDRA 3L6DA 2SHKA 5DM1A 5C5CA 4NKGB 1RWXA 3IQZA 5CEFA 2QJTA 5ALLA 2PXHA 3C41J 4TQUS 1CRQA 3EZFA 3WLAA 1LVHA 3T0FA 4CWAA 2OC4A 3EMBA 2H1HA 4MRMB 5H9VA 3TE6A 4DQLA 3F5DA 5LOVF 3CXCU 4IS3A 2XZDA 1UT8A 4GX1A 1QYRA 4JLUA 2XYGA 4CR7A 1CVIA 4YPVA 5JAPA 3K9WA 4DDHA 4Q1FA 1EBBA 4MKZA 1CE8B 4DJJA 2QR2A 5DI9A 1L7MA 1CDZA 4NCHA 3RSCA 1YJNF 3R75A 1I0ZA 2ZI3A 4CL8A 4CKEA 4MYHA 3VA7A 5GV8A 1NT2A 4EITA 2X2EA 1RPTA 3K8ZA 5REQB 3IALA 1Y1RA 2IOQA 4XE5A 3KR0A 1D8AA 1QHFA 3NKLA 2V9CA 4QE3A 1T34A 2JEUA 3I56F 2RAUA 3KT6A 4KZPA 1RFYA 3EXIA 3SLGA 4LFAB 2J5RA 1V8ZA 4UHKA 3TDMA 1RQ7A 3MA0A 7REQA 4QUBA 3OOEA 1ORIA 5JJNB 2IPNA 2YWFA 3DL7A 4K6KA 3VDNB 3AW9A 1SGWA 2QKCA 1QF9A 1GV1A 2AN9A 4Y0NA 2ZCEA 2OOKA 3DLAA 3EIFA 3PV0A 5EXPA 2BSQA 5HOEA 3R9IA 1ISSA 1J99A 1NVMB 3DKIA 4ZYVA 2EX4A 4HRVA 4M1ZA 4YX9A 2CGOA 2JNBA 3UJBA 1KKUA 5LMUO 4BY9D 3LWRC 1QG6A 4KXLA 5E38A 4CKEB 4ZGBA 3SWWA 3GB9A 2VYQA 4NTYA 3TI9A 4IXTA 4LZOA 1OH8A 1X2BA 5EJMA 4JT2A 2P62A 4EB6B 1NW7A 2DWQA 5CDFA 4TYYA 5DT9A 1WQ1R 4Q9LA 2OTLF 4X88A 1K0FA 2IZ6A 3WHKA 1NRIA 1PHPA 4B3FX 2FP4A 2AG0A 2FZKA 4HK4A 5AVTA 3APQA 3IFXA 3L7BA 2FZCA 3ULKA 4ZVUA 4F85A 2FOLA 2JAQA 3B13B 3AFHA 3NOQA 4JCOA 1G6Q1 1R00A 2EYQA 3PDWA 4E2FA 2PUDA 2HP0B 1FP7A 4LXYA 5TPZD 2VXBA 1XRRA 3ONEA 5FOWA 2O8NA 1G5PA 1M2HA 3IEQA 3K9HA 2FMHA 1U0JA 1BMFD 4XXHA 5FV4A 1VQPF 3AKZA 3IHTA 1JMKC 4JDPA 4BKQA 1GNRA 1Q8RA 1RM0A 4BNUA 3BT7A 4LNUB 4DV3B 7YASA 1B6RA 1K7YA 4LXQA 4NZZA 2NNWB 1VZ3A 1KMIZ 3A04A 5JCPA 1A7KA 1OHHA 4G65A 2DGDA 1KYYA 3G7NA 4XIFA 3UMVA 2WM3A 3WLRA 2DF8A 2JEYA 4M38A 3GARA 5HQ3A 1FDUA 4AQ7A 3H87A 1E1LA 3AFNA 2BI7A 1Q22A 1M1ZA 2NVOA 1CJKC 4FLWA 1GA1A 3AR3A 4IFIA 3OQVA 2VHJA 2P4EA 3U4HA 4BCDA 4AYTA 3KHSA 3LPDA 2WI8A 2A7XA 3NASA 3AVPA 4OB8A 3IYLW 3WWCA 3AI2A 1FFCA 5GIOE 2ECOA 3RVDA 4MPJA 3NHBA 4BB6A 5E4TA 5AYVA 1P4SA 4JB2A 3HB9A 2HREA 5EMMA 2P2ZA 4TVOA 2LTAA 4X7BA 4A1OA 1VGVA 1KRXA 2GN6A 2ZB4A 2EG9A 4IOJA 3IE0A 2DVMA 2CMHA 2MOKA 2DR3A 1BFUA 4OB6A 1Z0AA 2JCXA 3LHDA 5DNVA 1RAFA 3M4NA 4KNWA 3RYHA 4J76A 3WRXA 5LQJA 4C8EA 4HWRA 3EQ9A 2OAGA 3FWZA 3HP7A 4PHTA 3SYNA 4RH0A 3TLZA 1MP0A 3QTYA 4LYEA 4NBWA 4YJDA 4O8ZA 3T1OA 3A3YA 1TYDE 5ERGB 2ZJFA 5AVOA 4QPDA 2HEGA 1Y6JA 5FYDA 3ELBA 2D2VA 2QQEA 3T61A 1IJBA 2YN4A 3J81k 2B9VA 5CNMA 5D5HA 4GKKO 4FHFA 5B5EZ 1U7OA 6LDHA 3ZQKA 4CC5A 4QGGA 4G27B 1DT5A 5HW0A 2Q5CA 5HSGA 1N3IA 1VQ4F 3FD6A 3E4CA 2ZZMA 4IT5A 3E2PA 1MUUA 2G80A 3QLUC 4KX3A 2AMJA 3THXB 5TPZA 4L73A 5FOQA 1T1RA 4BT6A 2GCIA 3C98A 4Y8VA 2JFBA 5LR6A 2C54A 1YBMA 4MITA 1O0SA 2RI6A 2O06A 3OPVA 3RWOA 4MYTA 1M6VA 3HRKA 3CWZA 4IDFA 1WQ3A 4HXEB 4BKPA 4A27A 3FFXA 3EWIA 4WK0B 4AZSA 4OIFA 1EVLA 3LLUA 4ZICA 5IU6A 3JQ8A 1L4GA 4I7ZB 1PR2A 2IT1A 3WK8A 1GZ3A 1K9VF 5CUQA 1EA5A 3S2EA 4F4UA 2VK2A 4DUYB 4LY6A 3BXGA 4JJFA 3CX7A 2FPPB 3H13A 3F5SA 5DYWA 1GRQA 1E2EA 3DOIA 4JPRA 3CCJF 1O87A 3H65A 1NWHA 5HUQA 5JW6A 1NV9A 1FSGA 2HKIA 2VS1A 1LQ2A 2ZKOA 1CFJA 3TQRA 5C7OO 2UUBO 2VSNA 3BMNA 5FX2A 