5KX5B

Crystal structure of tubulin-stathmin-ttl-compound 11 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
430
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Cytotoxic Evaluation of Novel Tubulysin Analogues as ADC Payloads.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 167
structure length 427
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kx5B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kx5B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kx5B01
3JAWA 4DRXA 4WBNA 2VAWA 4M8IA 2RHHA 3M8KA 4HNAB 4TV9A 5IJ0A 1RQ2A 5JVDB 1JFFB 3E22A 3M89A 3JAKA 3JASB 1W581 3JARA 3N2KB 5MN5A 5GONB 3CB2A 5LA6B 4B45A 1FSZA 4IHJA 1TUBA 3RYCB 5ITZA 5CA0B 4EB6B 3WGKA 5JCOA 3VOBA 2Q1XA 4EI8A 4EI9A 3UT5A 3HKBA 1JFFA 3E22B 4YJ2B 2XKAA 4O2AA 3RYFA 5LOVA 1Z5VA 3HKCA 2VAPA 4YJ3B 4X1IB 4O4JB 4TV8A 5KX5B 4F6RB 5ITZB 4EB6A 5KX5A 2RHJA 4I4TA 5FNVB 5IJ0B 3RYIB 5KMGA 1TVKB 4U39A 4U3JA 5J2UB 5JQGB 3HKBB 1W5FA 4YJ2A 3N2KA 4O2AB 5GONA 5LA6A 4ZOLB 3RYHB 1TUBB 3RYCA 5CA0A 4ZHQB 4TV9B 2GVIA 4B46A 2BTQA 5BMVA 5J2TB 2R751 3R4VA 3HKCB 3JALA 3N2GA 4KWEA 2R6R1 4YJ3A 5EYPA 4X1IA 4DRXB 3VO8A 4X1KA 5IJ9A 2BTOA 5EIBC 1FFXB 4I50A 5MN4A 5IYZA 3UT5B 3WGNA 4O4IB 5JQGA 2BTQB 5LOVB 4I55B 4E6EA 4IHJB 1SA0A 3HKEB 1RLUA 3RYHA 5EZYB 5C8YA 5JH7B 3WGLA 1FFXA 4EI7A 3RYIA 4I50B 4XCQA 5CB4A 4DXDA 5JCOC 3JATB 4O4IA 5LYJB 3VPAA 3RB8A 4X1YB 2RHLA 3ZIDA 4IIJA 4TUYA 3JALB 3N2GB 4O4HB 4F6RA 1W5EA 3VOAA 4LNUB 5CA1B 5LP6B 5IJ9B 1W5BA 4HNAA 3HKDA 2RHOA 4FFBA 4O2BB 1Z5WA 5BMVB 5J2TA 1OFUA 4ZI7A 2VAMA 4IIJB 4TUYB 5EZYA 3JAWB 4WBNB 4ZHQA 3VO9A 4LNUA 5CA1A 4O4LA 5LXTB 5EIBD 5JVDA 3C8LA 3JASA 3JAKB 4O2BA 3JARB 2Q1YA 3JATA 