5KX5B

Crystal structure of tubulin-stathmin-ttl-compound 11 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
430
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Design, Synthesis, and Cytotoxic Evaluation of Novel Tubulysin Analogues as ADC Payloads.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 167
structure length 427
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kx5B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kx5B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kx5B01
4YJ3A 4LNUB 3VO9A 3HKCA 5EIBC 4ZI7A 3RYCA 3RYIA 3M8KA 1TVKB 3WGMA 5MN4A 1TVKA 5CA1B 5CA1A 3VOAA 5KX5B 4EB6B 5KX5A 4I4TA 4F6RB 4X20B 4TV9B 1TUBB 3E22A 4TV9A 1TUBA 4I50B 5J2TA 1FSZA 2RHJA 1FFXA 4ZHQB 5LOVB 1Z5VA 2BTQA 4ZHQA 5JH7B 5CB4B 2Q1XA 3JALB 5LXTB 5IJ0A 3WGNA 3UT5B 5LA6A 5LYJB 3UT5A 4EI9A 4IIJA 3N2KB 4FFBB 3RYFA 5ITZA 5C8YB 3WGJA 4TUYA 2RHOA 3HKCB 4DRXB 4O4JA 4ZI7B 3RYCB 4DRXA 1OFUA 3RYIB 3RB8A 4B45A 4EI7A 4B46A 4O4HA 2RHLA 5GONB 5CA0A 1RQ7A 4EI8A 5GONA 4U39A 4WBNB 4WBNA 2BTOA 5LP6C 4I4TB 3M89A 1W5AA 4X1KB 5M7EA 4HNAB 4X1KA 3E22B 4O4LB 5BMVA 4HNAA 5J2TB 4O4LA 4KWEA 5IJ9A 1FFXB 5IYZA 3WGKA 2BTQB 5MN5A 1RQ2A 5IJ0B 4O2AA 3VOBA 5LA6B 3V3TA 4I55B 4IIJB 3N2GA 4I55A 5JCOA 3RYFB 5ITZB 1W581 3R4VA 4TUYB 4O4IB 2VXYA 2Q1YA 4O4IA 2VAMA 5JVDA 4U3JB 1W5BA 5KMGB 4U3JA 5KMGA 1SA0A 4O4JB 3RYHA 5EYPA 2R6R1 4O4HB 4ZOLB 5CA0B 4ZOLA 2XKBA 4X1YB 3HKEA 4X1YA 4YJ2A 4XCQA 4TV8A 5JQGB 5EIBD 5JQGA 3C8LA 5BMVB 1W5EA 5IJ9B 5IYZB 1W59A 4DXDA 5MN6A 3JAWA 3VPAA 5FNVA 4O2AB 3JAKA 3HKDA 5J2UA 3JATB 4IHJA 3JATA 3N2GB 2VAWA 5LP6A 4LNUA 4M8IA 3ZIDA 3CB2A 5JVDB 1Z5WA 2R751 1SA0B 3RYHB 5EYPB 5JCOC 3ZBPA 3HKEB 4EB6A 4YJ2B 4E6EA 4F6RA 3HKBB 3JASB 4TV8B 4X20A 3HKBA 3JASA 4I50A 2GVIA 2XKAA 5LOVA 5JH7A 5CB4A 3ZBQA 2RHHA 3JALA 5EZYB 5LXTA 4O2BB 5EZYA 4O2BA 3JAWB 5LYJA 1RLUA 5FNVB 1W5FA 3JAKB 3HKDB 4X1IB 5J2UB 4X1IA 3N2KA 4IHJB 4FFBA 3VO8A 5C8YA 3JARB 2VAPA 3WGLA 1JFFB 3JARA 4YJ3B 1JFFA 5LP6B
chains in the Genus database with same CATH superfamily
2VHZA 2HBZA 1JL3A 3CCLV 3GA5A 5J5CA 3QG5A 1EWYA 2Q1WA 3HHPA 4FP9A 4P92A 4YRTA 2XI4A 3U4QA 2DSTA 4LXIA 1Y4SA 2PKQO 2Q27A 3ZD9A 3GAAA 3RB8A 5E1OA 4I9NA 3TB4A 3GP8A 4LXTA 1JR3D 1Q1NA 2XVYA 3EQ2A 5CLLA 4AJ2A 1Q15A 1RM1C 1G2IA 4RDHA 3T94A 3PKZA 4W1SA 5D5HA 3K57A 3ED1A 3FOZA 4CEIB 1GN2A 4YC7A 1V0JA 4D0NA 4MWGA 4HGRA 4I1YA 1P31A 1R5BA 5AM2A 1H2RS 4NJEB 5JZMA 4X89A 4F72A 4UTXA 4OK3A 4EHFA 2CCKA 2C8VA 2FMHA 3P9YA 3KE8A 3WTBA 2P6OA 1QIKA 3AUTA 4EB6A 2JD2A 2FWAA 2ACVA 4IIBA 1KYZA 1TQHA 3TQCA 1X7ZA 4NCNA 3DONA 2OUIA 3ZUGA 2JHCA 2NW6A 2NVUA 4KN9S 3VSCA 1RYNA 2XNSA 5K99A 2DJVA 3CEMA 2VNKA 4IJUA 1V8DA 2I29A 2XRFA 2A1IA 3U7QA 3ZDDA 4JIGA 5DBEX 3VM6A 3QWBA 3FUVA 4CV3A 3WS7A 3PCXA 1HOXA 1KIFA 4CFZA 4WXHA 4JDUA 3CV3A 2CD7A 4EFDA 3MBOA 2N9UA 2GZLA 2O3UA 4IIJB 2QZSA 3A9CA 3OBWA 3RD5A 1LF0A 1FZTA 4X7BA 1FSPA 1JKJB 3DNFA 1TUIA 4PZZA 1MEJA 1U04A 2JZNA 4BFYA 5HKLA 4P0TA 2DWPA 3UJHA 3ESRA 4Q3NA 3TLGB 4D92A 4EEZA 1PFKA 2VRNA 4PCVA 5KQGA 4XYLA 1J7HA 2PD3A 4E2XA 2HZ7A 4OX9Y 3H9JA 3PD7A 4RV4A 4NR0A 3S70A 4XD7D 4MPPA 3N86A 4ACBA 1G66A 4KRXA 4UNPA 5KNBA 1XFDA 1O96A 3OX2A 4Y18A 3BK7A 1AKRA 3B8NA 5KPJA 4R1OA 4TMVA 4ZC8A 4YRAA 9GPBA 4RIGA 1VBFA 2O4CA 2IJHA 4P93A 1OCCC 3BFXA 1PR9A 4DV4O 4ECEA 4MZXA 1PEYA 4ZARA 4MSUA 4CQMD 2CGOA 3LCRA 1NOJA 1U96A 1GTJ1 3R74A 3E03A 4XIYA 3KTDA 3GO4A 3BDVA 1JU4A 1M8KA 2H5IA 1VQNF 2ZYIA 1F60A 5B4TA 4QXAA 4YHBA 2PGNA 3RSQA 1P60A 6LDHA 4F86A 4P7KA 1ZK4A 4GM0A 5K3BA 3I72A 2M6YA 3QSYA 3ENWA 4OGLA 5H68A 4QODA 5IC6A 4AYTA 2WJ4A 1DBQA 3B8EA 3AK4A 3FRJA 3O4IA 4LK3A 1I1HA 1NI4A 1KEEA 2A57A 2HEPA 2ZSIA 1ZUHA 1ZHHA 2NU9B 5LMNO 3MWDA 3U7HB 3AZQA 4RTJA 1JHYA 5AKXA 1N4CA 4Y6GB 1KBQA 5DI3A 3M1IA 4IY1A 2QR5A 3IKVA 4C3ZA 3ZEAA 1IUNA 1RXCA 1PWYE 4ZO8A 2CXSA 3Q3GE 1Y9EA 3C1UA 4KP7A 4GX0A 4C9BA 4H3SA 5AOCA 1E8NA 2ZYRA 4MVJF 2IXGA 3MJHA 2B94A 1LPAB 1FVXA 4CG0A 2OMEA 4RD3A 1IH8A 3VO1A 2J33A 1IEXA 1NAHA 1Q5OA 1OREA 2BVNA 3IVXA 4RVHA 4KBFA 1XD8A 3UFBA 1CF9A 4UCRA 1BXZA 3AF4A 1E2NA 5CW1A 2PX3A 5HX7A 2NLJC 4HDCA 5JVDB 4MUIA 1NMSA 1IBLB 1YS6A 2H5EA 1UBMS 2JL1A 3ML0A 4MLPA 1NMUB 4KFRA 1EFDN 3ZRWA 2GBLA 5FOTA 2BHTA 3M99B 1V48A 1MFZA 1Q12A 3A9UA 2FZ5A 1YCFA 4LF6O 2WKSA 1ESMA 4QDTA 1JE1A 5BV8A 3AM3A 1NN1A 1MVOA 2EG9A 5BYJA 2IGTA 3IAAA 4DSNA 1YC2A 1O8BA 2IW3A 1AS2A 2H8KA 2XZDA 4MULA 3CUTA 2H4HA 1A9TA 4ZVSA 2O5EA 3KUUA 2XAFA 2YZ7A 5JAHA 2C59A 3ITKA 2IXFA 1XZ8A 1ZN2A 3M6WA 3I28A 3B6EA 4G2TA 2YTZA 5E1BA 5KVSA 1BW9A 1XHLA 1ZTEA 4NENB 4YONB 4JI0O 2BFCB 1DWOA 1KOLA 2JFYA 2X6AA 5EIHA 2JIDA 3EN0A 2VDLB 3ROZA 1CUUA 2Q07A 5BP7A 4IDBA 4BTEA 3ZCQA 3KDPA 1L3BA 1O6ZA 3N05A 2JFOA 3FBTA 1QQ7A 2P4SA 1YXMA 1O89A 2XCLA 5L3QA 1T5BA 1CUDA 2J6HA 4KVGA 3KAQA 5COQA 2QRQA 2YQ5A 2Z6UA 2WSSA 3TNDA 1R9NA 1P5ZB 1SD1A 3KUXA 1WXXA 1VCMA 2GCPA 4Y1EA 5H5NA 4OL9A 5ALPA 4ZCQA 4G4IA 4QUAA 3NX4A 5JNLA 4QQFA 5I3ZA 3DFUA 5CM2Z 1IXZA 1EFRA 5HFJA 2RK4A 4HWRA 4CT0A 2WIFA 3EMVA 4A10A 1D1TA 4BBZA 4E70A 4JK3A 5IKXA 2YDYA 3QVLA 3E8FA 4J41A 5THQA 3GVCA 1QX3A 4D46A 2ZAIA 3B9RA 3NORA 4G56A 1JQ0A 