4G36A 4QHSA 2EW2A 4D3SA 1OI4A 5L4SA 2VXCA 4UD6A 1SQGA 3PP8A 1F4MA 3PZRA 1KD1W 3DE3X 1V45E 1EAMA 4MB2A 3UVEA 5IWCA 1T2DA 1D5NA 3FDXA 2HJVA 1DAMA 1QH8A 4QVGA 1EM8B 2VUTA 3CBGA 1JH9A 3IUPA 4B4VA 2BGJA 4DB4A 1XXHB 3AIIA 5AQ1A 1F60A 2O2CA 4EYGA 5J4HA 3IP7A 4BKMA 2H2GA 4CMHA 3C3CA 1WB4A 2ZDHA 4D3ZA 5A1TA 1U4OA 5TJHA 5K09A 3BIXA 4CM3A 4QLAA 1H6AA 1Y3AA 3OQIA 1UP4A 4BYGA 4M9CA 1XBIA 1W44A 2K1EA 4QSHA 2AMLA 2O7VA 4AF7A 1IHOA 5BN5B 3P5SA 1VK3A 1DC4A 2Q3CA 2Q49A 3K1YA 1UODA 5JD5A 1DFIA 5H2FZ 2YWGA 4AO7A 1EHCA 2AR7A 5KYUA 2CW4A 2NXWA 3KSMA 1G3QA 5IYDO 1R3UA 1KZ9A 2REOA 4PSAA 3HSSA 3U1TA 5L7WA 2GH1A 2GJ9A 4UD2A 3OF5A 1J23A 1GCUA 2ZS7A 5SYNA 4B7CA 4FVTA 3SHFA 5KOHA 1JE1A 1ZN7A 5G4UC 1OCEA 3BB1A 3KUCA 3OQHA 1D2AA 1U0FA 3AO0B 3MGAA 1Z0SA 1R0BA 3PLNA 3VX4A 4DJFC 4XM0A 5B64A 3K2EA 1OB2A 1HZZC 2V1UA 4KHZA 3OQBA 1XMIA 1JD1A 2CB0A 2DG2A 1GUDA 2X7JA 4PAMA 1X1QA 3IMFA 3FYUB 2NR5A 1Q0PA 2LCIA 4XWOA 1YQUA 5B1IA 1J8QA 1JR3E 3DFIA 3IBFA 5G0SA 4DO2A 2R1VB 3A2KA 3UC5A 2V58A 1GIAA 4EPXA 3V1NA 3BF7A 1YA6A 1OJLA 4YQEA 1A7JA 1D8TA 3ZWBA 1DO8A 3MT9A 1YDWA 2LBTA 2YOFA 4M0LA 4U3JA 2MHCA 2I6DA 2O3TA 3SPIA 1E7KA 2GBCA 2PM8A 3UH0A 4K0RA 3GELA 3F5QA 4Y9DA 5EIHA 3AGQA 4DNXA 2XMZA 1FE8A 1SZQA 4JUDX 3IUEA 4UUNA 3TEJA 3CC8A 2F43G 1AGNA 4CH6A 1NYQA 4E33A 3MCAB 4R40A 1N8TA 1N75A 4XASA 3T9EA 3NWJA 1CUAA 1XTIA 4ABYA 1JEQA 3I42A 2C1ZA 5IABA 3D5QA 4QUHA 3FLEA 4RTSA 2B7BA 4B3JA 1SEPA 1Z15A 3Q11A 1OXXK 3VFDA 1OXTA 1DIAA 2B35A 2W7TA 5AXAA 4A2PA 1VG1A 3G5UA 4CIWA 1Q3KA 4I2NA 2HLHA 1HC7A 1N2GA 2RGGA 3JSLA 4MVRA 1KEWA 4JTCB 2H16A 2MMGA 3MT7A 3PPVA 4MMYB 1V3VA 1LUAA 1Z18A 4X41A 3RFXA 4OJKA 3PXXA 3R44A 1XTQA 2QE6A 3D3WB 4O2AA 4AJ2A 4L3VA 3LZDA 4WEOA 2HN9A 3K1AB 3SPCA 2F43A 3RIGA 3ACDA 4RZXA 3A0BZ 3ZLVA 2Y9MB 2VUSA 5DWVA 5FBLB 1OTXA 3PFKA 4G9EA 3JZIA 2WWTA 1K3EA 5H5NA 3R3UA 3HV0A 3STXA 1B6QA 3QBEA 1MLDA 3NK6A 1Q7YH 3GFTA 4FX5A 2VHXA 4ZKEA 2FUNB 1ZCBA 2IQQA 2ISQA 2OGTA 3EY9A 1X7XB 3QGMA 5C3MA 2CNKA 2NO4A 4KLZA 4WW0A 4YMTA 4ARBA 3ZVKA 1MJGM 2V7EA 4XFKA 1IXBA 2AGVA 1SU6A 1NW6A 2GZ3A 2I2DA 5HUHA 2I4NA 4X54A 4OHZA 3NDJA 2Z9DA 3CLRC 4P0QB 2CBXA 3NW9A 1XJCA 1VQMF 3O0TA 4FWIB 3BGOS 3ZHXA 2OFWA 2HDHA 2Q2VA 3GLIA 2JVKA 1DAKA 3QQPA 1Q7GA 3JQ7A 3R5JA 1KP9A 3L1UA 2OLEA 3QOWA 4Y2VA 3X2FA 1ZGCA 3GV0A 4QBHA 3VVCA 1BHAA 1JOYA 1GVHA 3HI4A 1FXKB 2FQXA 3MB5A 4B34A 1H5UA 4QZVA 1PBNA 2YYEA 1VQLF 3R65A 1JXQA 3FY4A 1E7MA 1GD1O 1SC5B 4FZ0A 1XF1A 2I7VA 2QP3A 4E5NA 2XVMA 4E1VA 2VHCA 4WFEA 4JI5B 2D3OW 1FAFA 1QFZA 1LK5A 1VYUA 5JJBA 3U44B 3HB4X 1XCLA 4E2LA 3AF0A 1I32A 1Z4IA 1AT1A 5AM5A 1YJCA 5L6LB 1HYGA 3VPDA 4OXRA 1EDBA 1QPGA 1U31A 1JTEA 3ZVLA 1P7CA 4DYVA 3AEKA 4DCJA 1F1JA 1AZLA 4ZOCA 2L2QA 3HN6A 4DCSA 4NAVA 3WGVA 3TSWA 1K8AH 2H5IA 3OX2A 3H84A 3F5WC 1IV2A 3IE2A 1FXWA 3PUYA 1NKVA 5EXSA 1US8B 4I50A 4J80A 3R7FA 3STZC 2FMKA 2YN0A 4MKXA 2PWZA 2EU8A 1VLHA 4BRZA 2WLTA 2EIKB 1M66A 3GVMA 3KKPA 3FVTA 3VO8A 1NN1A 4RA6A 4BNLA 1JFSA 4UEKA 5FPYA 