4X1YA 1SA0B 3HKEA 5EYPB 4X20B 4X1KB 4TV8B 5LP6A 3ZBQA 5IYZB 5LXTA 5CB4B 1TVKA 3WGMA 5LYJA 4I55A 5LP6C 3RYFB 4ZI7B 3V3TA 4ZOLA 1W59A 5C8YB 5JH7A 2VXYA 4O4LB 4I4TB 3HKDB 5FNVA 4FFBB 5KMGB 4U3JB 5J2UA 2XKBA 3WGJA 5M7EA 3ZBPA 5MN6A 4O4HA 4X20A 1W5AA 4O4JA 1RQ7A
chains in the Genus database with same CATH superfamily
4QWMA 1RYMA 2YJTD 3CRRA 2RHHA 1WKCA 3HCNA 3PRHA 5IBPA 3SMQA 3I4CA 3X2QB 5KNCD 2B4KA 5JVDB 1DX4A 2VAXA 4IJVA 2XQGA 3AY3A 1U28A 1HOXA 4GRDA 2JCVA 3GAAA 3P9PA 4CFZA 1LA2A 1N25A 2AOXA 2II6A 5JXWA 1E32A 3BIXA 3OZ7A 5AVMA 1QHHB 2XSZD 3RYCB 1LSOA 3L0YA 3B82A 2YV2A 4C3VA 2IXBA 4MIKA 3MWGA 3NFYA 4W4KA 1A3CA 3ER6A 4QXMA 1VJDA 2NUBA 3NC0C 3EOBI 3P9RA 2BGIA 2I4OA 4L3VA 1NVWQ 1TCBA 2G6TA 4OY3A 2VAPA 2WTUA 4H3HB 3PEYA 3ABQB 1KS9A 2CD9A 4I66A 2G9NA 4RSRA 3RAPR 4C04A 4UU8A 5LNK6 4PHGA 1RM3A 1QR2A 3NHSA 2XT0A 4YALA 3TVDA 1FOEB 4V39A 2WJ4A 4H3KB 5HMLA 3ZGYA 4AJEA 1F6DA 2AHRA 2F3UA 3UJ7A 4E5KA 2DYYA 1VHDA 4ILEA 1R6UA 2WUVA 2XY4A 3QSYA 3AI7A 1K33A 5CA1F 2F95B 1LSJA 2BOBC 4YCSA 3KJEA 2CYBA 1ZZEA 4BY9D 4BV8A 4EPXA 2IUFA 1AGPA 2ZI7A 2W8ZA 3A6EA 3GFPA 1ODEA 3QA9A 3WS7A 3D54A 3VR5D 1E0KA 2EIHA 1U3WA 2Z57A 3N2NA 4QJIA 4OV6B 1I1HA 1UJ2A 2NSYA 2V6IA 1EDBA 4RO0A 5KNDH 3GROA 3V6LA 5IT5A 4EFEA 1L8AA 3DTVA 1V8OA 2YI9A 4IQ0A 1ZVMA 4I1SA 3O1IC 4NYJQ 4RJLA 3T4DA 4JAAA 3QFTA 4LOJA 3VKGA 4DR1B 1U7HA 2I8AA 2BTQB 1KMNA 3PNPA 4V2IA 5LOVB 1EIZA 3VR6H 2DAPA 5KEIA 1TK9A 1RP3B 4JDPA 3OUUA 4AZ0B 3UK2A 4UM5A 4U2BA 2H3EA 4K9LA 1GN8A 2QP4A 3M1AA 1DKQA 1Z6PA 4XCQA 1JEQB 3C2QA 4HATA 1NY5A 4Q24A 2VJCA 4U6SA 2B36A 2MYTA 4YV1A 4A16A 2R9VA 2XASA 2JCSA 3I8OA 5E3HA 1XV2A 1ZTEA 2A9RA 1I3OA 1SKAA 2BE7A 2F17A 1AK2A 3ITEA 3ND6A 3PHLA 