4O2AF 3V8VA 2N47A 3AGKA 1TNDA 3TVYA 4OLBA 2CLFB 1ZLYA 3EGEA 4RH3A 1QTIA 4GYKA 4D7AA 2ZJ1A 2HHCA 2YFYA 3V9PA 3N2KA 1V7PC 2PZFA 4AG5A 1VBKA 1D2MA 3K03A 4X88A 1ZC3A 1KC8H 1YVRA 1T0JB 3S2SA 4F4CA 1YQWA 4JGSA 4YBZA 5BVHB 3SHWA 4DA4A 1JLRA 1W52X 3WLQA 4HYTA 4UB6Z 4Q15A 4CKEB 4CMKA 1ZM2A 2XNJA 2J3DA 2RCYA 1E7QA 2VPPA 3S2UA 1MO2A 1TE2A 5C2JB 3AYXB 4HNAA 1S89A 4AG3A 1XCPA 3TDNA 3EZLA 1JJOA 1UFYA 2CE7A 3LNMB 1F51E 4YJFB 2WUDA 2ZU0C 4KKXB 4PAOA 1SQ0A 1XVTA 2VHXA 3HLTA 2WSSG 4AS2A 2JARA 4PCLA 4B3IA 1XALA 3JQAD 2EOAA 3KZMA 8ADHA 3F6MA 2VJCA 2WMNB 2WIKA 1OYOA 1JLKA 1V2GA 1RZ3A 4W9RA 4D9IA 2QTAA 1EFRG 1R6XA 2PR7A 1PSZA 1YSCA 2CL6X 3QNWA 4UULA 3FYHA 3QY9A 1EVJA 3PDUA 3HMQA 1AUXA 2FFAA 4ZCTA 5JAOA 3BHPA 4HXEB 1GTMA 4NYKA 2NSHA 1UMBA 5DLQC 2BGGA 2WLSA 5EJ8A 1ML4A 3N07A 3BB4A 2MYTA 1JG2A 2ZXUA 2N05A 2GCNA 1JX9A 5GJVC 1J0AA 5ICMA 2E85A 5T6BA 3OY2A 2X4LA 4MKRA 1Q1ZA 4D45A 3EGCA 5AH0A 4EG7A 1OU4A 2DT5A 3BWMA 3FF4A 3HCPA 1F5NA 3ETLA 4I9GA 4E08A 3UPDA 4CKWB 2LDXA 2I67A 4FKBA 2X76A 4B3GA 3DJFA 1JIXA 4HQ0A 3ROEA 2ZT5A 1G8YA 1A2QA 4QBFA 3L71H 2O0JA 3RANA 4LF9B 2PZAA 3TOZA 1XNQO 3CPWU 4NONA 2AEJA 3MCVA 5KYGA 1ENOA 3VHXB 1XMOO 2NPIA 1XRGA 4WOKA 3M4YA 2QJTA 3P2JA 1UP4A 3CUVA 5HZMA 3NETA 4O02B 1NC3A 2CL0X 4G0PA 3VYVA 3ABQB 2RHOA 1H23A 4HMPA 1U8AA 3RVSA 3IKMB 1I1OA 3EX7C 2GPSA 2EZ4A 4PO8A 1K4MA 4RHAA 3UBTA 1DRUA 4II3A 1OVMA 3EEFA 2ZR7A 2ZYGA 1ZGJA 3HACA 2B7BA 2J32A 3AQIA 4Z86A 1UZLA 5B7PA 2AW5A 2IX3A 3P0RA 3QLTA 4TXNA 2Q4TA 3LQKA 4W1QA 2JBWA 2CJYA 3KOMA 1KD1W 1MH9A 4XDYA 1NUPA 1LV7A 1TFRA 3GTZA 1COZA 3G8CA 1ODEA 3HXOA 3NR2A 3QNUA 2W4MA 5L3SB 3HA2A 3LY7A 3OIGA 4YUYA 1HE1C 4QOHA 1XIVA 2DOKA 4H6PA 1D6JA 2LGWA 3QOWA 2BGJA 1Z7EA 4RS4A 1I5XA 3Q7RA 5CB6A 3EF1A 3G9TA 1PFYA 1YL7A 3T4PA 1OYWA 4I7ZB 2P9FA 1RLIA 3IQIX 3U3ZA 3L0BA 3USZA 1RCTE 4L6CA 4E0BA 5BRJA 2DZDA 1URFA 4CR6A 3VFDA 4D2IA 5F9FA 3S06A 5GY7A 3VTZA 1KZ6A 4WCEV 2E5LB 2HJHA 3GJYA 2VSNA 4O4LF 3FD5A 1E1DA 1K7FB 3SR4A 1HZJA 5A6VA 3GUYA 3SSAA 2TRSB 3UAOA 5TISZ 5CBPB 5BOSB 2YW9A 4AKHA 3MLBA 4RJKA 3G9XA 1N4DA 1EJ0A 2PJDA 4QLAA 3FGOA 2VXCA 3RKSA 2I1WA 3T52A 4LZWA 3S0YA 3U3MA 2VPZA 3AHHA 3ZE8A 1GPMA 4MTXA 3DMYA 1ZPDA 5EJGA 2ZBDA 1U2RA 2VYND 4JKYA 4BN5A 1QB8A 1KVSA 4ASUA 2XQKA 1Y5RA 4DLXA 2JKVA 3WRXC 4U7FA 2FN4A 4K9LA 1CP3A 4YDQA 1SAYA 2RQ6A 1ANKA 4P5EA 5DBOA 3I39X 1D5WA 1O95A 5LOVF 5CDGA 4MWEA 2DB3A 3PYLA 1ZI9A 4DUZO 4D4GA 4HLQB 5B7GA 4OHBA 1LV8A 1TADA 2JANA 3QKWA 2H2HA 5EIWA 4D97A 4ETMA 2DH6A 3T1YO 1HZZC 3JD1A 1L4NA 4B9AA 2O0LA 1AI6A 4F11A 1DXOA 3E89A 1XVAA 2IIBA 1JZTA 1CY0A 5FOXA 4NJMA 1WN7A 4P84A 3CLKA 1U97A 1P3DA 3WK9A 3TIFA 3BS4A 4NZYA 4TWKA 2YVAA 3TQIA 3TQQA 1Z7GA 2CV2A 4QOIA 1DV2A 1L4GA 2CFCA 3QYAA 4E5PA 4ZCRA 1HQYE 4JOCA 5B66Z 3ZZ0A 2VDPB 4A0GA 5LXTA 1DS6A 1ORIA 3NEYA 1EDZA 4DZTA 3PC8A 2XCQA 4EMUA 1XLVA 2W2XA 4U5QA 4PDVA 4HLCA 5T4FA 1R6BX 2R6HA 2LTAA 2PWPA 3P0IA 3D36A 1XKXA 4ZHQF 1GPKA 1R4ZA 5SYAA 4RF4A 4X71A 5L9AA 1T0KB 2ILVA 2OV2A 4JI8B 3BERA 3H5RA 1J2UA 2JFHA 3UKMA 3BCHA 1FFSA 3C6YA 3HXKA 1AQUA 1T10A 5C7IO 4M0KA 3CBQA 4ASUG 5FIUA 4ZXFA 1EMDA 3NC0C 1AZSC 3OLWA 2WW8A 3R41A 4AULA 3M2PA 4R2XA 4ZALA 4X7RA 4V3BA 1VSVA 3VOUA 4RY2A 4UCFA 2JIBA 4ZOAA 3UVEA 1SCAA 4NOKA 5FL3A 1JHUA 2F1MA 1H42A 2BF7A 4TKLA 3M0EA 1YT5A 4CF4A 5A5GA 3WMRA 2GFQA 5H80A 3KOYA 4FZ3A 2HWUA 1CQPA 4UHCA 4TTSA 4ZJYA 3AG6A 1W9HA 3VZBA 2QRGA 3BMCA 2F1RA 5CVJA 3OPXA 4US0R 2WQ7A 2C7QA 4V1CB 1BXKA 2ADFA 1MABB 2OV6A 4XDHA 4UBJA 1A9SA 4DLPA 1RI3A 1APBA 3QXXA 4TLDA 2GZHA 3FBAA 4IMPA 3P52A 1YR2A 2FPKA 4P3XA 4EQZA 4CT5A 4C4TA 2AXQA 1D0VA 4IDOA 3RSCA 2BFWA 2RH5A 5A3JA 3W1VA 1V6AA 4Q00A 4GEKA 5JCPA 3BCSA 3DM5A 3K9CA 2WLLB 4CMBA 2HUNA 2IIVA 3D5TA 5CDFA 3SKVA 4F71A 2XXJA 4QYIB 5GAJA 1U3DA 2YIBA 1PL4A 1WKVA 2WAYA 3V7WA 4Y3UA 4UTPA 2ZYHA 2FSSA 4JOSA 2EL7A 3A6ZA 5BQFA 4H18A 1RWXA 1N3IA 3LWZA 2ZB3A 1JT2A 1Q8RA 1CY4A 4H1UA 3EBPA 3R0QA 5HHTA 1KPIA 4DPKA 1T2NA 2CVPA 4A73A 2B36A 2VCHA 1HT0A 4LSZA 4IDGA 1NVXQ 2R7AA 3M6AA 1RJ9B 3BMOB 2QAGC 2QMQA 1E2IA 1T5SA 5AVVA 3ASYA 3P32A 1A4IA 2HXGA 4BMZA 1JTFA 4D4JA 1YULA 3P97A 2P4EA 3RUCA 4FIPC 4I5FA 2P9EA 2XWBF 5E6RB 5ECWA 5KYYB 4Z8XA 1RIIA 4IX9A 1VI5A 2XA9A 5FPSA 4ALIA 5DRTA 2Q2NA 1I2BA 5AO9A 2G9RA 3ESBA 4XCXA 4XOUA 3OJXA 3RW9A 2YJ4A 3PHJA 2E18A 2Q7XA 1DV1A 3UKDA 1SC1A 1YJWF 4HVLA 4I3FA 4D9EA 1ZSNA 4FGSA 3ZW9A 3HYTA 3SDLA 4RPGA 1ULUA 4D9JA 3S7ZA 2D1QA 3ODGA 1NURA 1V3QE 1EZ4A 3PXDA 1MPXA 1N25A 3MJDA 5GM2A 3OQPA 3GB7C 1MC1A 4LF7O 5L7TA 1UBRS 9ATCA 3L7CA 1G5PA 4BQOA 5IANA 2Q0OC 4KU4A 3RVRA 1IN1A 2B5VA 1M90H 3A9VA 3S8MA 2IPMA 2MR5A 1SH7A 3OQMA 3LKBA 1JP7A 7MDHA 2R72A 4HXYA 5T5QA 4L22A 2EW2A 4TQGA 4DJAA 4C4RA 5IJXA 3AJEA 2C42A 4E22A 2QSUA 3WL8A 1UMCA 3LQ2A 1L7OA 6AT1A 4MDFA 1M1YE 5K6AA 1IQUA 4J07A 1M3SA 5LB4A 3ICCA 1E6WA 4FJCC 4KPFC 1MFPA 1P4AA 3AM4A 4NZOA 3FHTA 2DKFA 5HGXA 2KW5A 2WTMA 3EYAA 1XZNA 1KDPA 1ZL8A 3IDOA 4BRUA 4M9QA 3PT9A 4ZVTA 4A7PA 5BSHA 2VAPA 1XZAA 5G4KA 1QHSA 4JUCA 1NY6A 2Z3VA 3WGIA 4TV9B 3W2TA 1ZSYA 1TT5B 1YQ9A 5KX5F 3VGPA 3OT4A 1ZOOA 3CSDA 3W1EA 3SIUA 3AFNA 2E4ZA 4CI0B 4PYIA 4KFSA 1D9ZA 2QL7A 2IZ7A 3HB9A 