2M6YA 1UFKA 2Z0AA 2F9LA 3DONA 3LJKA 3ZEDA 4OKNA 1W9HA 4D4JA 5B7QA 2JIRA 1KMCA 5A04A 1F6BA 4PQRA 3K32A 3UPDA 4DGQA 5C35A 4F21A 5MFZA 2LDBA 1E3MA 2Y48A 3D9QX 3FPFA 4IPTA 2HJDA 3DT6A 3LT4A 3F4LA 3PX7A 1V3TA 1J00A 1PEYA 3R24A 5F77A 1J1ZA 2HH9A 3CRAA 1H0KA 1NIPA 2OILA 5ELMA 4F92B 1DC5A 2VYCA 3SF8A 4IIFA 1W36D 1E2GA 1N7HA 3CLSD 4N54A 3QOFA 4NENB 4C76A 5C4MA 1S1CA 5D51S 5G4VC 2ZOVA 3K0FA 1JN0A 2Q45A 4JEHA 4D4LA 2ZF8A 4MYSA 2E1RA 1M2OA 2QAIA 4UAJA 4F6LA 2H0RA 4GXRA 3FTCA 4NE9A 1XBTA 3HU5A 5LHIA 4JBWA 1Q44A 1QKJA 4JT8A 4BX3A 5BXYA 3ICQB 4HDRB 3TPFA 4GUDA 1DUSA 1TGVA 2VNKA 4XLZA 3C7DB 1KMHA 3BE8A 4WOBA 2PUFA 1RLGA 5NLLA 3WKEA 1OV9A 2YQZA 3UMJA 3M1IA 1SQBH 3CEHA 3QK7A 4KL8S 4KNVA 2VAXA 1PQYA 3VHXB 4PI0A 3VZPA 4B82A 5ALOA 1KL7A 4UXJA 1COWG 4X6UA 1JLKA 1Z5GA 2H18A 3G79A 13PKA 1B93A 1XZEA 1I7DA 3D3IA 4F96A 3WB0A 2GMWA 4CM7A 3FOZA 3ETQA 3UBTA 2F2TA 1EXNA 1R73A 3DA8A 1DF4A 5F3WB 2W2KA 4NFSA 2IYRA 4JI4O 4TS1A 4CODB 2W93A 4XSGA 3HDQA 2BEKA 4UDOA 4O25A 4BFWA 3HACA 3RH0A 1F1BA 4MV3A 4BNFA 1H66A 1NI5A 2WF6A 1JPUA 1K0UA 2OVFA 2WUFA 4QG3A 2IH4A 3AL0C 4WNIA 4PI2A 3C8UA 3DV9A 1VARA 2EJCA 2HF8A 1QGED 3K92A 3PRJA 4EKNB 3ZHUA 4IDPA 2WUEA 1NOJA 3EFFK 1D09A 1UP6A 2YV4A 3K2XA 4PCLA 4OP3A 4N3AA 3LBAA 3M8KA 3KXIA 3X1JA 3ZZTA 1P1FA 3LFOA 1F12A 3GAFA 1TYBE 3OR7C 2E55A 4JOBA 2EOAA 3F3MA 2RKOA 3NTLA 3CPQA 1PQWA 1SA0A 1IEQA 2OQRA 5JBIA 1JEYB 1T2NA 3ASZA 1OWMA 1VL6A 1Y76B 2V7BA 3CSDA 3GT0A 4DG5A 1T4DA 2JGFA 1ABFA 1NF2A 2QYHA 3NB0A 1XQWA 3RREA 4KO2S 1KIAA 4BO9A 1LJ8A 4NYMQ 3BGIA 1ZWZA 4CPDA 4C08A 3HH8A 4XWKA 1XLWA 4IJQA 5HHTA 4Z1MG 4BFUA 2NQ2C 4WUTA 2J9ZB 3GY0A 1ZH0A 3UMBA 1UIMA 2DOKA 2I2AA 5I5EA 3GJ5A 2QPAA 3AG5A 1KMQA 1TIKA 1K33A 3GMTA 1V95A 1RAAA 2AN1A 4BZWA 3SSOA 1TT7A 2VWPA 1U80A 1PEKE 3KWLA 4NS1A 2ILTA 2O0JA 3HVUA 3R20A 1JGTA 3TZEA 1JH8A 3NGMA 3A6FA 5IS2A 4ZVKA 3E23A 4MW8A 1I6WA 2CHQA 1WMEA 4JJ6A 4DA9A 5JZVA 3IAHA 4RVFA 2BGKA 1YUBA 2QX7A 4BP1A 1FRVA 1V1MB 4OI1A 1IE3A 4WHMA 5GAJA 4AN4A 4MWZA 3OLWA 5HXUA 3DR5A 4Q48A 3TTWA 2HLNA 2QSZA 4D8TA 4RD6A 2IBZH 1FIUA 2YASA 3I58A 4U9HS 1JJFA 3GC6A 4BZQA 4HT3B 3ZD7A 1NDQA 1GTJ1 3R23A 3QU2A 1Z8DA 3A4VA 2JGDA 2PYLA 3IDSA 1JWBB 3MJHA 1G4UR 4R3NA 3OC6A 3RC7A 4ARAA 2X0IA 5U4XA 4WXEA 1NVKA 3FYSA 5FPSA 3TD9A 3G8BA 3FWPA 4F4IA 2OHVA 1XE3A 2D62A 3JQ9A 1AF4A 2JIZD 3W7UA 2A67A 2G5TA 1G1XB 3BXZA 3HDTA 3CYPB 4A4DA 2RNBA 1ZNWA 2BFEA 4CTMA 3D4LA 3R5SA 1C0EA 4F0JA 3GLHA 5BQPA 2O8EB 2HRUA 5IZCA 5BXQC 1NUAA 4RZHA 5G2OA 4Z49A 1TKAA 3QEJA 2OLJA 3GNTA 4X1IB 1WJZA 4G1VA 4ND7A 4GR5A 5DIFA 3IL2A 1G4HA 2AL7A 3LCRA 2HJWA 5DYYA 2PZKA 2A7QA 2W43A 3LQ2A 1AD2A 3AILA 2FI1A 3H83A 2UUPA 4UATA 4R84A 5JSZB 3CEMA 1YKFA 2ADQB 3ADCA 4I1PA 3SS9X 3USZA 4QLBA 1E2LA 2XYRA 4Z1OA 2B34A 2OLKA 3DLCA 1AK1A 2NW6A 2X4LA 4JK3A 4X8HA 4BMXA 1OAOA 4WL0A 3U61B 2X0LA 1YR3A 2C9DA 3KCXA 3M3DA 5FBZA 2QE7A 2VOJA 1H6DA 4BVLA 2DBVO 1A4XA 1WAZA 3I7TA 5JCJD 3L1VA 4OQDA 1UDRA 5IM4F 3TAXA 2JIPA 1DV1A 1B7GO 