4PCAA 1UCFA 2H4ZA 3DMRA 3HP4A 4XYGA 2FR8C 2MQEA 5BP7A 2I6TA 2RHOA 3AF0A 1TCCA 1JXMA 4WTOA 3IBSA 2AKEA 3C5VA 4Q05A 5G2OA 2I87A 4IXDA 3WK4A 4TTSA 3OTWA 4XVUA 2QRVA 4YRTA 3V6MA 2KG7A 2CXXA 1QSGA 1Y42X 4PFQA 4L9RA 5KYUA 1YQQA 3DT8A 1VXOA 3KTFA 3WDSA 5EHQA 1XK6A 1MA1A 1T4BA 4CLXA 1XDDA 4V1CB 4N12A 1M57C 5L3ZA 3WK6A 3OIGA 4F3KA 4CFYA 2EIMB 1WULS 1KE2A 5EBWC 1DCKA 4GICA 4BO3A 4ZARA 4WFAV 5SYNA 1QKKA 3BGVA 2BCEA 2WNHA 4LNHA 5KREA 1NI5A 1Z6AA 1QVVA 5DVZA 4E5DA 2XMZA 1JR2A 4LMAA 4QGAA 1ECFA 1W1WA 3G2JA 4RA6A 4KX3A 4MEBA 3F0GA 1T9ZA 4NCJA 3ZU6A 3M4ZA 3WBBA 4YR7A 1G8AA 1ZJYA 2ZXWC 1I3LA 1UJNA 1VQ1A 2EAUA 3K15A 3IQEA 1T3SA 1Z8DA 4OGFA 1QYVA 4XFDA 2V7EA 2AN1A 3ICWA 3CD6F 1H2EA 3FN4A 2B8TA 1QCZA 2QMUA 3M9XA 4I81A 5FP0A 3TW4A 4B6FA 2Y0PA 4F1KA 4CIWA 1SH7A 1ST2A 3KZKA 1XRMA 3L4SO 5FTNA 1L7OA 3ZBPA 1R4NB 2YDYA 1N6PA 1VG0B 3NNSA 2XCSB 5IAKA 1OILA 3OONA 3O9OA 1GV0A 4D8VA 4PGFA 2FI1A 1MX5A 1D2NA 4Z2WA 3CTMA 4PQRA 5CIQA 1QNFA 5JTUA 1GQOA 4WXMA 4BMPB 4U0JA 2PDAA 1M5IA 1WNTA 5EE3A 1DIBA 1G6HA 2B82A 1M90W 4RANA 1TYAE 4I46A 4QFMA 3HEBA 2X9NA 4OYYA 3UWDA 4UE6A 3RUPA 1OLXA 3B52X 2UYQA 4CXMA 5CX1A 4U7DA 1GQ2A 4BP1A 5HOEA 3FETA 5AM0A 3RVBA 2BSKB 4A4DA 4QPPA 4F12A 4YRMA 1FK8A 3FDIA 5HM6A 2Q5CA 3V4ZA 3P9CA 3CRNA 1P7GA 3DUFB 2QMHA 2ZAGA 2GKGA 1CR0A 3AG2B 2FLKA 2O07A 2Y27A 3ND8A 1RAEA 1JMYA 3A4NA 4IKPA 4PGGA 5CPBA 2YWGA 5K3FB 2PX2A 2IAFA 1TMKA 1WCIA 3PXXA 2V5UA 4NU5A 1XKXA 5CBHA 2P0AA 3C24A 2YZNA 1YCDA 3BDIA 4NZOA 3Q2OA 3WLOA 1WZUA 2WI8A 1E9BA 3IESA 4OF4A 2KTUA 5JZVA 4OSPA 1VI5A 3PT5A 2FLVA 2ETNA 1OKKD 3E9EA 2FH5B 4HX2A 5EXEA 1OE0A 3KB1A 5LZ8A 1KOLA 1NAHA 3DOCA 3BH7A 3CRCA 1NJ1A 2C9CA 4KE6A 5THQA 1OC2A 1T5OA 5FR2A 