3E18A 4PPFA 2XY4A 2HZBA 4PZCA 1FJHA 3HNOA 2ZFUA 4W5TA 3CLSD 5A9GA 3ZGYA 2EHJA 2Q3CA 3OO0A 4B09A 5EVJA 4UNRA 2RC5A 4QUBA 1ECJA 5KHGA 4R7GA 2Z2ZA 4Y2TA 2UXDB 4C0WA 1B6GA 4RLSA 4HWPA 1ABBA 4Z0PA 3CUSA 4I50A 3EJWA 4MKZA 1R3IC 4CCSA 2X8JA 3IP5A 1S4MA 2ZR3A 3OX4A 3FRIA 1UDCA 4JNCA 3V00A 2FLVA 3E1YA 2I9PA 1A98A 3RC7A 2XUIA 1G5TA 4N23A 1ZS9A 2LE0A 3I45A 1GZDA 1RP1A 3NS7A 3P5BA 5KJ1A 3CB4A 4QRIA 3UJBA 3GWKC 4RF2A 2IH2A 2H1CA 5DNWA 5H7XA 4F9GA 1MHPA 1W0JA 4TSFD 4ZEMA 3VTIC 4MVJA 4P33A 1HL7A 3I56F 2XLCA 3ZJ5A 3K2XA 3IFSA 1I80A 3AV0B 2H2WA 3PNYA 1KAHA 3OTGA 4N82A 3DGEC 5GZ1A 1LNQA 2X1VA 4TV8A 2IBMA 1CEXA 1ECPA 3KYIB 1FDRA 2G04A 1D04A 4GU5A 4I08A 4D56A 4AY2A 1BGVA 3EDMA 3H16A 1GNPA 2GD6A 3WLKX 4S0ZA 3TGLA 3G1TA 4MPJA 3OZGA 4FDVA 9ABPA 3KR0A 1Y3AA 1MHTA 5IP5A 1ZZEA 4M1QA 2VJNA 1PDOA 1GQRA 4QD3A 1E3WA 4IGIA 4WF9V 2GTHA 1U9JA 1V5WA 1NXPA 3PL1A 1L9KA 2FN3A 2R68A 4RXMA 4IV0A 1AQ6A 5BR8O 5ALXA 4EB6B 3OTOO 4DMHA 2CHQA 5F2OA 1X7ZB 3DEZA 2XUDA 2VQFO 1ABFA 1JHAA 2NTNA 3HDYA 4LJAA 3RVJA 1UDWA 2FPMA 4KYVA 1ZVJA 1BWSA 1GNQA 3K0HA 1DAFA 2H2DA 3FVTA 1WU7A 1JPUA 4NPCA 4Q7QA 3SJCA 1G8FA 1LBQA 3SYQA 4TM7A 3UMRA 3HEMA 2GZDA 2XQGA 5LNK1 1OLUA 2QZZA 1RCUA 1WUTA 2IYFA 2LKCA 1AY0A 2EBHX 3MCQA 2VQSA 2NZUG 3DXFA 4Z4CA 1H0KA 4MR9A 2QWQB 4ZJUA 3C3AA 3CBGA 5F51A 4RC9A 3BA1A 2X7RB 2VDJA 1KVQA 1W0JG 3AY3A 4H33A 5EG5A 1D6SA 5F9HA 4MVJG 3FW1A 4BMPB 5G4VC 3RRBA 4DLBA 4YJ3B 5F4ZA 4D41A 1V47A 1TZKA 4XIIA 3NDIA 2D74A 1QFJA 2HVJC 5KVAA 5H16A 1O96B 4HFRA 3EH2A 3GZTB 2IWHA 3QXHA 5LQDA 4NL4H 1M1NA 1Q6YA 2HWKA 3QF4A 4TTRA 2WIAA 4ZQCB 4KLRA 3LPLA 5CIQA 2FB9A 2HYDA 4UPVA 1WKCA 3DDOA 5T8KC 1FP7A 4KACA 1TDJA 4H7HA 2EF1A 5K8IA 3D4OA 5GW7A 5IRCD 4BECA 2PX8A 4BO0A 4BVFA 1RRMA 5EZSA 3CCQF 1YOVA 4KKVA 1Y81A 4QWWA 2R6FA 2E4XA 5H2FZ 4UM9B 1TEXA 4UXHA 3T34A 4Q1FA 3HUTA 4AIRA 1Z07A 3L0CA 1PLLA 1LFDB 1L7RA 3ASNC 1XBIA 2VI5A 2QA4V 3EGXA 4CL3A 4BO1A 4EPRA 5IVIA 1KQPA 1W2BU 4W8GA 1MORA 5AI6A 2I4NA 3NOOA 1L6RA 1QE3A 1NI4B 1KEEB 4BEBA 5L3RA 5FORA 4DDMA 3G0GA 3KXPA 1J07A 4TUYA 1I3NA 3H5OA 3SZMA 2F43A 3MWDB 4K1LA 3KE9A 1JEDA 3MCZA 1QAHA 3GUUA 3RV4A 5MHTA 1B15A 5DI3B 2JNWA 1Q3HA 2MIIA 3V55A 1YDGA 1ZD2P 2OPHA 1G1AA 1NJIW 4A26A 1BE3H 2IW5A 3SBEA 4M37A 1V1MB 4RFVA 1Z0IA 2IXDA 5HOEA 5B1OA 1PVOA 1X14A 4K81B 4AI6A 4F1WA 3RN4A 4R7ZA 3F0GA 3IERA 5C35A 1VHJA 4R1UA 4HVAA 2FFRA 1VGRA 3QMWA 1WBJB 2YCBA 1NT4A 3ACCA 1EA5A 1NNI1 2WSBA 5ETJA 2BN4A 3F5SA 2LV8A 1OKKA 1Y1RA 1A2KC 4OFWA 4MS4A 3IOYA 4DR1O 3LMKA 3W5DA 3WXMA 1UAGA 1ZGGA 1Q17A 4P08A 3IDSA 3IVMA 1SUBA 3LE8A 4YCMA 1ZMOA 1GPH1 3KDSE 4Z4FA 4U0KA 2WB4A 4I46A 4O59O 1TO2E 3QPWA 1AR4A 1H9AA 1LW6E 5DCYA 4UM8B 1L8XA 5AW8A 4ZCPA 4H0NA 2RGUA 4XYGA 1Z5UA 3T0FA 1ENVA 3CKMA 2C83A 4QDKA 3FCAA 1TZMA 4GP9A 5K01A 5C9ZA 5DFAA 4CL8A 1P33A 4V2UA 3WIUA 4WCFC 3PHHA 1YZ3A 1IXBA 1Z17A 1SIOA 3RT7A 1VHQA 2C5SA 1JHMA 4YUXA 2PT5A 1UMDA 3QTYA 3KYBA 1YI1A 1T1SA 3NBZC 2F43G 4Q4HA 3HJRA 5DM2A 2W6IA 1UBUS 1BW9B 4TL6A 3FI9A 2XMDA 1XWFA 4JLJA 3GA7A 3C98A 4DR7B 1U9YA 4D9KA 4IDAA 2GN6A 1GGEA 1YTFD 3H2IA 3UB2A 4XPZA 3K71B 2BEVB 4LY9A 2Z2KA 4E6PA 3FTFA 5IAAA 5I3CA 3AHGA 3HFJA 5DHSA 4KGVA 3EPHA 1H85A 1S4QA 1SUAA 4BX0A 1FKAO 4MVYA 1TMYA 3RYTC 2FW9A 5BSGA 2BONA 3BFJA 1GPAA 4F93B 3LRXA 1T6YA 3H0KA 4ZU1X 4MUJA 4P4NA 2W43A 4GO1A 3QJGA 1MB4A 3EF3A 3GT4A 3PC2A 3JQ9C 1HV8A 3CUYA 5AVYA 4N18A 1A8QA 2P69A 1LC0A 5JCJD 4NKGB 1YJ9V 1TQ8A 4QJ4A 4IPTA 2NO7A 1M1YB 2ADMA 4QTUB 3VJLA 5LYYA 3EE6A 2I3ZA 3J81M 4J75A 1OTHA 4RL4A 1DBFA 1PR3A 1YZQA 1NBME 3WDKA 3DZIA 3TJTA 4FFPA 2BL4A 2HHHB 3L7YA 1T5OA 1U8FO 2PWBA 1JECA 4EA8A 1IZ9A 1BH6A 4Z1MD 3D8HA 2DUNA 1DJOA 2QZ4A 2HRYA 1K73W 3PNLA 4NZPA 3NHJA 5LHHA 1RWNA 1LJ8A 2CL5A 4B8ZA 4U7NA 3ZVLA 4NI5A 4G0VA 4E4RA 1I0LA 2RKWA 4DJEC 3ZNPA 4RHUA 1KAOA 1IBKO 1NXSA 4CH3A 2HRDA 3N2KB 3UTDA 4XI9A 2I2CA 1G20A 4KTVE 4BS9A 1H2NA 1SC9A 2C2MA 2P5UA 4PY2A 1U02A 4UUBA 1PYDA 4O4LA 1ACLA 3A3PA 3F9IA 2W6IG 5B1DA 2C99A 2GTPA 4CH5A 3ZPXA 1HYQA 4ENVA 2GVZC 2KYRA 2GHYA 3ZHYA 2YWBA 4DNPA 3MRTA 3O0TA 1XYGA 4HDRA 4OQXA 5ILQA 2VOEA 1KPGA 2BSKA 2PO7A 3UOWA 2VF7A 3QUQA 4MI6A 3DC5A 4L9SA 3GJ6A 1VKOA 4OK6A 3E9ZA 5SZHB 3V8BA 3I2KA 4JP3A 3T7AA 2Y77A 4EENA 3GY0A 4YO8A 1VLVA 3WICA 1DJPA 1SZCA 5DHQA 1VQ6F 1L5SA 1VOTA 3D1VA 3F47A 3SJBA 1BWQA 2GTAA 4RCZA 4PC2A 3FUWA 3RNLA 1CEEA 2NXNA 3FZGA 4WK6A 4DUPA 3BD6A 4IBOA 1KKLA 2H06A 3RHZA 2VJBA 1K4DC 5FUWA 3TKYA 2WIGA 2HCFA 2O1XA 1TC2A 3KEQA 3K6RA 1B8VA 4ZAFA 4Q34A 2GZMA 3IP9A 3QY0A 1HQCA 2WWVD 1YCDA 3SJQC 1BCRA 1XTTA 4ARSA 4M1TA 4MKFA 2WHEA 2CWWA 1UMBB 2W37A 2XKBA 1WZ2A 2I2AA 4HNVA 3TBHA 1ZN7A 3HA3A 1BHAA 3Q3JB 1Y6RA 4JL5A 4EEQA 4L7QA 3R3SA 2V0NA 3P1JA 1MCZA 4LJRA 2XGGA 1XQ1A 1KYOF 5BT8A 1NYLA 1QCCA 2Q4DA 4U5XA 1JN1A 3FNQA 3GLFE 3X2EA 3U7JA 1ESEA 1Z4NA 4PBTA 2QT1A 1DJMA 2VSFA 1WNFA 4MS3B 2YC2C 2PUTA 3GW8A 4MMZB 1HE3A 3NLLA 3L6OO 1KU6A 2REBA 1R10A 4AF7A 2IFTA 2X2PA 3FPAA 5HBGA 4EVIA 4ZHQA 1MOQA 1T1JA 1JY8A 4OSPA 1QVWA 1TYZA 3CCSV 3FYUB 4S12A 1IOZA 4BV3A 2ZE7A 4BTVA 3EZ9A 3Q7IA 1KMQA 2PTGA 1NATA 4BNNA 3GDWA 2W90A 4EVQA 4P4TA 4PNPA 1S1MA 3AW9A 3O9MA 2JHFA 2PSJA 3FDJA 