3S8MA 1LNZA 3QVSA 3IV7A 1R37A 1QKKA 1QFMA 1OPXA 3ZRVA 3QTTA 3WR5A 2JLXA 2B36A 3C6KA 2C7PA 1Z7WA 4K8XA 1L1RA 1NR5A 1GXSB 1NONA 4QYTA 1QIDA 4IL5A 1ESNA 3H2KA 1PE0A 3OLVA 5DCWA 4E46A 1VG8A 3CX4A 2GT1A 4ANFA 3GMIA 2IXAA 4TTSA 3MAQA 1QVFU 2B1QA 4QGAA 5AKJA 1XCBA 3CH7A 2NXCA 4QFDA 3ZV5A 1XDZA 4II3A 5H59A 4IYHA 5AI0A 2P6YA 1KHTA 2FE1A 1GZUA 2YWCA 3BMXA 1EZVH 4YLEA 1N32B 1SHUX 4KVZA 1RZ3A 4M8IA 3PIIA 4R5MA 4CDGA 2KQUA 4ZEVA 1UZAA 1X13A 3K4HA 1DG9A 4J9ZB 1X1SA 2X9LA 2GF9A 1U1FA 1QMPA 4QJFB 1PJCA 3GROA 2YJNA 1VI5A 3RRXA 1E0JA 1A1VA 3PNSA 1U8XX 1FUEA 2M7WA 4L2IA 1BXGA 3NJ8A 3FDZB 3UT6A 4QGSA 5L3SA 2R6GA 4EB0A 3EPHA 2ZRLA 2Q0SA 4FFVA 1GG8A 3SC2A 3PC3A 3KL2A 4CCWA 5CDGA 4W5RA 1XLUA 2AN3A 1J42A 2BJWA 4QJBA 3LYLA 4QT0A 3V32A 4YN3A 3TSAA 2PGNA 2D1SA 3D8HA 1UKYA 4BV9A 2ZUUA 1KZHA 4BVFA 4GLOA 2YVAA 1X39A 3A36A 3N5KA 5FTLA 2NN3C 2WHQA 4IKPA 3LVRE 2ID7A 2V74B 4Y3UA 3DKRA 1YS2X 1JU4A 2IVFA 3Q8MA 5HIKA 1MB3A 1HR0B 5JO0A 2JEXA 2HIAA 3B60A 5MGNA 4F3TA 4TZKA 3U1VA 1PL8A 1XI2A 4WN9A 4X8OA 1JFVA 2QSJA 3AL3A 1SBHA 2BEWA 3C6XA 3NYWA 3T1VA 1LI7A 3P0ZA 2XNDA 2FGYA 2G5GX 3TWOA 5AVVA 2ZI5A 5IXYA 1K2VN 5IK2A 3NIGB 3P2YA 5HK9A 4NCAA 2ZUWA 1XZ8A 2VCYA 4G0YA 4E07A 5IEJA 3JRXA 1NVAA 1UBTS 4HDRA 3K5NA 1G64A 4CETA 2QPLA 5F1YA 1QC5B 1HG1A 1XEXB 4EJ0A 5K5EA 4ZAXA 2Q7EA 1NHGA 1P2TA 1XQVA 1ZLXA 2I6XA 3CZ9A 2AFRA 3RJTA 5BOSA 3FDFA 2FY8A 4MRMA 4MGYR 3EZ2A 4U2EA 4WFFA 3U3OA 4TYMA 1MA0A 4OHPA 3QSYA 3BQNB 4HOYA 4EUKA 1QQ7A 3HYLA 2O4UX 3RU2A 4L7VA 4RJKA 1L4UA 3EPJA 1B15A 4PFKA 2H2HA 3C8DA 3THYB 4AJOA 3L6RA 4HL6A 4DLRA 3D43A 1S2GA 3PDUA 1Z37A 2JATA 3L1HA 2E6KA 5HOQA 3E03A 1N2EA 2C2YA 4B08A 1I3OA 1LPMA 3OZEA 2FJPA 1L4LA 2KWIA 2VF2A 4GEGA 3ND5A 4J4BA 2B8WA 1P39A 1ST2A 1V55C 3K14A 1L7PA 2A0WA 2A1UA 5KMGB 3H5LA 3KTAA 2C07A 1FUIA 2WMNB 4LCJA 4ZV9A 5G0WA 1OTHA 1QIFA 2GFQA 3WNQA 5FP0A 3COPA 3OJ0A 1QR8A 3VNSA 4IIDA 2R4TA 4EHAA 4MUIA 1YZQA 4J7CA 3PVSA 1Y3CE 5B66Z 3F0EA 1A1SA 3HKDB 1TRHA 1M56C 2C20A 2RHBA 4H6XA 5D85A 4BO4A 4ETMA 5GQSA 2VDWB 4XQ0A 2V5UA 5AVQA 1SOMA 1XD2A 4G1FA 1A7UA 2KGWA 1JEJA 2KSQA 2RGNC 2O54A 2EIMC 2CHUA 3E18A 4JR2A 2XMGA 1UC8A 1Z73A 3LSTA 1VHLA 1F8XA 1U2RA 2H8GA 4HGRA 4GKAA 5FNZA 4GGMX 2X6BA 5L9AA 1WXEA 1FYJA 2WJYA 1FFEA 3BMOB 4MYCA 4I8DA 2XNDG 2E21A 3JQAA 1C8BA 3QVWA 1OBHA 4IQ0A 4KDFA 4LISA 4R1LA 3DD1A 1TMOA 4B6JA 1KPIA 5HY1A 4PZPA 3L4JA 4Q9HA 5GOZA 1BIFA 1DE0A 3AHFA 3RS8A 2NGRA 3DDWA 2TMDA 1B16A 5M5BA 1KS9A 3UJ7A 3DC6A 2KJQA 4ZO6A 1KEUA 1P7ZA 3OESA 2JGUA 1PJTA 4AG6A 3AUYA 4G5FA 5ETJA 2ZXWC 1N2XA 4KQWA 3UICA 3DV0A 3K6RA 1C0LA 4QU9A 4UCWA 1DWOA 3ZHZA 3CH6A 5EEGA 2Z5FA 1GCAA 4RVGA 2YHSA 3GGJA 2VAWA 4MVJP 2OCCC 2JFUA 4HPXB 3ZEAA 4X64B 3DCNA 4QSMA 1JHVA 2V7QG 5SZHB 2PJDA 2WEKA 3L4SO 3NU1A 4U8HA 5TDHA 4EGFA 4GMFA 1FUUA 2FFAA 1W73A 1LUVA 1FP6A 1QVAA 5LA6B 1N8RH 2W6ID 1DQNA 1E79A 1Z6XA 3HO8A 4X8LA 3EVFA 1JRLA 2ZJ2A 1BHJA 1PKXA 1UKBA 3KAKA 4IVNA 4B3XA 2VXOA 4QYSA 4WY8A 4CMKA 3HP4A 3KYBA 4BKRA 