3VAAA 1ZH4A 3PIRA 4AIRA 3ZBTA 1WU7A 3VSAA 2QM4A 3VYTC 5TMDA 2RB5A 4ER5A 1N2EA 4JWKA 1BDMA 3K0CA 4DV1B 1C1XA 4G0OA 5LZ4A 2OBXA 5AI4A 1VG9B 3O8BA 1NM5C 4LRYA 1DF5A 1JFVA 4R0VA 4XQGA 1UJ4A 4RF2A 4CHGA 4DR6B 3JWIA 1I14A 4NBRA 1MAHA 3F6EX 4DM3A 3OC6A 5L6LB 2HMWA 1E5DA 3RYHA 1J0AA 1OX4A 3EARA 1IH8A 3DNMA 4MKXA 3T9AA 2L6LA 4YV0A 3SQWA 1QCDA 1JR9A 1RPOA 1L0BA 3AEUB 1EG2A 3WIDA 4QICA 2L35A 1KEEB 3W4JA 4BVAA 1Q0PA 5B30A 5CCBA 2AZMA 2LE0A 3BWVA 4KLCA 4LW8A 3L92A 2H08A 3PYXA 1DTWA 2HUNA 3JALB 2GK3A 4M0DA 1CR1A 3ZRVA 3IHWA 1ZH2A 3MOIA 4NY1A 1AK9A 2XAQA 1PHPA 2A9PA 1MNGA 2O05A 2QQEA 4WKGA 5F5NA 4IVPA 1V9SA 1COWD 1DJQA 3QFRA 2BFDB 3IX7A 3TAHA 4EUSA 1YTFB 5T7BA 1PP4A 3N53A 1W48A 2VXBA 1R0ZA 3MTJA 4JBWA 3OC0A 4RPKA 2R6HA 2YS8A 4RAQA 2NXWA 1AG9A 3AILA 1P1FA 3REOA 5DLYA 4DO2A 1XZGA 2IY8A 5C1IA 2Z6UA 4PRYA 3AT1A 4ENWA 1QRSA 2Z1EA 4J0EA 3SR3A 5TQ2A 1DGQA 1JSRA 4ZGWA 1NX6A 2Q1YA 1BE8A 1T9GR 2XQIA 4UNQA 4NG5A 3LLMA 4RL6A 3M6UA 3QVTA 1YDWA 4N49A 1FYWA 4YAFA 1M57B 3CCVV 4LH6A 1XX6A 1ZJJA 1YAJA 2GPYA 4J76A 4MRRA 1AO3A 2HHJA 2C54A 3D5TA 2Y99A 2WLIB 5DEIA 1G21A 1YT5A 1PR0A 4RQFA 3Q11A 4MULA 4XVRA 1A4XA 2GYUA 5CX4A 5EWMA 3TTSA 2C94A 4F8EA 3E15A 3L8YA 5ULLA 5I9MA 1GA4A 4M83A 1SFRA 1VJTA 1R0BA 4MROA 4RCVA 1NXOA 3EUAA 4QXQA 4C3OB 5LDHA 3AL0C 3DBRA 4FW9A 3C16C 2C7VA 3VZQA 4QUDA 4DDTA 3ZKWB 2QN8A 2VP2A 3MIIA 5A5EA 2RB4A 1ZCFA 4DW1A 2HHAA 4LC0A 1IK6A 2GKOA 4MB6A 3S29A 2W11A 5JC8A 2B8WA 2YDEA 1P77A 2E76B 2EX0A 3M5CA 4QGGA 3M8KA 1Z6XA 2VRCA 5DWQA 5HS4A 4J8PA 1SGWA 2RGAA 2IF2A 3I55F 1X7GA 2UYOA 3DXZA 5FWNA 2PV7A 2HSGA 3E9DA 4E2WA 3OLCX 2AF3C 4FMTA 2BT4A 4H1HA 2H9YA 4M22A 4TQDA 2WMOB 2DWOA 3MHTA 2JGRA 1PLKA 1HR0B 