5CDHA 5IUNC 1EN4A 1XJ0A 1A5ZA 3SDBA 1JA0A 2R96A 3EHEA 3O4GA 3ERCA 4HQKA 2PMKA 3EW7A 4JP1A 4PLGA 2YV1A 4KQEA 3JVEA 4EY8A 3E20B 5DK6A 2C4HA 2JVDA 3PNMA 5EQTA 5E6UB 4I5IA 4IQGA 2RGDA 3GWZA 4EGQA 4J0GA 4WY2A 1HSZA 2V6FA 1WPBA 4FBGA 1CFZA 1QGYA 4FR2A 1KHHA 3QM1A 4DYDA 2CUGA 1PW5A 3LWVC 2I4OA 2Y1KA 4G23A 3LXXA 4DRXA 3V4ZA 4R2MA 2KBFA 3CNQS 1IBSA 1TJ3A 4PE5B 2PTHA 5GONF 5BSTA 5CFNA 2F9ZC 4MNTA 2WJAA 2C7BA 4J76A 2WPDD 4GNRA 1JWLA 2WWRA 1SPBS 4CRWB 4RO0A 1D3AA 3SYKA 3WLOA 2QP4A 1H3NA 4P9PA 1YJXA 2GILA 5EE1A 3OZAA 4ZTUB 2XSZA 3RABA 2CEKA 1NUHA 3REQA 1FNKA 2IHKA 3EVAA 2JFQA 2OBYA 1JVNA 5L4LA 1JJBA 5IVPA 1WUKS 4XQCA 3ZE2B 4FE7A 2QIPA 4D4MA 1F8FA 1R6AA 2AEMA 4BMDA 1ESCA 1RE1A 4B3HA 3E6AA 3E4CA 5C3UA 3EFEA 1M6EX 3N6XA 3ZTTA 2YICA 5DXJA 3KBOA 2B92A 5I51A 3M7MX 2Y0DA 4LXGA 2G72A 3IDFA 2B1RA 3AUSA 3TLMA 1XVIA 2FPSA 4P6VF 5J1SB 2HREA 1EUCB 3RASA 1RRVA 4MO9A 3HB5X 2VZ0A 3W9UA 3GEIA 4HDSA 1D1PA 3L84A 4ZGBA 5LA6F 2I6UA 4X41A 4MCJA 4X1YA 4BNHA 1NKVA 3F0EA 5K8UA 4AROA 3TKAA 4YY3B 4LJLA 3ZGXA 1OWLA 1SIWA 1EFTA 3A6JA 1JHVA 4OHPA 4KUHA 4UVBA 2BZGA 1H47A 2H2AA 2O2IA 4TZZA 3QBDA 4P80A 4G28B 4TL7A 4NJMB 4X20A 2FR8C 1YBAA 2WHXA 5DM70 2BI4A 3G71F 4NS4A 1P1IA 5AKYA 4KR9A 4MEBA 1XG5A 4U7WA 5HRUA 1VECA 2C29D 2ZJFA 5A4AA 3BVOA 3GVHA 1NH2B 5LXTB 4KJXA 2IYXA 3DL0A 5GTIZ 2BT4A 5K3AA 4U4AA 1KEKA 3UPUA 3RFCA 4FC6A 2P3QA 4DMLA 3BYZA 4NESA 3PT5A 1RAEA 3V7QA 4EI2A 1WQ1R 4QPDA 4BP8A 1WZUA 3ZVNA 4GGPA 1KAQA 2ASVA 3HO8A 1IJFA 4BMYA 2XKKA 4B74A 2G4CA 4OJKA 5DOVA 2RDCA 3SBDA 1W2WB 5JFOA 4MUMA 3L8EA 4MW9A 3FGPA 2GAIA 1W4RA 4ZCLA 4J3FA 4IJ5A 3C3TA 3D02A 4M1MA 3DVRX 1ZWLA 2A30A 1PUJA 1E99A 4ZCSA 4YMTA 4UBIA 1Y3FE 4H1VA 5A62A 1AX9A 4F8EA 3CURA 3B12A 3HG7A 4LYDA 1WW2A 3D8BA 2CEAA 3IA2A 5KX5A 3UCFA 3PUJA 3GLKA 1I7FA 4KFMA 3NHSA 1C41A 4IDNA 3S40A 1LJLA 4BWYA 1NJ6A 2P6UA 4X5OA 3UJ3X 1M9NA 3HN7A 1FDOA 3LGSA 3BWXA 4G1FA 1M5TA 3E2MA 3U0OA 5G4UC 3BPSA 4Y6LA 2GEBA 5FBRB 4ENRA 4LVOA 4GQBA 4DSTA 2F4NA 2W93A 2ZIVB 3JYLA 3HDTA 3VPHA 4WLEA 1Q0ZA 3WOVA 1SHLA 4YH1A 2NUTA 3Q2IA 5DHUA 4J16C 2R5WA 2B8EA 4DLWA 2O7RA 2HMTA 1WB6A 4KN8A 4WV3A 3CCCA 1MNAA 3BQNB 3N5CA 3FROA 3T9CA 4M8IA 3A6EA 2YJ5A 2B35A 3GAMA 4QWMA 5B8FA 2VKTA 5BNWA 1TO6A 3WKCA 2WTNA 3JALA 2XMBA 3STWA 2CXPA 4J94A 3ADKA 4H2DA 3TIXB 3WNQA 4ZBMA 1B2LA 3QU9A 3OC0A 2PJZA 3BHIA 4FEEA 3LBFA 1E0DA 1K3FA 3FSJX 3X1DA 3MT9A 1PJZA 4X64B 1QQ5A 2X4DA 2VJMA 4AK9A 5AVWA 5LJIA 4D8VA 3SJUA 2NSJA 5CT9A 3UGTA 3LUDA 1G4AE 3WGKA 1KR2A 5M3BA 1FTSA 2E4WA 3MMXA 5AM0A 3PGJA 2XVZA 2ZLBA 1W581 1RPRA 2RJNA 5B3SB 4NV3A 1ZY2A 4QA9A 3ZV4A 3P9RA 1R8SA 2JA1A 1GD1O 4CM4B 1M5IA 4OHKA 4QGPA 5FEMA 1L5HA 1LDBA 2HK6A 4EKIA 1YFZA 3FB7C 3JATB 2EBUA 4FCCA 3QUSA 1MW8X 1SXJE 1RYEA 4UTNA 2UVPA 4BJ1A 2A14A 1YRWA 4EG4A 3D6AA 3B48A 3WWEA 1N32O 1R0RE 2ERXA 1GDHA 3CSSA 3R5TA 2HLDD 4GF5A 5D3KA 3P0ZA 2KPOA 4JKOA 3I05A 3TQTA 4I8DA 2VDOB 2JVJA 3ZDZB 1GLVA 1WXGA 3ZS9A 2O1EA 2JFUA 2H1RA 5MFZA 4BC0A 1UDAA 5E3JA 1FNSA 5DCLA 1PQPA 1V43A 4Z4EA 2R60A 1RAFA 3BCUA 4XTCS 3BSSA 2FRXA 3ZIAA 2XAHA 4DLKA 4ZZ3A 3QPUA 2REQB 4W99A 3B7PA 3VPBA 4EW3A 2V54A 2YJ6A 2PGGA 2ZM6O 5I7UA 2PZGA 4NCIA 3I9V1 1Z75A 1PFGA 3FM9A 4Z5XA 1XPJA 1UMCB 4TYWA 5TIIA 4EUSA 5SY6A 4CNQA 3VR6A 3QNEA 5K2MA 3GLFB 5AM5A 2IKSA 1BS2A 4QGGA 4ETIA 3KOWA 1DRJA 1U31A 3MXTA 3E8HA 1BROA 3DKRA 3T5MA 5T7BA 2G1PA 3FYDA 2B61A 2BMDA 2I6SA 4YVFA 1KKDA 4D3SA 2ZAYA 1XZIA 4XCVA 4Y2HA 5CRIA 2CCGA 1IG3A 2D4AA 1T2EA 3E4DA 1X80A 1SUCA 1E3QA 3EXHB 2A84A 4OHCA 3FWPA 2H9AA 5G4KB 3K1YA 1XA4A 3G2HA 4YP1A 2CKDA 4DV1B 1FP1D 2IYYA 2R8PA 1I4EB 2OTLF 3I2HA 4W5NA 3H86A 1E1QD 1K4KA 1DAPA 1IPEA 4ZK6A 4OM8A 4OQEA 5GJCA 5AKGA 4C20A 4FEGA 1S9HA 1G20E 1ZGZA 1W5BA 4B3MB 4NBSA 3VI6A 2FKNA 3CLUC 3ECAA 2RARA 1DB3A 5D6OA 3HJBA 1CVLA 2CMDA 3KT3A 2DUUA 3GEEA 3HCAA 3HZRA 3RROA 2IU6A 2VC2B 1LTHR 1W4AA 2ZIOA 2QJRA 5L7WA 3SSNA 1IDOA 4JBLA 4YT8A 2IHBA 5KUKA 3A3YA 2FL4A 3I04A 1IY1A 3ZIAG 1E6KA 4GKJO 3F6RA 3FRHA 4JB0A 2P2LA 4Y6QA 1NI8A 4XSHA 2QMUA 4I50B 4MUNA 3VR2D 1G2QA 2X8JB 2CDNA 1I8TA 1U4OA 2QU7A 3E8XA 2FUG1 4MVUA 2ZRFA 4MINA 1K6MA 7GPBA 2YWCA 1AK2A 4FHEA 1ZWZA 3I2FA 3OWXA 1CYDA 2IEDA 2OOKA 4FOPA 4G07A 3GGSA 4LQCA 4GDMA 1A2BA 1FX1A 3TUZC 4EF5A 1N0JA 4M0LA 1BMFD 3CF0A 4GXNA 1ORVA 1AR5A 3GX1A 2XGSA 5I8ZA 3W5HA 3N58A 2QUZA 3MCAA 3TPFA 4E4TA 4J7JA 3AU9A 3FZNA 3VH4A 2PBRA 4TV8B 4LK2A 3B7WA 2RIPA 4JHLA 1RM3A 4YDRA 2DBRA 4FYVA 1VF6A 1MEOA 3DOFA 4AQYO 2UZ1A 3PKJA 1IPAA 4FQ8A 2R3SA 2WWIA 2PRZA 4Q24A 4X62O 1DDIA 3TW8B 4G4XA 4TMWA 1MTOA 3G89A 621PA 5K8LA 3ILXA 3L9XA 1E3WB 2CJPA 3ENVA 4ROSA 4MYUA 1QLHA 3FJYA 2QWPB 3Q10A 3UWSA 3ZG6A 4HEJA 1CU1A 3IBTA 4JP5A 3O9ZA 3UBMA 3FPSA 1VARA 2DYSC 5KIAA 4KUMA 3GJ4A 4GRDA 2PN1A 2CTRA 3FYUC 2W6ZA 1SCQA 1E4YA 2X7JA 3ZCRA 3VPSA 5FUMA 4KQFA 1WW8A 1FFDA 2WZCA 3W4KA 1QO7A 3QJ5A 4IVQA 1R73A 4OB6A 1PE0A 3NYRA 3MJFA 4I1SA 4GDFA 3K1TA 3KQMA 2I3AA 3K2EA 1S3IA 3N7UA 5FOQA 1JYEA 4MR9B 3L1UA 4PA3A 4AJ4A 1ENPA 4TTQA 5J9FA 4IOMA 5KVVA 1U9CA 2ZREA 1WAMA 1FSZA 4EHAA 2QOEA 1VQ7F 2V45A 4YRGA 1NGSA 2HKIA 3C8UA 1B14A 5JXGA 4O2LA 3WQQA 1R0CA 3CE9A 1U3LA 4PTLA 1ML3A 2FSVC 