4TQAA 3HA7A 2EZOA 4A8JC 4Y7DA 4Z9AA 3NHWA 2ZVZA 1PM9A 4FSXA 4A91A 4BNHA 3P2MA 4L5YA 4RHCA 3G0GA 4E2XA 2PUJA 1YBFA 3ILXA 4H37A 5AWFC 3SQMA 4DV7B 1TFRA 4MTCA 3T52A 2LGWA 1FLVA 3KZCA 2CJWB 4B8YA 1AH2A 1QQAA 1MNGA 1KPGA 2CXNA 1NOIA 2K2WA 4ZQIA 3VPSA 4DQXA 3VU9A 4LI3X 3EG9A 1WPQA 3SPHA 5B1SA 3WJAA 5KJCA 3L70H 1KORA 5LP6A 3CH4B 1XCOA 3TYXA 1QQBA 1E3SA 2M98A 1K3UB 2X9NA 4I1SA 5JZMA 2IPOA 5LN1A 4B7KA 3HKEA 1ZCJA 3T7AA 1KO7A 5KOYA 5DISB 2ALEA 1A0OA 1E3DA 2M6KA 1AP5A 5H80A 3ZYZA 2QHXA 4UCOA 4FMPA 3WKAA 5AW1A 1HURA 121PA 1I1OA 4AP5A 1B6SA 1C50A 2BMJA 1TTTA 2C0CA 4D92A 2IFTA 1ORQC 1IRXA 1BGWA 2PL5A 1YU6A 4CM4A 1H2YA 2HWUA 5EBMC 1C0KA 1ITZA 4RMHA 3UT0A 5TT1A 4B0OA 4EA7A 3HTNA 3OM1A 4GEKA 3LDEA 1XEQA 2AXTZ 4ZQFA 4F91B 3TBKA 2CE7A 1KAEA 3WK9A 3ABMB 5B1NA 2V54A 2Z8XA 1DIBA 1L8XA 4FJCC 3IVXA 4YPFA 1GARA 4K5QA 4U7FA 5HS6A 3GDHA 3EWSA 1GUZA 4C0HA 2IW1A 1X8JA 5BVHA 1DX9A 1P84F 2XA2A 4BTLA 2OCBA 2RKWA 2Y1OA 1P72A 3DLBA 3VQWA 2E49A 4BUJA 1JSCA 4QUJA 3ZWVA 5JECA 1ADJA 4HB2A 3E9EA 3ABIA 1J56A 1UJCA 2GSDA 3S5JA 5A5VA 2C5LA 2W5UA 5HY0A 2HWKA 4JUIA 4FMBB 1NXVA 4NYMR 2PD3A 2QLTA 2AZ0A 2C4HA 5AW4A 4OMUA 4HYQA 1Z68A 4IUDS 4WTOA 3PG5A 1T9GS 5TS2A 3RHFA 2GEBA 2JBAB 4KJZA 3F7VC 2VG8A 5E1AC 1C7ZA 2WU3A 3DDZX 2GV9A 3TZLA 4B80A 4D44A 1R9MA 5EJEA 1FNCA 2HBRA 1GNLA 3B6IA 5THQA 3FVVA 2W22A 1JFFA 2YW9A 4MLDA 3GLFA 1R8XA 3SPXA 4IDBA 5DX8A 3ANYB 1XN1A 3KKMA 4AUNA 1VOTA 4FGZA 4HLCA 4Y9SA 2XT6A 5IF3A 1KEVA 2XUGA 2QD4A 2HNKA 1GT6A 2E6UX 1QYCA 2FH5B 3QEMA 3VKFA 1YD7A 4IBOA 3D8UA 4WESB 4JMPA 4BS9A 2FN3A 3K5WA 1NVPD 1C30B 2IV7A 4M7PA 1W1UA 1H0RA 1LXCA 4MWDA 1A9RA 3CURA 3U44A 5ALYA 1NSFA 3OGCC 2APJA 1W88B 2ZR8A 3EVDA 2VF4X 4CLRB 4R8RA 1XXHA 3BSSA 1HX7A 3H4TA 2PF4E 3ND9A 4F45A 5I7FA 1W4BA 1RQPA 1G59A 2OD9A 2PQMA 2CW5A 2VNJA 2NACA 3DTVB 5F1OA 4LOJA 3SZ3A 1HI9A 2B4QA 2ORWA 3OCCA 5ES3A 3OCYA 3PCXA 4MINA 1LDMA 3U81A 3A0UA 4IUYA 1YB5A 1V26A 1O77A 3WDKA 3N39C 2EGUA 3R7NA 1TU4A 3RKUA 1HNNA 1QDUA 4M1EA 2BM9A 3WTCA 4BMYA 4W6QA 3WGLA 3TD5A 4HAXA 3HRIA 4P2BA 3KBOA 3INTA 2ZROA 3JZDA 3KJXA 4DRZA 3TGUH 2XTMA 1GXSA 1CR4A 1YJBA 4KN9S 2J41A 4X3PA 1R6KA 3D7MA 2SCUA 4PGFA 2IWHA 4ZFNA 9LDTA 4ZT5A 1ZXBA 4MV9A 1WBDA 1G18A 1NASA 2ARKA 2H00A 3WNDA 5LIPA 5CA3A 3B53X 1C7QA 1YRWA 4HGYA 4P4LA 2X42A 1PWYE 2J3HA 1XZNA 3I5MA 1JIKA 4F4JA 3HGTA 1RBZA 5DTEA 2FLWA 5ED4A 1G6UA 3A2MA 3IRVA 421PA 1HYHA 4GMXA 4GQIA 5I9LA 2FRDA 5HIIA 3TKAA 4DLUA 3LV8A 4F12A 3QBTA 4H44B 1SA0B 1MHPA 1Z0UA 2AS0A 2DWPA 2GA9A 4BDTA 2R6R1 4FK5C 1G6KA 2ACWA 3S06A 1IQRA 2GWRA 3MBMA 1W0CA 3GK3A 4TTTS 3VZDA 5HM8A 5TXGA 4OHXA 2QW0X 3BILA 1XL1A 2ATXA 2O1SA 1KJWA 1CJMA 2ORIA 2Y68A 4B6RA 4DIFA 2QM4A 2VRBA 2JH9A 3TQQA 4EK9A 5JQGF 1R9NA 4FHCA 2QLFA 1VYVA 3RVJA 2VYND 3DZIA 2A5GA 4FDUA 4QM6A 3U48A 4FLUA 2BE3A 2H4HA 2REQA 1Z6TA 3BH0A 3MYYA 4DV5B 2G17A 4NAUA 4PPFA 5FI1B 4LFAO 1Y6FA 1UBSB 2VJMA 4NCKA 1F0NA 1KR2A 1TT5B 1TAQA 4U6QA 4CM8B 3ZZMA 1JAZA 1JJIA 1LDNA 3ZWAA 4M8NE 