2GUGA 2JIZD 1NULA 3G0OA 5TMEA 3BH0A 1ULUA 3O4HA 1G8FA 2H9AA 2I8CA 4L9SA 1U0BB 4P7KA 1ANKA 2C2OA 4G0YA 1EB9A 1SCNE 4B3HA 2O14A 4ZT5A 5K3OA 4JI2B 3NMUC 3HWUA 1F38A 1QC5A 1YS7A 2W2VA 3FNFA 2HV9A 4JUDX 2DB3A 3OPQA 1LDBA 3MJFA 3D6MA 1PO7A 5K5EA 2XTAA 4J16C 1W5FA 5J4LA 4OHZA 3BHIA 4FZ0A 2H1OA 1CUIA 2GASA 1U9IA 3DBHA 4HH4A 5L7YA 3UTDA 4I50F 3DP9A 2BPOA 4EGQA 2DH5A 3ZUGA 5EWJA 4Q9JA 2JD0A 4C0WA 1IHOA 1HQDA 1Q0UA 4X94A 2XAHA 3IT0A 2XVXA 1EZVH 3T1HB 3GAZA 1ZRHA 3CLHA 1CSEE 5JJNB 3OZIA 1RXYA 2ZUFA 1QZXA 4G5SA 4UHJA 3MVEA 4J4HA 4RM3A 2GYVA 1ZGHA 2CTRA 3CCSV 2BGLA 2PSJA 2XA1A 2IEGA 4FWTA 1AJEA 1JDJA 1MPTA 4FUTA 1R37A 1ZKMA 4TTAA 3WNBA 1CP2A 4N39A 2C2MA 2EFCB 2QN2A 3HB9A 3LO8A 3JVDA 3HHPA 2ECOA 4R2LA 1MA3A 1S2DA 2FE4A 3IUNA 4F0JA 3QUAA 3W2TA 3C9TA 1E3SA 5DEDA 1F0PA 2R1TB 1DC6A 2BFDA 3F6PA 3OIUA 2B61A 4M0LA 2Y0BA 5DBOA 4CF4A 5HXAA 4BXOB 3WDKA 1IY8A 2FSHA 1J8MF 4RA9A 3MNFA 3X2SA 2PGJA 1AUVA 3C9UA 1YR3A 4NMLA 3NTLA 4GNKA 4IZOA 1N77A 3OT4A 4M1TA 3VU3A 1RSOB 1AHIA 5LP6B 2GVZC 3ITKA 1ZG3A 3FUXA 1KJ9A 1F0YA 2IJJA 2AL7A 5BPFA 1FXSA 2P6YA 4FDAA 4ESEA 1XOUA 3ORYA 2P67A 3K8ZA 3HUTA 2WKQA 4BZXA 2CV2A 2FEPA 1Y6XA 2HHCA 3QELB 3QW4B 1VHJA 3K9CA 1IY1A 4DQLA 5J23A 4I5GA 3RU9A 3BF7A 4J0QA 2IYOA 1QORA 3KOYA 3WI7A 3ZDYB 4I5FA 3HXPA 3IC9A 5DN9A 2NZYA 2VCEA 3H05A 5EYPB 1U2SA 4R2JA 4KOEC 4NJEB 1QIMA 1MMMA 4GP9A 3EIQA 2JJ1A 4WASA 3EB9A 3IPXA 4RGQA 5AXAA 3OH8A 4HBZA 3L6EA 1DAEA 2VLIA 3D3QA 4TKZA 1IBRA 4MGHA 2VCYA 3B6EA 1SWVA 3RUAA 2BHTA 5JDIC 5LQCA 4X90A 1E9DA 1PLJA 3MJCA 4ZVNA 3FB1A 3GJ5A 1WG8A 2ZGVA 5FHRA 2Y05A 2RCYA 2ASVA 3I9MA 3UC9A 1N2XA 4KDFA 1QQCA 1IXZA 2Q1SA 2WYIA 1OA0A 3EK2A 1HH4A 1MZVA 3CPQA 1YITV 3RC2A 4B3RB 