5I9NA 3LY9A 3E35A 2OBNA 1SPXA 3COPA 4JLDA 4ED9A 5HY0A 9MHTA 1R3DA 1KY5A 1CUBA 1NWCA 3JCMM 3H9QA 1BDHA 1WETA 2GFIA 1CR2A 1CR6A 1JBEA 1G0OA 3QF4B 3MWKA 3GJTA 5DGDA 2P90A 3A6GA 4K7JA 1RYBA 1GZ0A 1J1IA 2BF4A 3JXEA 3JWIA 4BE7B 3RUFA 4E15A 3LECA 1VP9A 2EYUA 4DFDA 3SJZA 1W19A 1R0LA 3AL3A 1BS1A 3B3JA 3I76A 4EJ0A 4QPPA 2HO5A 4JIMA 1WEHA 2ALEA 4N5DA 2RGNA 1QHYA 3DDZX 1EHYA 2FW7A 1KP9A 2AR0A 4PR0A 1VXOA 1SQ6A 4BR6A 2BM1A 5BN3A 5K5EA 3C97A 4DLAA 4UU8A 2BKEA 4YLYA 3T5BA 4KIUA 5JC8A 3FKSA 1S8OA 3FYSA 4XKJA 2WE7A 3WBKA 1JS1X 1WNSA 1MZVA 4TUYB 1JHXA 3DS8A 2GUGA 2JLQA 3EBOA 2F43B 4X6LA 3MOIA 4PF1A 2FFBA 3Q5GA 1HQKA 4DJDC 2ECQA 1CK2A 3K73O 2QD3A 1R1MA 4ZKDA 3HNRA 4F45A 2QN7A 3J81k 2P8SA 1G38A 1FDTA 5FLEX 2HOQA 4DIMA 4AECA 5IHPA 2XHEA 1UEJA 1MKYA 1FP6A 1L7BA 4CR7A 1Z4KA 4DM3A 3WLFA 5EE5B 5JAPA 5EIBC 2DFPA 3DO8A 5JZVA 1RMTA 2C82A 2LZ0A 4NE7A 5J5AA 3AH8A 3AEYA 4UZFA 3ZN2A 5DP2A 1NXOA 4MVOA 1BVHA 4H6WA 4MS4B 1U1GA 1XAIA 3H8SA 3PQ6A 3ZN0A 3KQUA 3WXMB 1ONNA 1HDCA 1Q8IA 2W42A 4RHTA 1A4XA 2VRBA 3GFRA 1FYXA 2HMAA 1ND5A 3IIMA 4R83A 4ZU6X 1L7EA 4F4LA 1ZM7A 4CETA 5JWPA 3MYRA 3KKZA 3OCVA 4LRUA 4WFGA 3F3KA 3LDUA 1JHPA 4DOMA 4NWIA 1H4QA 2P9TA 4UXJA 2XUOA 4O33A 2RK6A 1YMVA 4QQ8A 4WY8A 4Q1VA 3PGA1 4BNMA 4HB4A 1JA8A 2V7VA 1YE5A 1BQZA 3IHKA 3GOHA 4BUJA 4HNGA 1ZKDA 2Y48A 2VBCA 1KI4A 1SXJB 3E3MA 4J0EA 3LQYA 4MWZA 2HV9A 3DLTA 2DGDA 3FKSG 1K27A 3ZJTA 4MLDA 2X9VA 4ZAYA 1DF4A 3D59A 4KN6A 3M1AA 2AQ8A 3N74A 3ISVA 4Q4HB 3KZVA 4QTTB 1QX4A 5DMHA 1S8NA 3VNUA 4CIWA 1PX2A 2WLHA 1G5HA 4AY6A 4G0OA 2AFIA 4N49A 2M2IA 5FPOA 2ID9A 3U3XA 2OQIA 4RGBA 1DDOA 3OD1A 2QM3A 2A1UA 3I0ZA 4ZEOA 2WT9A 3RODA 4AWXA 4DT1A 3N4ZA 4CZZA 4W9NA 3A25A 2NVWA 2PL3A 3ULKA 4F5WA 1EXWA 1YV9A 4NOJA 1PWXA 2F64A 3TR0A 4IGEA 3TTWA 2DKNA 5IYZF 2AMJA 1BE0A 3RHTA 3I6ZA 1JN0A 5IBPA 3PC7A 5HUJA 1D5CA 3KELA 5CTAA 5L45A 3D6NB 4PDRA 3HBNA 2PUCA 2V65A 1E5XA 4MKXA 3L92A 1NHGA 4O8CA 2OK8A 2H9IA 5JJJB 3RUEA 2F4VB 3UPTA 3GR6A 1IEVA 1YMQA 2PGAA 3DTVB 1W30A 2A3QA 1YRHA 5K6TA 4UPEA 2XCRB 3FFMA 1NJSA 2HHJA 3HWUA 4JC5A 1EPUA 3W7BA 3KKYA 3IYLW 2B1QA 4C5BA 3COYA 1PZXA 2XIJA 1YR7A 1EDOA 3RVYA 3O38A 3SXUA 3CEAA 1BFDA 1QCYA 5GONA 1YS9A 3U4GA 1G8KA 1U1DA 2VQEB 2QLMA 1QV6A 4JJFA 3TTTA 1UFOA 4IGFA 2WNHA 3L0IB 1QKJA 4WOPA 5LGNA 1G20B 3R5HA 1OUMA 3GFSA 2XVXA 1E69A 3MWEB 3KZKA 4WBXC 4OB7A 5HZKA 1KMHB 4MRNA 2D7JA 4RDXA 4WL0A 3CB2A 1JG6A 3PFWO 4IXDA 5FEUA 3S27A 3WK8A 2PLRA 1SZTA 5B3SC 2CVHA 4DLLA 5TVGA 4BIZA 2BSKB 4H7JA 3NH9A 1HG0A 4WFEA 3MUEA 2BMAA 2CKMA 3GFPA 4G5GA 4DQVA 2RGXA 1WS6A 3MTIA 2C5EA 1G1XB 2V4DA 1OJLA 3P10A 4ZYXA 2RJZA 4JSYA 1E92A 3F73A 1N77A 2O50A 1XMPA 2QV0A 2WFLB 1RQNA 5TMPA 1IRXA 4EFNA 4FEAA 4J7UA 4GPIB 4OQDA 4NYJQ 1PYOA 4IJQA 4XXHA 3DL2A 3L6RA 4WJKB 4KTTE 2C8LA 3TXYA 1EINA 1P6XA 1YU9A 1JXQA 1Z63A 5C7LO 5FLKA 4F2WA 4QTYA 2PUJA 3DHYA 1TRKA 3OEHA 4MI1A 3MWFA 4LFBB 5D8DA 1RXIA 4K3AA 3OMNB 5TPZA 1C2TA 3GH3A 3VJRA 4JQZA 3H2SA 3M6LA 4LF8O 1FK8A 2X8WA 4RD6A 4Y9TA 5A4FS 4G0QA 1HX7A 3R6DA 5B2ZA 2O9JA 1VRWA 4IT5A 1MC8A 1SOMA 2HN9A 4CGYA 4I1IA 2Z2IA 1J00A 3C6MA 3EIEA 4WKNA 2PANA 3DXXA 1FFXA 5JH7F 2O05A 3ETQA 3SR3A 1H2HA 5B3JA 1TIKA 3K58A 1T3TA 1GN6A 4LFCO 4LF5B 4BJ6A 2XXAA 1SJ9A 4F3YA 3W79A 3GLQA 3HR4A 3MGCA 4YRIA 4HCJA 1ZUD1 2VR1A 2VAMA 1GNVA 5DNUA 4I5SA 3EASA 3EXHC 1XU9A 4MCHA 3EARA 2VDWA 4IVRA 2F66C 3LX5A 1QZ3A 1QYXA 2ZZMA 1OBHA 2F3PA 2IXTA 2JEXA 4UEOA 1A77A 3N6VA 3VZPA 2G76A 1PD3A 3KLMX 5KQMA 1MZEA 2P8JA 2JCBA 4AO8A 3PGXA 2IYQA 3I8XA 3G2OA 1G17A 2ZCJA 1L5VA 3WAJA 4DLSA 5ES4B 2Z08A 1UQRA 1BYUA 4JI3B 1DC6A 5ARDA 5ISMA 3CPSA 4FNAA 2CSXA 3D2CA 3TXAA 1I4WA 3LRPA 3PXBA 2F67A 2BTQA 3JYQA 1GKKA 1NZFA 1L5QA 3DEKA 3GT3A 2ORVA 2FC3A 3OEHG 2R66A 4RJJA 4C76A 1E4OA 3S02A 1N6KA 3OJFA 2CSUA 4AVYA 1K98A 4X91A 3B36A 3IQEA 2FPPB 1BX1A 3HVUA 2Q3HA 2YRWA 4OI0A 3KNZA 4YXWD 4OH7A 4ND3A 3OESA 4YNBA 3ZX5A 2PWAA 1SRQA 4EBFA 3OIVA 4N7JA 2NV0A 3T7IA 5CCDA 2VN8A 3JQ8B 1V4VA 1AJEA 5IHXA 3HCBA 3TM4A 4YP7A 3IC7A 1EUQA 1CDOA 5FH9A 1O97C 2VJYA 4G2KA 4MMYB 1Y1LA 3WGLA 3UG6A 3KKLA 2WP0A 3REQB 2HADA 5FL7D 5EAZA 1G5QA 3I1YA 3AW8A 4YRFA 2QU8A 4DXWA 2JEZA 1YC5A 3OEED 3AVYA 1EBUA 2HMVA 5K2OA 4OXNA 1CJCA 4AF8A 4QU9A 2VJAA 2I76A 4X92A 4BFTA 4S2UA 3WY9A 3L4BC 1JH8A 1WDMA 3NW9A 3BQ9A 4LHWA 3VOBA 3W06A 4FGWA 2GAFA 4RXTA 4C2UA 1QC5B 3SHOA 4J6FA 3RYHA 2I7DA 3S28A 1C0LA 4QUHA 4XYEA 1E3EA 3TO5A 3WLMA 3OH8A 1PK8A 5L95A 1VQ5F 4DR5O 1CLIA 4HDSB 1R00A 3ACDA 1ZINA 3Q8HA 2QK4A 4XA8A 4M0PA 4KVFA 3QVKA 3GF4A 4XFDA 4FWIB 3R3WA 2HLHA 4C21A 4HH0A 1SK9A 1LWNA 5I9SA 1WZNA 4CCWA 3N76A 4F38A 3EISA 2LRHA 3Q4HA 1JJIA 3OA0A 3U4QB 4X20B 1YJ8A 2B4AA 3ABTA 3WB0A 3G0DA 5EXPA 1XDWA 4EGCB 3F78A 5HY4A 2CE2X 1R50A 3BH7A 2AG5A 4K3UA 3LT2A 3TPCA 5E2AA 2XEDA 3IJ4A 3L41A 1CS4C 4OBEA 1TF2A 4BP9A 4JB3A 4HAIA 4EYQA 1PKXA 3HYRA 3OE1A 3ZTYA 3HXTA 3OJ0A 4N12A 5BWLA 4UTRA 1KI6A 1LX6A 5B5SA 4BVQA 5G53C 5BQOA 2WSYB 4HLNA 3VJMA 1H2MA 4MHSA 2OZBA 3VR3D 4UFNA 1PWHA 4IH9A 3VH1A 4G4ZA 4DQLA 4YR7A 1G16A 1U1FA 821PA 4MYRA 3K9HA 2V6IA 4RESA 5GMOA 2IZ6A 5L3DA 3FOBA 4M83A 1M1KH 1PP4A 3LYAA 5AUQA 2NVUB 4DHWA 5FUQA 4HN2A 