3WRYA 4UVHA 5EJ2A 2HMTA 1TUBA 2HT6A 1YQGA 3OZCA 2Q7XA 3GRCA 1H22A 3GQBB 1JYSA 3FUXA 1P7WA 4TM7A 4HX2A 2FTKE 3B5JA 4IKEA 4XJVA 4ZJUA 5A2QN 4YXWA 3K12A 2VUUA 4WSOA 4U5XA 3SVLA 2PKYX 3MILA 1ZGBA 2V7GA 3GWOA 1W3EX 4QWMA 4S2EA 5C5EA 4JYZA 5KYTA 1HG0A 4PHHA 3N8GA 3OY7A 1N3LA 3AHDA 4G2NA 4XSHA 5SZKB 3E8MA 3T9DA 4ID9A 3U7QB 4IHAA 1TT5A 4BVBA 3ZJ5A 1D7OA 1U43A 4C03A 2NQTA 4IFBA 3HWSA 4ML3A 1AU9A 1Y1KE 1Q7CA 1YDFA 3AB8A 1GN3A 3BA8A 1MQ8B 2LXNA 3LM8A 2WSIA 3NHYA 2OD7A 4PU0A 1RRPA 3KQVA 2PO5A 4QYXA 5KA5A 1R4AA 4UAUA 3MWLA 3RRJA 3K9FC 4B87A 1ZNYA 3DZDA 3MD0A 4KFSA 2HOQA 1CUBA 3IUMA 3QKTA 4D1YA 4H0FA 1UI9A 4UM7A 5EI5A 1D2GA 5LB2A 1PV4A 3A9UA 3ASVA 5TF0A 3ZKWB 2LCAA 5F3RA 4AJNA 5JANA 1A9XA 4RTMA 2ZJOA 4IJWA 4EYSA 3LWVC 4DZRA 1YF3A 4HAVA 1LUWA 4O4JB 1DNPA 4LCEA 5A5DA 3ORQA 3BWXA 3H1LH 3OCZA 1FS0G 4JB3A 3BMQA 1IAQA 4MMZB 4F5WA 1M10A 2WINI 3WYEA 3U10A 2I67A 3QYFA 1Z13A 4JELA 3AG3B 2D7JA 4NNJA 1V5GA 2GSMB 5L3QA 1OYWA 1US8A 2HHJA 3AINA 1ZMRA 3TMKA 1RWKA 3DZCA 3CZAA 2X2OA 3RK0A 2QTSA 1YE8A 1G6HA 2WOOA 3DHYA 4LRYA 3IBSA 2Z95A 1I4LD 1RC0A 4G88A 5EWMA 4A5OA 5KYYA 2GD2A 3ICPA 1O94A 4CTJA 3VZBA 2Q7OE 2HXYA 2BFFA 4XD7D 4CDRA 3PD7A 2KTVA 4MVOA 2ZINA 4PA4A 2L42A 2ZCVA 4A5UB 1U2PA 4BNKA 3WP0A 4Z4CA 1QOQB 1KD1H 1OV4A 3SX4A 4TTPA 2PE5A 1K73H 3LY8A 4DJ5X 2UZ4A 2RH9B 4K03A 2IZ1A 1Q3HA 2AWOA 1O8CA 2J48A 2O0MA 2GTPA 3KLBA 4I0WB 4OFBA 4XD7A 3A70A 3I76A 3RSSA 3E6AA 4UEWA 4O1MA 4DARA 1Z4JA 3RRNA 5BY2A 1Z5PA 4MUKA 1Q2XA 4RVUA 2W6JA 1B3BA 2JCSA 3T95A 4TPKA 1MENA 3FSGA 4G67A 5CJJA 4EH1A 3AQIA 3UXMA 3ZLUA 2W6NA 4ZCSA 2JGIA 3DVSX 1GAJA 4KSYA 1LDBA 1H4SA 4PPNA 3OTHA 4V0NA 4H3HB 1KFEB 5KSZA 1ENYA 4DCPA 4O4IB 5JJJB 1JLSA 3AR6A 5C7IO 1QZUA 4G0WA 4M4SA 1XQ9A 2PVCA 1K8XB 4R1SA 4RWZA 4LMBA 5H9CA 5EZ6B 5FA8A 3OEEG 1FTGA 1X3SA 3MS2A 4TLEA 4DN6A 2QW1A 4DDTA 2BFBA 1D2MA 2MSNA 3FSJX 1XQXA 4OQ4A 5DBOA 3V1YA 3ZOPA 2GILA 4L07A 2WALA 1J0AA 1LPAB 2Q1TA 1GKYA 1H4VB 1QONA 3O4RA 2ZVYA 4AP9A 4DFDA 6NULA 2N1BA 3A2LA 2YV1A 3OJXA 2H57A 3P7MA 4FDAA 4PAWA 4OL0A 1ZCZA 4Q34A 4G4ZA 2XIQA 3O3OB 5A4AA 2OIEA 4R5HA 4TV8B 1AC5A 4BLQA 4IGAA 2R8XA 5HG0A 1T8RA 2XUFA 4OQFA 1WUTA 2JC3A 1GZVA 2VPTA 3BUSA 3EY4A 4RY2A 4W8HA 1D1QA 2D8AA 3QE0A 3ZVRA 1DKPA 1GPJA 3DSRA 3ZW9A 5CXUA 4YHHO 4I0XA 5ICCA 1RPZA 2PYJA 2PQ0A 3IJ5A 2LCFA 4QXMA 4DUGD 5I9NA 1TW2A 3TM5A 1W46A 1CUVA 3H75A 3QUQA 1F06A 4TMWA 4ZK7A 4LJ6A 5JJIA 5FFMA 1KI6B 5HK8A 1AKMA 4X84A 3JAMA 1TO1E 3IA7A 2GS9A 5LZ2A 2W90A 5EE5B 1HV8A 2KBFA 4FN5A 4QIHA 3U9SA 3S0YA 4RLHA 2ZT9B 1BW9B 3TLCA 4X65O 2JCBA 1I3CA 5FTWA 3AIOA 1CUJA 2XYVA 2YI9A 4Z9FA 4DA4A 2C98A 1DLJA 1FFDA 3ELDA 1GN6A 3WY9A 5KNBD 5T41A 4GLFA 3B82A 1ISHA 4RA9A 1QE0A 1E5XA 2VDKB 1VQ9V 2YX1A 3EDQA 5AJUA 2UU9B 1UJ6A 1T9DA 4QXRA 4OO3A 1KVUA 3FAKA 1QP8A 4NQZA 1KOJA 1TK9A 1FXKA 1YNSA 2H51A 2V6BA 3R4CA 5B2FA 4D26A 4R8MA 4RJTA 4PA3A 1WHSB 3SDLA 1XNQB 4LCKA 2WD8A 3BMCA 1B8OA 5ECGC 2X3FA 3AOGA 4BP8A 3L1JA 3QLVA 3K3WA 3UG7A 4CZZA 3AXSA 