2I7CA 1HNZO 4JVSB 1J5EO 4N65A 3MW8A 5J63A 2DM6A 2OPBA 5BWOA 1DEKA 2PPLA 2TYSB 4OVKA 5LM3A 3TECE 4JBIA 3U1BA 2P9TA 3VZBA 4BBZA 1Z0KA 3NWPA 4UM9D 1EK2A 5E6SB 1SESA 2FFJA 3LFOA 2ZBRA 5GV7A 2W70A 3W5UA 2QMOA 1PK9A 3OEHG 1XIVA 2P6PA 2W8BB 1AMOA 4L6CA 1EFVB 4J6EA 4ZYZA 1WA5A 1ATIA 3RVSA 3OJ0A 1L7QA 1UM9B 4UJ3A 3OU2A 4BEVA 1XKLA 4RWUA 2PMDA 1P1IA 4HJRA 2C7RA 1B8UA 2EHDA 2P4VA 4FS3A 1FXHA 4NB5A 2KGWA 2VUTA 3AUUA 1S9DA 4MKGA 5FUBA 3WNCA 1OWNA 4XSVA 3SXUB 2OCCC 4GBGA 1EMDA 2P2GA 2DKOA 3N74A 3CCLF 3RYIB 4C81A 2B99A 2XYPA 3NBKA 3NHLA 4L4ZA 4NYJR 1RZVA 2NSJA 1I4LD 1R9JA 4HMQA 3E3LA 3SEFA 4XBFA 4OXQA 2EIMC 4NEGA 1F9AA 3DKVA 3FWHA 1ZUD1 1T2FA 3NYQA 4DA6A 3U49A 1AM4D 1MDBA 1FRZA 4X66B 4N23A 2X9QA 4NBKA 3FTPA 1LSSA 4KWTA 3RKSA 3NBUA 4EHKA 3RIGA 1RT9A 4BB9A 1C9JA 1ZC4A 2DG2A 1ESNA 1Z5PA 3VPDA 4RE6A 1CZLA 1GGJA 2L69A 2VP0A 3AO0B 3IAYA 2QTZA 2Z5GA 4GGMX 4Y2YA 1JRLA 4L87A 3S3WA 1E64A 1UM8A 2XE4A 5AVKA 1E79G 4BQPA 2TS1A 3BAAA 5JPCA 3HKEB 4WFGA 1BS9A 4UNSA 4ASUA 3KETA 1C3VA 2P06A 2EFJA 1AO0A 1U6JA 2FEXA 1D2MA 4JZYA 4N3CA 1FFBA 5AW9A 2VJAA 4HB2A 1TJYA 4MX8A 3O94A 5LYJB 3I1FA 4XR9A 1DAKA 2XQKA 3NBQA 5B1YA 5CFQA 4EHJA 3QOFA 2CH7A 2FPKA 4L4XA 4D5GA 1FDTA 4Q7KA 3CKKA 1BW9B 4GLOA 2D0DA 4A6EA 2WTAA 1J9EA 3DD1A 2R8RA 3H1FA 5DISB 5GWXA 2WV9A 1YQTA 2DLCX 3LVRE 5JMPA 2GDJA 2P75A 2B3DA 4FKMA 3LHKA 1PP9H 4LC1A 1JIIA 4MWOA 4DLSA 5FOSA 2CJFA 1XU9A 3B6IA 1H3FA 1N5RA 2GEJA 3DJYA 3ZY2A 2JFVA 1SUSA 2Z5FA 3ZXYA 1RW4A 3EEBA 8GPBA 3TD5A 5KQMA 2HPAA 1Z4KA 2FMLA 2WILA 3KXKA 1MFPA 1HLGA 3BRCA 1GU1A 4IDAA 3RHSA 3SX4A 5LZ9A 1QH1B 3H2IA 3UYKA 3T15A 2JD2A 1EHYA 1K0UA 4YJHA 3SVTA 3R0VA 3ZJZA 1QGUB 1R1DA 3PTZA 4PSUA 1GEGA 2HA0A 3E9NA 