2WY2D 4PPQA 3MMZA 1NBIA 4XQGA 1UFQA 2FZVA 3RIHA 3QXSA 3D0RA 3U7QB 3IVAA 2F59A 1VE1A 3PJRA 1IB6A 4Q4LA 1A1SA 4BKRA 3A1DA 5TXGA 1KO7A 3ELCA 2EF0A 4L0MA 2P1DA 1Y74A 1U4SA 1TK3A 1ZRNA 2JJ2D 2ZXEA 3RTEA 2OLEA 5LQRA 1E58A 3K9NA 1KIAA 2HT1A 1OZ0A 4X9XA 3BAZA 1OLOA 3MQ4A 1SZXA 1ICEA 1X1SA 1RZUA 2UUCO 5FOWA 2PPLA 5JASA 2ZXFA 2IUUA 3LLCA 2OLKA 4Z7NB 3PNBA 4DW1A 2QUAA 5J40A 5TY0A 4Z6KA 3L82B 5JCXA 2NUTB 4EGAA 3BEOA 3FB1A 4AJ9A 2QZJA 1M6WA 4C04A 1OU0A 1KFEB 4JKIA 3LC7O 5LQCA 1LS6A 4X24A 4J0FA 3U37A 3SE0A 4M46A 1KI2A 3BD7A 3HGQA 4L5CA 4P86A 3JALB 1LRJA 3WBJA 1A8UA 4P3PA 4G4GA 1CY8A 1FFWA 2G9UA 2VATA 3T7TA 4BFVA 5HFLA 3L4JA 4GMXA 2IQQA 3C9TA 4UUJC 1CULC 1DMRA 4TWZA 4JJGA 4J0IA 2CZCA 3FLMA 3ABUA 1XCOA 1FMTA 1MDBA 3FHCB 4O2AA 4QREA 3L5OA 2WI8A 1D2CA 2FRDA 2VJMB 3A7EA 1H4VB 1DO2A 2BSAA 3PNQA 2OKGA 5A3VA 3EDRA 2ILMA 2Y68A 1QPZA 1GEGA 1Z4IA 5JAMA 2ZRGA 2KB1A 4D6TH 5HKKA 1Y7TA 4LDJA 3A6KA 3TDKA 5COAA 2OK7A 4UVCA 2B4TO 2GVIA 2II6A 4JSRA 1DEOA 1L5HB 4Q9DA 3GIWA 4DXHA 4TKVA 3IB6A 3H2YA 4FYIA 4YRJA 1J9ZA 5FJJA 1RXYA 3VTAA 4P8RA 3WGMA 1RXUA 3FFXA 3KHTA 4HYYA 5LHIA 3PWKA 3NC4A 4TVOA 1SXJC 4UREA 3R7NA 3VC1A 4DQKA 4AJHA 4D7TA 2QNRA 5A9SA 3U0BA 1J0XO 5BO5A 2C9YA 1G64A 3M34A 2W2LD 1RI2A 2J0EA 3DB1A 2VYQA 1H2SB 2AFIE 3UK1A 1DWUA 2H29A 3ORYA 1C7EA 1H66A 3UMFA 4RZ3A 5KC8A 1SR8A 3FETA 1KFJB 4RCYA 2C7GA 5ADWA 4IWNA 2J6IA 3QTTA 3CEPB 4U8GA 1DTWA 3D3KA 1F2DA 5G0VA 1I0HA 1PGOA 2RAPA 4JL8A 4L87A 3F4LA 3ZRWB 1ZNYA 5LZ5A 4PAMA 2I8AA 1IVNA 1KEUA 3ZWPA 3T9EA 2VUIB 3AEXA 1DCKA 3OLQA 3EXAA 5JO0A 3ABOB 5HW0A 3Q7PA 2XKJE 2B4QA 1DRWA 4JS0A 2C2KA 4IDQA 2QTSA 3T1VA 5JO9A 2VT2A 3U62A 3HSKA 2PO5A 2SCUA 5BWCA 3PJFA 4IDCA 4HVCA 2P67A 3QNMA 1FTGA 3TGUH 1X80B 3DYVA 5FNZA 3NMUC 2R1VA 2XMGA 4YCJA 3N2GA 1JI3A 2ZI5A 4PFSA 4H7FA 1E7RA 3IUSA 1FUUA 3RIMA 4Q7EA 1KAMA 1KXJA 3L7IA 3K7EA 1AP5A 1AB5A 1UJNA 4GC5A 5FDFA 4M9RA 5H81A 3TOVA 4CKCA 4X66B 1M33A 4GI2A 3M5WA 2MYUA 5L3QB 5FBWB 1JEQA 2GK7A 1J70A 4YAWA 1LTKA 4XWWA 4LMRA 4YT2A 1XZQA 4KOAA 2FMKA 2IXBA 2NO6A 1RFGE 3JWEA 3K16A 2HEIA 4YCBA 5J1TB 4AYXA 3DTNA 4DSOA 2RH4A 3P5SA 2A9JA 2ZB8A 1KOGA 2H11A 2Y0IA 4DY6A 2AQHA 3NUQA 4PPNA 4EY4A 2QUHA 1ENZA 1P61B 2ORWA 4HB2A 5B57C 4MPTA 2VJKA 3GNSA 1R6KA 4UBLA 3SXPA 1K6EA 3WLJA 2YNMC 3QQPA 4OIMA 3TM5A 2IVZA 1OCRB 2WJ3A 1NFFA 2AN4A 2CB9A 1HSOA 5ESDA 1ZOLA 1MA3A 3K9AA 5CDFE 3K30A 1WD5A 1AOXA 3LXRA 2ZUDA 4K9DA 3VHRA 4WFBV 4R0VA 2F1JA 1X87A 1R8QA 1DQZA 4YTEA 4C7OA 1PJQA 2WAMA 2NSYA 3RVNA 4BV8A 1E3TA 1KK0A 2J09A 3AINA 4WXPA 1F4LA 3KKOA 4JVOA 3KYJB 4Q3KA 4E14A 2VYFA 3EPPA 4R2IA 2QF7A 4GNKA 3ST7A 3NHYA 2W4IA 4G0ZA 5EJAA 2DBZA 4FFRA 2VWKA 2CBZA 1CX9B 2UZ1B 1ACJA 4BO9A 1VQ8V 4UE3S 4US1R 3DZCA 3UMJA 4NTWA 3U6KA 4HNAB 3QHDA 1WM1A 4FGKA 4ZN6A 2J59A 3T9DA 1KYXA 3T7RA 3RK4A 3NHZA 3DDWA 3HU5A 2DHEA 1H2LA 1WDKA 3ZDEA 3ENQA 3CNEA 2YY7A 4LMBA 2Q9BA 2DOSA 2F1OA 4JXXA 1C3OA 3SPXA 3PDHA 2DPYA 4QIHA 3LV8A 1XV2A 2OCGA 3CRVA 7AT1A 5LOVA 4XQ9A 4CH4A 3T4EA 3K2QA 2QRNA 5CW2A 4OFBA 2L17A 3ND9A 3MSCA 1IM5A 4FGUA 2FX2A 4ZOEA 5T64A 5KHKA 4NMXB 3ZCSA 3EDOA 1YH3A 5D6NA 5DSXA 1KFBB 4YIHA 4NCBA 1TYBE 4PHGA 4D44A 3U31A 2EW1A 1C4OA 4BQQA 4MRRA 3CHXA 4HP8A 4AMUA 1GNSA 4H7DA 4WXRA 2D5LA 2O3SA 3THSA 5COBA 3R75A 2ZUCA 5A03A 4TOIA 4F0JA 1TVMA 4IRMA 3B1XA 3RUPA 1Y33E 5HGJA 5DF1A 3CN7A 3SHTA 1U3WA 3AIOA 3M5DA 3M3HA 3C9UA 3K4QA 1Q7YW 1M76A 4F8JA 3VISA 4OTZA 1QP0A 1FLNA 2ACEA 4TRJA 2R1ZA 5MDHA 2B33A 4K05A 2JAXA 1US8A 4XR9A 3LNCA 1NXVA 2WK1A 4C4AA 2GDZA 3ZGNA 4KE6A 4HZIA 2HPHA 2ZIAA 1Q86H 1RJEA 1HNWO 2A5DA 3LCUA 3CS5A 1W9MA 1C1XA 2Y1WA 1PFWA 4JVLA 5DX8A 1LPNA 3PQ7A 1T0PA 4DDVA 1WHSA 3R8CA 1QOPB 1QVGF 5EZ5A 3MMSA 2V6MA 5HE9A 4AZSA 4AO7A 2J41A 3PD0A 1NJ5A 2ZOVA 2JGJA 4FXOA 3THWA 2PKQP 1Z0DA 3SHFA 4ZJPA 3Q3HA 5DEIA 4OA5A 1IXSB 4BP3A 1K97A 4JN6B 2LO1A 2FOXA 5DM60 2VYVA 3B6MA 1R37A 4AP6A 1DX4A 4DSAA 2W6CX 2YBDA 3CPEA 3C74A 3V46A 4X93A 5BN3B 3VIUA 4UOEA 4GIBA 3R9WA 4IILA 1HRKA 2XOKD 3EVBA 5EERA 2AGAA 1Y9ZA 2WHPA 1QWOA 4IGKA 3STUA 1UADA 2AMLA 3E9EA 3JQBC 3Q88A 1HYBA 3WMXA 3V3KA 4UM9D 3L02A 5HIJA 1Y3CE 5DO9A 4YRQA 4OH1A 4NAUA 2QR2A 4J49A 3ZVRA 3U39A 4IIXA 4XPIA 2B6NA 2NO9A 4GRAA 3KKPA 1RBQA 3IKJA 4B75A 3PX2A 5KSYA 4U2GA 1P2GA 2O54A 3NIDB 2QDXA 1JDJA 1U94A 1YITF 4EUEA 4KQMA 2IAFA 4RQOA 1U2ZA 2W6NA 4DUYO 1RPTA 2ZDHA 1OV9A 1ORDA 3CMAV 5BNFA 3WA7A 3TRHA 2VH2A 4GAEA 4CIAA 3I2JA 2E5FA 1U43A 1L8AA 4MVJE 2GUZA 4ZOCA 1ZMBA 2PI5A 1E3DA 1YQQA 1QVFU 1GA4A 3PL5A 1FLDA 3VR4A 1ADGA 4GLJA 4TMKA 3IUYA 3H7IA 4MGEA 4LN1A 3IVGA 3UXMA 4GGMX 1MVNA 1V39A 4ZYLA 1Z88A 3IUJA 1EGVB 2ID8A 1MG1A 1W46A 4DO2A 2UYPA 5IF9A 3O7WA 3KEGA 5DN6A 2EVWX 5LBUA 2VBIA 5CGQB 2HCJB 1SUPA 4ER5A 3HK2A 1NP6A 3DCJA 1MSWD 1QFSA 4RMNA 3STLC 4C3OB 1ZL0A 1UP6A 4NK5A 4E11A 1TOAA 3PHLA 4MP6A 1G1MA 5DH9A 5DIFA 5EGNA 1DKPA 5H6RA 3T5TA 5JEEA 4ZDWA 3TQSA 4DCSA 3A6DA 1Q3TA 3ZGVA 1KJQA 1CRWG 1R64A 1XYYA 1RRGA 1QU3A 5CVCA 3PUVA 4R40A 2E48A 3DC6A 1XHZA 4E88A 2JH8A 2NYVA 5EP1A 3V33A 4XUDA 2AFIB 5NULA 1WEKA 1VQKV 3W9YA 2XHBA 2HIMA 4HDKA 4G8BA 2ISQA 5HQJA 3V4RA 3GXOA 4RD4A 3RJ5A 2A1UB 3EEBA 1U9IA 3U7FB 2I2WA 4DT1B 