4HH1A 1A8IA 1RWNA 2HX0A 2KPOA 2QZ9A 3FOCA 3KQYA 3MJDA 4FYJA 1W55A 5REQA 4GP6A 4K9MA 2EDCA 3E89A 1C9DB 2DSNA 5DTMA 4LK3A 1TJ5A 2AXEA 2D5CA 4R31A 3K08A 4EF6A 3EQ7A 3O1HB 5CLGA 1A8UA 4QUAA 3TLAA 1ODJA 4R2KA 3G0CA 1XQ8A 3OWHA 3QVJA 2PJUA 1XTVA 3RNLA 3MJEA 3W5IA 5DNWA 4KO4S 5K7SA 2WQ7A 3O4HA 4MVWA 2WIDA 4D7TA 5IX8A 4XYMA 2DYSC 4KGXA 2J9XB 2GLTA 1SQQH 3L6BA 2F1MA 3OGIB 2O2XA 3CISA 3DEYX 3GAMA 1BXKA 5JYEA 1W35A 2CBZA 2FG6C 3TQTA 2UVPB 2NOAA 4MKGA 1D2EA 4GLJA 2KTUA 5HUJA 2AF3C 3DLPX 3ZDFA 4CI9A 2CTRA 1W19A 2HLDD 3D8NA 4JITA 4FOSA 1BGVA 3W7VA 1T5HX 1PYOA 2NSJA 5K0CA 4BNIA 4EB6A 1KQ3A 1T2AA 1RAHA 1EVIA 3PHIA 3D7RA 5LPNA 3FMPB 2IS2A 4TGLA 1NXWA 1MGOA 2G7MC 4UNNA 5H4HA 1ISJA 3ZS9A 3FPEA 5IFLA 2RG1A 2C3YA 3DOFA 5DE3A 1D9ZA 4TS4A 3LPLA 3E0QA 1UWKA 1U9ZA 3B7WA 5CA0F 4US2R 1XDWA 3HEMA 3WL3A 3PEVA 4HAOA 3ZZUA 2G63A 5AIBA 1NN5A 2YMMA 3AHCA 4YQZA 3S2SA 5CK4A 3PVZA 2R72A 4FYKA 1JMVA 2SICE 4WT7A 5CNJA 3VKWA 3GRKA 1WA5A 3S99A 2AYYA 2ODBA 5FPPA 3OTOO 1U3UA 2P0EA 5T4EA 8AT1A 2BFCA 2W83A 3KL4A 4NBUA 5HYVA 2H7YA 4KN6A 5DBIA 3LDCA 1L5RA 1QOPB 3T9CA 1YB2A 5AVUA 1SD2A 1W29A 1LS1A 2GVDC 1NT2B 2HUNA 1U96A 4L5CA 1KKDA 1WDMA 3RROA 5LU8A 1URFA 1E59A 4S0ZA 4YPOA 1AXEA 1KU9A 4H7IA 3CCJV 4FZRA 4K0KB 4BJ6A 1T4MA 1E60A 2NLOA 1K98A 2Z5VA 2QRJA 1RXEA 4G01B 5D8DA 4K9QA 3SHVA 4B35A 4OLBA 3AP1A 2E4UA 1Z4PX 5C1BA 3EVEA 3M6FA 3BERA 3NPMA 1AUXA 1M72A 1XD9A 3CXRA 3DMTC 3Q8XB 4GX2A 1MXFA 1YI2F 4PQEA 3X43A 3CSUA 4H35A 4MIKA 5IHXA 5LQSA 5IBQA 1Y4UA 2MR6A 4A6DA 2LDXA 3LYBA 2CJXA 2J9FB 4PBSA 4QOIA 3X2SA 1OLOA 2FQYA 2HW8A 4B45A 4R9RA 3T5MA 1QAHA 2X5JO 3EIUA 4IIVA 4KXRA 1N2HA 3UCEA 2X4GA 4BAGA 5HJ7A 4J10A 4BFYA 4WLVA 1QZXA 4XEHA 2MT9A 3DS8A 3O2JA 3MPUA 3C24A 4IEEA 3CCQV 5BORA 2EJ7A 5JQGA 4K9OA 1E98A 2I2WA 5HA5A 2HTEA 4WXMA 4JP8A 3WMRA 3VSDA 2BMDA 3ZTTA 3PQ2A 2AHZA 2XB4A 1GPMA 4FC6A 3WL4A 1BWPA 4D7AA 3TLXA 2GN1A 3SBXA 2GUZA 1B8UA 4N21A 1A96A 1MOSA 4OGQB 5D5PA 4F2HA 4DCCA 4GC9A 4LWOA 4U2CA 1UCFA 4YUWA 3LF1A 2OCYC 1WULS 1OJ7A 1W47A 2JFYA 2X8WA 4X93A 4B2IA 1SCUA 3QVXA 5C9ZA 2M32A 5HWSA 4LQ4A 5DEIA 3Q4HA 4GL2A 2OXEA 1MRSA 1QH8B 2QA4V 3GUCA 3H2JA 4MCAA 5IM5A 5ADVA 5KNDA 5CPFA 2GF2A 3HVKA 1V39A 3PFFA 4K9SA 3REOA 4I3HA 1W0JD 1BO6A 1G55A 2YXYA 3PC6A 3HCNA 1B0PA 2BEWB 4ERXA 3DBOB 4PZUA 2N05A 1BRMA 3HV2A 3JQBC 4CG0A 4NJEB 4PSDA 3GN1A 1CRPA 4F3YA 1VQ7V 4LOHA 2GGSA 1I4EB 3CN7A 5DLYA 5EJ9A 2Q8NA 4PE5B 5J9FA 3E70C 2VIIA 4YGXB 1Q92A 5GGYA 3GDGA 3BFKA 4U7HA 1YSCA 1WPGA 2VSOA 3F6MA 2Q8PA 1NRJB 2FW0A 1YDXA 2RIPA 3IHWA 2VPWA 1KZGB 1XZLA 4QBFA 3DAYA 2FZ4A 1FFTB 2IUUA 2O8DA 2IZ0A 2HFJA 3BKXA 5JRZA 3OJCA 3C8ZA 4MJLA 4MQEB 1THTA 3D3QA 4FLXA 5A2QA 1J09A 1TM2A 3C90A 1L2TA 1ZHHA 4DLZA 3LDTA 3HADA 3PUHA 5GADl 2JLUA 1PLLA 2RARA 4MUNA 3UEOA 4H1VA 2P30A 1ZX3A 5IRCD 2XHZA 2FF5A 1HZJA 1PBTA 2JKYA 1YS6A 1XZIA 2JKZA 5J2UB 3QLTA 4BL5A 3MOSA 1YZKA 1SK8A 2YWHA 1RPNA 2HXSA 3HJUA 1ECBA 2C2ZA 3PYLA 2B4KA 3BD8A 1DWQA 3EJWA 5LNK6 2PBLA 1GGHA 