4OJQA 1EQAA 1EFLA 3UJ9A 4C87A 4AIIA 4ZI7B 1MPXA 1VE3A 4XGIA 2KWIA 4KN8A 4WNAB 3Q7TA 1H2NA 3HUEA 1NVGA 1O96B 1WQ4A 5E8RA 2LV8A 4PCVA 3BGOS 1ZXLA 3IOEA 4DW8A 1Q16A 2UU9B 1Z8HA 3I2IA 1QE3A 1YQXA 1I2DA 2VNIA 1IBMO 5MN6A 2AXNA 4YGXB 3UEOA 1RHUA 2R6FA 3SYNA 1A1SA 3C8UA 4LZJA 1LPPA 4Z9AA 3ZE8A 4E15A 4P0PB 4NNPA 4I9WA 1U9ZA 4NQRA 5AQEA 4XRGA 3AEQB 4TV9A 5BUSA 1IDSA 3Q6IA 5SZJA 2VHUA 2CW4A 1JR3D 3T8YA 2GZ3A 5KYXB 2DN9A 1FNNA 4KRYA 4B3MO 2X8BA 4MUYA 1LK0A 1IVYA 4M8NE 1G3RA 1QH8A 1R3JC 3RRBA 3FAVA 4QJFB 3R3XA 4Z7OB 4CKZA 3VFDA 1KE1A 2WUWE 4KHZA 3EODA 3PK0A 3R44A 4V3CA 1DHTA 1DAOA 2AOTA 1GTMA 2Q6KA 2R2GA 3MWEA 4MTLA 4LYJA 5AKGA 4CHTA 2FN7A 2X9LA 1J2UA 2IXAA 1GAJA 3W79A 4X95A 4BO4A 1MRNA 1L4GA 1F12A 2OEPA 1O3YA 4L2IA 1G59A 5FNVB 1HE8B 2QG9A 2Q8PA 1E77A 1COWG 4HYYA 5JQGF 4O2AB 1MG0A 4HVTA 1T2UA 2QXYA 3T1YO 1Z16A 2R00C 4K5QA 3S68A 2VSOA 3GIDA 4NX2A 1U80A 3ZWWA 3LKDA 2XA9A 4BV9A 1X7YA 2VJOA 4I1RA 4XGKA 4GSLA 4IV5A 5JJ5A 4IT5A 4L8WB 3TUIC 2AYXA 5J2TB 2HT6A 3TDKA 4IKOA 2C1ZA 4B3BA 2QE6A 1PVOA 3CF2A 1A0OA 2XW6A 4ZVKA 1RM1B 2XCIA 2ZXUA 3K4QA 4O59O 1U2EA 4DLUA 4RYLA 4LSZA 1AE1A 1LPBB 2HWKA 3H65A 3IEXA 4F11A 1U0OC 2D2VA 3KS9A 3VR2D 4DMKA 1XREA 4WXHA 5AVYA 1L5RA 5DHSA 3UMCA 4DQVA 3FPLA 4EGFA 4QPNA 5E4FA 1Q6UA 3OMNB 5KDLA 4BFZA 4UCVA 3SM9A 3USES 1FFDA 3W77A 4UZEA 3D3JA 3MJSA 4TQFA 4K0KB 4WADA 5FJJA 1IEQA 1L5SA 2R6AA 3LA8A 3ONEA 1D9XA 3JWEA 2HYIC 3RK1A 1MO5A 2ZKLA 3I5YA 5TGTA 3ASYA 2FWMX 4X8LA 3UN1A 3V8RA 1TDJA 2CJYA 3CJHB 4DDVA 3K06A 2EKLA 3ELYA 5CVDA 3GB9A 4JKIA 3S2GA 3SF8A 4C6RA 2WR8A 1CTQA 2SICE 3WPXA 2G25A 5BY2A 4BY9E 4CEHA 5JJJB 1PWXA 1TVMA 2ENUA 2D7CA 3UK7A 3WMWA 4C78A 4RADA 1PW5A 1YJWF 1LUAA 2KMLA 