3ORQA 2VO1A 2L6LA 4LJ6A 3ZXYA 2YSUB 4DNXA 1JSXA 1OA0A 4MRAA 4BO5A 3PV0A 4KXQA 3CZAA 2C3OA 1T9GS 3DL4A 3A31A 4LNHA 3A3OA 4DC9A 3KDAA 1CK4A 2I6XA 4YBRA 3PFHA 4FHZA 5DT9A 3B1FA 4MUAA 3HN6A 4CCYA 3DA8A 3KSUA 4A92A 2O2GA 1N2GA 1XN1A 1WPXA 2EJBA 5HWEA 1XZMA 2DBYA 2CNOA 3ZXXA 4UUOA 4PELA 4G5SA 2GMWA 2BP7A 5FAKA 2WYOA 3MTBA 4QNNA 5DN6G 1TIPA 3OOHA 8MHTA 1TEZA 4YDSA 4KOEC 1SBHA 2ZTLA 3HBJA 2HF9A 1EFRD 4PS0A 1VQMF 1XTRA 1Y6FA 1GTL1 2V4MA 2HDHA 1P81A 1PR0A 4NC9A 2VHCA 1XMQB 2DHCA 2E21A 3RF7A 5GVSA 3RT9A 4DWJA 3DEIA 2VYCA 4UM5A 4C06A 5JJBA 1YB2A 3OQ6A 2MSDB 2P4KA 4HTAA 5FTLA 2J0UA 2ZJAA 4XAQA 3TRJA 5C5CA 4FHCA 1KZHA 3W7UA 1G5RA 1YJ5A 3AFGA 4DN6A 5F7XA 3E27A 5BV2P 1PF5A 4GKKO 2C58A 4FD2A 2DY1A 1VZ3A 3CLUD 3QOYA 3BMCB 3FFTA 2CLDX 2HK8A 3HDVA 2R5FA 4EI8A 4PWZA 1AD2A 1ZZGA 4Y9SA 5GVRA 3L46A 3KTFA 1G9TA 1XSEA 1EWQA 3FXAA 1AUOA 3QKUA 3BIXA 2PL9A 2XZTA 4TGLA 1EU1A 4PZEA 1EWRA 2P22C 4ZTBA 1KZ7B 2FG5A 3KHUA 5J4VA 3DR3A 4EOGA 3RFXA 5JD6A 3ZWOA 5E3IA 3VBEA 3CMEV 3LDTA 2K6GA 3KB6A 3L4KA 1P9WA 4OI4A 3EVZA 3OAAD 4DA7A 1KEVA 1GQQA 2Q5QA 4Q21A 1MAUA 1VQLV 1GAXA 3U17A 2DFVA 2UUOA 3BL6A 3D5EA 4JYMA 2JI8A 3PTLA 3FB6C 3TQOA 4M22A 1WV0A 4B3SB 1D4FA 2GBLC 5H83A 3S2ZA 2FY8A 1Y5LA 1AHHA 1FFXB 3CE6A 2YR0A 5SICE 3HEAA 3QO7A 2WZDA 4FMDF 1K7XB 4C4YA 1Q21A 2D4HA 4Q4CA 2WUVA 1PZNA 3N3BC 1DADA 3WDMA 3N8NA 3FWKA 5HILA 3SEZA 1WQ3A 1CUAA 4QUIA 2ITDC 3I12A 4LCJA 1VIBA 4V38A 1CC1S 1YL5A 1E6MA 3UJ6A 3ZBHA 2VDWB 4YAFA 2AOTA 5L3EA 1PR4A 4HGYA 1EJBA 2GEVA 4UXNA 3E7XA 2HNAA 3P2MA 4WI1A 4IOKA 4JBYA 5JWOA 4ZZIA 1KMIY 4KH0A 5KTTA 4AX8A 3RJZA 3OMLA 5IKEA 2RHJA 4D99A 2C78A 1X86B 1IZ3A 1P2UA 4R1SA 1IBMB 3NO4A 4PBRA 3PUHA 4KNVA 1E2MA 1D2HA 2B9VA 1XNJA 2BJVA 4EYGA 1ISJA 2Y1GA 2BTQB 1AJQA 3KPVA 1Z8HA 4AMGA 3S5JA 1CUEA 1FLAA 2FR1A 5EJFA 3ZI4A 2DT4A 3I4FA 2OTJV 3LHKA 1PK9A 2NYAA 5FLYA 5CCBA 3A9SA 2DQ4A 3U48A 5BQPA 1SCIA 5K7SA 3PXAA 2ASEA 1ZL8B 1V6CA 4JLOA 3IOBA 2UV8A 1OCRC 4Q12A 1E9FA 4C6RA 2VGMA 2I78A 2A79B 1RYHA 2OIEA 4ZHYB 4FFOA 3CLVA 1S6YA 4FE3A 3JVHA 5D85A 2OG2A 4KVZA 1SK8A 1WBBA 3OU6A 5IC5A 1CUYA 3KWFA 4UD6A 4R2JA 1U3UA 3REOA 2XT6A 3L0OA 2H63A 4G0XA 3U9TA 1CJSA 1EN5A 2OM2A 4KODA 4O63O 4ADSG 1PQYA 4GR4A 2FZCA 4PIMA 5B7NA 1T35A 1Z12A 3SLKA 1UIMA 3PR2B 3CF2A 2C1EA 4DF3A 4CC5A 2NAPA 4R8CA 1XLUA 4DILA 2ZCEA 3RA6A 3RYHB 1LZKA 2ZUSA 1W76A 1MDFA 3ZS8A 3JR7A 4YCCA 1XTPA 5AXAA 2G1AA 2B83A 5AP9A 3D6TB 2M6RA 1LSSA 5LSAA 3CX5F 4CLDA 1N7IA 4WZBA 3THYA 1YZHA 3K08A 4XLLA 4IIFA 2AE1A 3UUGA 1Q7RA 2WLIA 3K6SA 2HI0A 3EAFA 3E5NA 3MT0A 1NX6A 1U8TA 3AG1B 2YFQA 4I81A 4ASUD 1QFZA 4B6GA 2WVJA 1ISHA 1JSZA 1J2TA 2WINI 3Q4HB 2NWQA 3H65A 2QKYA 1K06A 1K8YB 1Y3BE 3G1WA 1M0SA 3PFIA 1OVGA 3NBAA 2J3LA 3UFXA 4UCVA 2QPTA 4LRWA 1MV5A 3L74H 3VVCA 3KAKA 3ZHCA 3NIFB 1YVWA 5EIBD 4D57A 2KKWA 1NMYA 4F7DA 1J8VA 3DOOA 2GXQA 4EATA 1NBEA 2D1SA 5LLSA 1W47A 4HRAA 2D1RA 1RKXA 3L1VA 1MIOA 1C0KA 3EZ7A 2GN2A 4LX8A 2V96A 4NXNB 4K6OA 2CT8A 1F7YA 1JJ2U 1QDEA 4FSDA 5IAJA 1YZGA 5DNCA 2EX1A 1SVOA 4G0MA 3MWLA 3LF1A 4HQRA 3ZHZA 1HE5A 3AHJA 1JRLA 2V74B 1NH2D 3U7IA 5IC4A 3LUGA 3NXKA 2QQFA 1NVTA 5KEIA 4JNKA 3DUWA 3ILHA 1ZUQA 2VCEA 3NHUA 3EZNA 3GEDA 1F3LA 4J1QA 4NULA 2XBUA 4ZYUA 3AVVA 4FCTA 2BDUA 3TDMA 5CFOA 3ASZA 1VJCA 5KUMA 3INRA 4S1WA 4UDOA 4Z53A 1OLUB 2BD0A 1RMYA 2WDZA 4P4LA 5C4MA 4UNIA 1QTQA 2HA0A 1OHHA 3HYLA 3NB0A 1VQPV 1E4EA 2OR3A 2PL5A 4DK1A 3I3SR 3ZI7A 5F9MA 4HF7A 3LNNA 3ZMTA 5FYDA 3CF4A 4JLUA 1K5DA 2PUEA 2QM8A 4OFXA 3W3ZB 1E77A 1KEZA 3P0FA 5FI0B 2FMFA 4MYHA 3HZZA 1Z6ZA 3L6UA 3N0WA 3BZUA 4DJFC 2RE8A 5F2EA 1U5CA 2Q62A 5EPUA 4LRTB 3JD3A 2D06A 4PRYA 2RHLA 4WN3A 3IP7A 1M1NB 1ZM3A 3FHOA 3LL7A 4LH7A 1WMSA 2VTBA 2AE2A 2QNBA 2V9CA 2X6TA 1QGUA 1IOLA 1NVEA 4JC0A 1CUFA 1XP8A 4OPAA 4W6ZA 2WU1A 2DP4E 3OPMA 1O0BA 3GCWA 2CVQA 4FFNA 1XQ6A 3VNSA 3G79A 4L73A 3PJSK 3K96A 1EB9A 5CX1A 4O2AB 4Q3OA 1NBMD 3OC6A 1N8RW 1Q0PA 3HUEA 4DBZA 3ZX6A 4M8NE 1YOVB 3MJSA 4IIEA 3AEQA 5E2IA 3EAQA 4TM8A 3P9ZA 2GKGA 2ATEA 1ZIDA 4KO2S 2MK3A 3TLCA 4K86A 4K5QA 1I30A 1RTTA 3EGXB 3KWJA 4A8JA 1GMGA 3L1HA 1LI5A 3W3AD 1AQYA 3AEZA 1K1EA 4DM4A 4BO7A 4HATA 2ONJA 4OU4A 1SURA 2MMCA 5CD1A 1OHHG 3AV3A 2GJ8A 2VQ6A 1FP4A 2IZ5A 3DGFC 1PWZA 2ATCA 4KWEA 1RKBA 5TRTA 1WSBA 1A32A 3K0EA 3CF4G 3FTDA 4GG1A 2VHYA 5A9SB 2HRUA 1O95C 3NDPA 5G41A 3VQTA 2FWMX 4HLUA 3I8OA 3NWOA 1Z3CA 1H1TA 1U8ZA 3R66A 2N0SA 2UXXA 2J9XB 4DYLA 4QYWA 5A3RA 4CKZA 2G9QA 3IEPA 1O9HA 3LK6A 2ODPA 2QQ0A 5LMUO 3WPXA 4D5EA 4R7TA 4CHTA 2F00A 1DTWB 4DBVO 2Q5EA 4RZXA 2GLTA 3VNAA 2ZRIA 2PRYA 4TZ0A 3FA2A 2HMUA 2FWPA 4DQDA 4A5UB 3JZFA 3CD6F 3S7TA 4MWDA 4F4DA 4UNQA 3DFIA 1VIAA 1EESA 5KHIA 4ZA2A 1MN6A 3EW9A 3PC8C 2W2PA 5CHYA 5JPDA 3APQA 1GRVA 4PX3A 1RFLA 1QHEA 3D01A 1NYQA 5C5DA 2VPWA 3DNPA 4H08A 2UUBB 3EIFA 3O47A 3D36C 3QTCA 2BEKA 5JSFA 4DV7O 1XRNA 4L4UA 2SCUB 4BEWA 4RHFA 3T8YA 2O2JA 1XR3A 3CYQA 4QHYA 5AXCA 1K9MH 2R1VB 4MJLA 3CC4F 3N2GB 1UMDB 3OLZA 4F2GA 2G09A 3CLRC 2ZTVA 4M7WA 3FOEC 1LSOA 2GR9A 3ENZA 2QD4A 3T5CA 4KPEC 3FAZA 3VZQA 4V0NA 2UU9B 1GGMA 2LUOA 4XVHA 1A1VA 1J39A 1JFFA 1DTEA 1PNOA 4RQUA 3G49A 1NSFA 2E3JA 4JYCA 3ZCUA 3NJ8A 4JXZA 