4JGIA 1M2KA 2EATA 2AW3A 3QO8A 3TAHA 3HVJA 3NIFB 4X1OA 3VX3A 1NJ8A 1TAHA 1YZ3A 3K3PA 4FFDA 1XG5A 1L5LA 3RARA 3TLJA 2ZJYA 1OXUA 2P2NA 1SZDA 4JIGA 1JQJC 4M1YA 1QCYA 3PNKA 1PQUA 1T6YA 1Q6IA 3A10A 1OCZC 5BR1A 2Y0DA 2P6OA 4FBGA 1CQPA 2PL9A 2PLAA 3DBHA 3HU3A 5K0FA 1CV2A 1GY8A 4M6WB 5F1PA 2QBYA 5IUKC 4NV0A 3QO7A 1M3SA 2IYYA 2H17A 4R2MA 4TT3A 4JXZA 2C4NA 3OUTA 3L0PA 5E7MA 3J81N 1QB8A 5HP7A 4LC9A 1BJTA 2VDVE 3KB6A 4PSKA 4JAAA 4C0JA 1CEXA 3KSDO 3PJRA 5EKXA 5BQOA 2VTVA 3EXHB 1BJRE 4NICA 4RELA 3RTBA 4B4KA 5K99A 3N2LA 1Y8CA 3IKTA 1OZHA 4LV6A 4L4UA 2CV0A 4IXNA 5AVWA 2AF4C 3E9CA 2YCLA 1BVHA 1NIJA 2R96A 4RWEA 1L5NA 2D3TA 1CRWG 1KC8W 4HZUA 3A4LA 1M2EA 2KSDA 4J9YB 4V1CA 1EQ2A 2Q2WA 2R6JA 1JALA 4MWGA 1T5LA 2PGIA 2XBUA 3C43A 2NU8B 5CFPA 1FNKA 1SNYA 1G8FA 2CUZA 4YR9A 2OGSA 1DWUA 5CFMA 2XXAA 3V33A 4OUDB 2YZNA 3K5MA 1C7RA 1MN6A 2ZR7A 4KIFA 3CJHA 4Q82A 1Z2DA 1J0EA 3I9NA 1SUCA 3NG1A 1RC1A 4NUTA 4UQOA 3TL6A 1NJ5A 2NUAA 1GPKA 3IULA 4WOKA 1DX4A 3UY4A 4BZPA 4FFBB 2ZWIA 4EFDA 1OJHA 1QLEC 4JI4B 2W9XA 3GXBA 1FS6A 3OM8A 3MTEA 2AI2A 3K8YA 3N2ZB 4HLUA 4HX9A 4XQ9A 1K6XA 4YCDA 2RQ6A 2C00A 4CIYA 2DB3A 3LGAA 3IURA 2YV5A 4TWJA 4EHHA 1PJRA 4O3MA 3FCOA 4N65A 1BVUA 3CW9A 3H9CA 3H1KH 1RM3A 3ITNA 4HPJB 4QT4A 5KUTA 5M7EA 4GMHA 4Y30A 4DEYA 2QRQA 2Y6UA 4BPBA 4YJFA 4R6ZA 4DR2B 3P19A 1RZUA 4INAA 4PZEA 3DEKA 2AGAA 2HCFA 4ZANA 5AXCA 4A8JA 3GBVA 5FPHA 3ER6A 3CTMA 2WZCA 1XHOA 1WEKA 4F8EA 2FR8A 5HS4A 3ZHTA 4ENVA 1UXOA 4EGAA 3PNMA 1LCIA 1P31A 4B2YA 5EAZA 3IUJA 3GFPA 2C95A 3ME5A 2LIPA 2YDXA 5FDFA 5HGJA 3K05A 2CDBA 2HRBA 3CCEF 4YR7A 3GA0A 1U6IA 1TCVA 3BAZA 1PZGA 2HZ7A 3BA1A 4FJ1A 3WFJA 4P31A 2QTRA 1C7JA 2P1RA 3SM3A 3GRRA 2F17A 2HRZA 2XODA 3MMNA 3X1WA 4C0BA 5IULC 1PD1A 3CPJB 5KHGA 4A03A 3LA6A 3LDDA 1OCRB 5EESA 2PRZA 4DUZO 3BE6A 1WZEA 3EXEB 3M7IA 3SQDA 1RRMA 4LJ4A 4CU5A 5KHLB 4RPLA 4RTRA 3FUVA 4ZVLA 3I62A 1Y74A 4MQMA 4YWHA 3ZVNA 3Q8KA 3EEBA 3SDBA 3IC5A 4NK4A 1FRNA 3HR0A 2Q6LA 4Y1EA 1V9PA 2R1ZA 1V1RA 2HV8A 3OD5A 5AKHA 5TQJA 5DV9A 3BD9A 3DP7A 1T8WA 4FW9A 4Z0PA 2YS7A 2XB8A 4BFTA 1PR3A 2FCRA 4RDCA 5T64A 1YZTA 2QA4F 2F3PA 4WA7A 5IPFA 3UPTA 1IULA 4KV9A 4LMAA 2XITA 3NHKA 1ZITA 5E1BA 5EHQA 3W7BA 5BQXA 1SXGA 4O08A 3UOGA 4ZT6A 3KKZA 3HCAA 4DMFA 5IZ4A 5AM0A 1XCPA 1YCDA 3NC1C 2X58A 2OXCA 5EE1A 2O8FA 3VMFB 4P3PA 3C48A 2C2GA 2VSQA 4ZALA 3LWOC 4YASA 3NC4A 3LCUA 2GZ2A 3VTKA 2QQ5A 2YFHA 2AQHA 3T3DA 1BYUA 1TCUA 1ULZA 3LC7O 2GD6A 2MSKA 4N0EA 4OMCA 4BKUA 5LA6A 2EJVA 2YHUA 1OPRA 2V6IA 2F3UA 3IT1A 1O9HA 1H48A 3NNDA 4RPGA 1WAMA 5ICSA 2DEUA 2E85A 1TA9A 2WKQA 4WY2A 2IYVA 2Y0CA 5DCVA 2P4VA 3C1TA 3SBDA 5BUZA 1ZWKA 1M67A 1R0CA 1RJWA 4GM1A 1RPAA 1WD5A 1O58A 2BFDB 3HPLC 5TX7A 4UVCA 2RDCA 2DAPA 2F59A 1ZM3A 1E8MA 3H1PA 2XE4A 2GASA 3E8HA 2VDLB 3U4DA 4UV9A 5EZYB 4RULA 4DM3A 4Y98A 1V4BA 3IAEA 1IBLO 1NVVQ 2YN2A 4DLKA 2BN4A 4YMHA 1E79D 4TZZA 3C1UA 2WBLC 3FCSB 5JO9A 4JLNA 3RLFA 3T3OA 4K8ZA 4ENSA 2GM3A 2PGOA 4G0QA 4PLCA 5SZJA 5GGXA 1IPAA 2EV9A