3WYFA 3CVJA 1UC4B 2GYUA 1X92A 4UJ5A 2WF5A 2HX0A 4X6YA 1XTUA 1JEQB 5K8TA 4U7TB 4E31A 3V7FA 4PHZA 1DJQA 1RBMA 4X3CA 4OBWA 1DQPA 1U6IA 3HXQA 2FKXA 1Z82A 3EA5A 4J0DA 3BGSA 3Q87B 2AI1A 2PKRA 1KXZA 4MQ5A 2Q4PA 1E18A 4I2NA 3DDCA 2P35A 2XBLA 2GV9A 2DPMA 1QU2A 2WM9B 4S0XA 3MJEA 3PGLA 4TWBA 3OZFA 3TCXB 2R65A 3AOGA 2CNKA 2BFEA 2NNWB 4W4KA 1UKYA 1K86A 1LPPA 1T8YA 1YRLA 3HJUA 3W7XA 5EJIA 1VGQA 4DR4B 2PLNA 4G6ZA 1CJBA 1AMUA 4JQCA 1QBGA 4Q18A 1AG9A 3D54A 1AVMA 1VQOV 1ZNWA 2KSDA 3AB7A 2XNCA 5CITA 3WPWA 5THXA 3T9BA 3S0HA 4IHJF 3HCWA 3DBRA 2IYPA 3V8NA 4C7OB 1IZZA 1F4NA 1RLMA 1QQ6A 1VQ4V 4ND1A 3WHKA 1X25A 3WP1B 3L05A 3PFGA 2CMFA 4AP5A 1N3BA 3IUEA 4Z99A 4KP4A 3CKYA 1PEDA 4O4LB 4JLSA 3U56A 5U4XA 5EQDA 2TMDA 3LHIA 2XB8A 2XE8A 5KTRA 1O97D 1BQEA 4A1OA 1Y1TA 4BJ3A 3P9SA 4HDRB 4FBLA 1HL3A 3K1JA 2FDXA 3OZRA 4N3AA 3K0CA 3CX3A 5D7BA 3G8DA 1WULS 2VXOA 1DAIA 3SDZA 1Q0RA 1PGQA 4QJ5A 5A3QA 2FUEA 4ABTA 2Q0SA 3DJYA 4YA6A 2DWUA 1GT91 5HA5A 3CGWA 3GA0A 1C3OB 4YV0A 4GOXA 1K3EA 5B3KA 4PS1A 2IZOA 3DTUB 4RFLA 1NXXA 4RKWA 3RVOA 3NK6A 5DTQA 3MVEA 2YUTA 3CCEF 5LOVB 3TINA 4AZ0A 1TO1E 5LA6A 3Q15C 1WSWA 1EX1A 5KQPA 3TMAA 2CLHB 2OZVA 5FLXA 4FDMA 4RX1A 4EI7A 4P2BA 1GKIA 4PW0A 3QGMA 1S7CA 1LZLA 5CP8A 2OC4A 4GPEA 4RMHA 4UOZA 1SVSA 1Q1GA 2DBQA 421PA 2BOCC 4RJ2A 3K70B 1MG5A 3SVLA 1BCRB 3U5TA 3GH1A 2AUNA 1Z62A 1DBWA 4M0DA 4AZ3A 3PNSA 3M2TA 4OHXA 1E1LA 4FS8A 16PKA 2H1VA 1TJ4A 2PGXA 3OY7A 3OBBA 4F3RA 2H4FA 4EFLA 3UO8B 5LFAA 4QEZA 2YXEA 3TSZA 3AK2A 5EQFA 3K3PA 3D00A 2E5WA 2L35A 1NP7A 4QOJA 2GASA 4WMLA 4IWXA 2HBQA 4ZT5A 3PFNA 1M7GA 1XMIA 5K6AC 1P4HA 1BG6A 4PR3A 5K0FA 2BDEA 5EZYF 5DLPA 1H0SA 5JIBA 1US8B 1AF4A 2A33A 4AUNA 2ONYA 3LYHA 4ZHQB 3A4IA 2DUJA 2WPNA 2QE7D 3MIZA 4RK0A 5JS2A 2G9ZA 3G0OA 1W0KD 4Z51A 3VHLB 2D0IA 5EE9A 1C1XB 1RC8A 3H5IA 3VSAA 3L93A 4D3FA 3EXG2 3GRCA 4PA9A 4NU6A 5T3UA 1L4MA 3PYXA 1WHSB 4KWCA 4DR6O 3GK3A 4DMFA 1C7JA 3LFTA 1X0VA 3CISA 4R6WA 1GKYA 4PAWA 3EB9A 4I5EA 2CJXA 1FYWA 5LQJA 2YEVA 5JJ5A 4H13B 4LGYA 3A0RA 5C7OO 2C7PA 3QVWA 1HWYA 2P77A 1TCVA 4ID3A 1AZWA 2BHSA 4LDRA 3S0WA 3OIWA 4G09A 4NBWA 1F8GA 1TU0A 2WHPB 4ITUA 4JR2A 1KK1A 2JAUA 3KHNA 2I3DA 2XB2A 4MV5A 2O3TA 1DK1A 1C7FA 1ZYUA 4HJXA 3FUCA 4HSGA 4FLZA 5G3ZA 4MKGA 2D13A 1NU1H 1GFZA 4URXR 1UXHA 4XPIB 3JWGA 3ABSB 4WZBE 3VU3A 2WLJA 1X4TA 1TQ2A 4DRXB 5FB3A 4I6GA 3PHCA 4NHOA 3A1WA 1Q6ZA 1YUNA 4GUAA 2GETA 1W2GA 5JFGA 3E5MA 4HWOA 3AG1C 5CBGA 3LUFA 3L6DA 3WWZA 5EJ6A 3EMKA 3C8LA 2AN5A 4IIGA 1YE8A 1LPOA 1UXGA 3ET5A 3EFHA 4GR5A 2A58A 3EZFA 4KI0A 2JGUA 4I36A 3P26A 4UDYX 1O6BA 3D8TA 2GERA 1XAJA 3UWDA 3BHMA 3M4JA 1JWAB 4TS4A 2LW1A 1J49A 3GNQA 2BFFA 4PU0A 1WMAA 1JDSA 2IW1A 4CLEA 2HF2A 1L4HA 5HDBB 4KYIB 3ZDBA 5CIYA 4OGWA 4GWGA 3BEDA 3RC1A 2IEIA 3BWEA 3P0HA 2QW1A 3AEUA 5SZKB 1D2RA 3D8SA 1F23A 1AU9A 1JWBB 1TF5A 4RM2A 1PZEA 1P0MA 1HUQA 4TLCA 1YB7A 4OCZA 3OHSX 4RAOA 1GGHA 3ESYA 3K14A 4MYTA 1Z0SA 5C7YA 1XJQA 3CPWF 4X1YB 4RVSA 1K68A 3ZP7A 4R40B 1LPSA 4MUKA 2VBFA 3ADOA 1JNYA 3TQFA 1XO1A 5ARBA 2JFGA 1SXJD 4A0QA 3SJCC 5TX7A 721PA 3QW2A 3DSRA 1U8CB 1XRMA 2NNUA 4A15A 2ZIWB 3DE4X 1C3XA 2I34A 4F4UA 5FPHA 5LGTA 1QDUA 2OB1A 3KD3A 1SDSA 2H4WA 3RG8A 3NHLA 3I09A 1OFGA 3Q8WA 4XDZA 4U6QA 4GKAA 1R0XA 2K7ZA 5M34A 3L2OB 5A4IS 3BD9A 4CCYB 3O03A 1KI9A 1ODLA 4OMCA 3H11A 1OT3A 2FMLA 2BP7B 1ISMA 4Q93A 3BGDA 4PC7A 4RAQA 1FXKA 4MIEA 3OF2A 3OECA 3L9DA 2GOYA 3I6MA 4IO0A 4N6OA 2FQ1A 4BBPA 4BX9A 1R74A 2P2ZA 1N2EA 1ZRHA 5I7HA 3DTVD 3LUKA 2I6DA 3Q12A 5KX5B 1WTAA 4WFKA 5ALWA 3E9QA 3SJAA 2QROA 4W4TA 3ZWQA 1MT3A 2YZKA 3AUYA 1Q7EA 4ALJA 3IV6A 4XYMA 5JYCA 1ATZA 5HJEA 1MSDA 1U4NA 3ESQA 4WX2B 1FOEB 1DFIA 1U0GA 3I62A 1B0AA 3DULA 4HAWA 3BAAA 4ZI7F 1FPQA 5B3LA 3KALA 3BFVA 3VRHA 3VAZA 2BFMA 4RMJA 1VKRA 3RIGA 1WDWB 4E1AA 4ZVPA 2CLIB 1A5SB 4ZVUA 2H7XA 4CTNA 4Q7KA 4TL8A 4BEVA 3BE5A 4IDPA 2H7YA 5DLYA 1D7OA 4N54A 1ST2A 2HP0A 3CVYA 4D5GA 3HKDA 2PXAA 1NF2A 2QZ9A 3RC8A 1V5IA 2V7EA 1XOIA 4MQEA 3KQPA 4LSMA 4EHJA 5HZGA 3N6RA 2DJIA 3MTQA 1PSDA 1C9YA 3ZD7A 2JIPA 3UV7A 1OC2A 3C4VA 5A5VA 4UVGA 2B30A 1J56A 4CI9A 3OIYA 1LDYA 3ORHA 2WJHA 3LA6A 2XT9A 4MIYA 4TSRA 3JWHA 3H87A 5DYTA 2HBRA 2YNMD 1J7JA 2TSYB 5EMHA 4JJ8A 3RK0A 1LK7A 2A0YA 1ES9A 2DX7A 5TQ2A 3P0EA 3T12A 1KC3A 4PSUA 2E1RA 1ZIXA 3LLUA 4AL4A 2QV7A 2FRVA 4C82A 1O77A 3V80A 3DT8A 3V8RA 2IP4A 3GCXA 1X1EA 3T0GA 4AKEA 1NL3A 4PZAA 3DBHA 2NZXA 2PR2A 5TDHA 5IDVA 3T1HO 2YN0A 3A4VA 4JLBA 3NIWA 1OIXA 1VPLA 1CCWA 4RPHA 1EK2A 4ABMA 3W2HA 2UVPB 1NRXA 3FYIB 1F12A 3W8NA 2BBOA 5YASA 2KX7A 3O3NB 2CHEA 1HK7A 4OI1A 1K0FA 3NIGB 1IYZA 4JJIA 5FWYA 4M6WA 5FV7A 1VCNA 3IEKA 5JY1A 5DHTA 1TTQB 1JILA 4ZTZB 4Z2AA 2Q1SA 1E2UA 3G0HA 3Q3EA 3GLHA 3C7CB 3GN2A 4JI1O 5LM3A 4C89A 3PF8A 2GZSA 4I1UA 4GPBA 2WKQA 3JQGA 3NM4A 1T8PA 3QMPA 2I54A 3WAGA 2VPIA 4QRHA 4NXMO 2P75A 2XAAA 4CF5A 5J4LA 1XNRO 3HBAA 4IXMA 3GRAA 4NNOA 1IJEA 5KSZA 3FGZA 1XA3A 1EJ2A 3UB4A 4KAFA 4JI5O 1GGNA 5EFOA 1SB8A 4IF6A 1J9EA 3OOWA 1AO3A 4UVHA 2R751 3K5PA 2QTVA 3G0CA 1IUPA 3FIJA 1IC6A 3BAFA 5DM1A 1AB3A 3V4FA 4WY5A 5TS2A 3I01A 4G63A 2ZDIA 3ITNA 5E0KB 4DIBA 1OB5A 4AUMA 3HCFA 5ALEA 2KS6A 4J0KA 1NN0A 1UWVA