2WJZB 3O9MA 1KJNA 3UICA 2ZBUA 1NU6A 3RTBA 3W5JA 1Z7EA 2LO1A 4E1VA 4YX9A 2VP4A 1ID8A 2ERCA 1HLFA 3GRFA 1ZIPA 3A9CA 3S5UA 3X43A 3HKEA 1XZJA 3ZH9B 4EG6A 3GHZA 1NLUA 2BW0A 1U3LA 2HKOA 5E9WA 3Q4HB 1XDUA 2I6UA 2WUFA 3T3IA 1O6ZA 3R7NA 1P9NA 2P2CA 3QWHA 1KU6A 3A2MA 3KXDA 4HZGA 2A0XA 1M2HA 3TI7A 1N78A 3IQGX 5LBIA 2DFPA 1TM7E 4K9QA 3VR5H 1EXWA 3B9BA 4LXIA 1GLVA 3ROGA 4YMSA 4RQBA 3K72B 3QHAA 2AEEA 4DLWA 4EMSA 1C9KA 1RLIA 5T64A 4Y9DA 4TLLB 4HPJB 3QE3A 2OFFA 3VGJA 2HLDG 5C32A 4Z1MA 3WTCA 4BNJA 6REQB 1PWHA 3PE4A 4JI8B 1Q74A 3WXBA 1RXSA 4HGYA 1M1ZA 4QJ3A 5K2OA 3K2XA 3S06A 4GI5A 1UDXA 4PSKA 3L0DA 3NWJA 1P44A 3QITA 1FQWA 2IXFA 3L5OA 1PF5A 2EW2A 1LU9A 4QLBA 4ACAA 3OFNG 3ABLC 2FQXA 2FW6A 1FRQA 2H2WA 2H16A 4BE9A 1GYRA 3P0ZA 1DRWA 1WP4A 4EY3A 3P19A 4MW2A 4BVTA 4QOJA 3VNQA 2PHNA 5C35A 4MW6A 2FUCA 3GJ3A 1ESMA 2CGOA 3FFMA 1YMQA 5FAXA 3MCUA 1P3JA 2A0FA 3CX4A 5ER6A 3ET5A 1CVRA 1JZQA 2LCFA 4XM2A 4CUZA 2I66A 1KB9F 2OO7A 4UUJC 3M3PA 4D81A 5HHTA 3QMVA 4DXAA 3RIXA 1QH0A 4Y2UA 3LYUA 2CSUA 2IP1A 2Q4EA 3LCRA 4NP6A 5E7JA 4E4EA 3E83A 1ZKDA 4K9PA 4H1UA 2O0LA 2W0XA 1JIQA 4XWKA 2I4IA 5K8TA 4YJ2A 3EZ7A 4IGKA 4ALMA 2GJ8A 4G5GA 2RBEA 4LCUC 3K6SB 1YXMA 2IELA 1P4SA 4GMFA 3HJFA 3QXHA 1RPTA 2AG5A 3WNQA 1O4VA 2W48A 4IGFA 4FT2A 2QB5A 1I5RA 3R6DA 3SQDA 4LGVA 1I01A 3BZUA 3VGPA 5IZCC 3ZEDA 4GX5A 4LEIA 4UD6A 4A5OA 3R6TA 4CPDA 3IJ4A 4TWIA 2A0KA 1ZSNA 4DRXB 2BRUC 4I36A 1KKLA 2P6NA 4MW0A 4J80A 1V6SA 5J47A 1AN0A 1OYOA 3PJRA 4B43A 3SIUA 1O77A 3RVZA 3FDXA 3MS4A 4H7JA 5T4FA 2C2ZA 4BUZA 5HK8A 5BYKA 4C08A 4UEJA 3EA5A 1VL6A 5E38A 4CDMA 4BAGA 3LAWA 2HCBA 3FNBA 1TF5A 3AB3A 3LU1A 1U7PA 1ZHHA 3D2LA 2V9YA 5C1BA 1E9EA 5C5IA 3F73A 1VZ2A 3RYIA 3A04A 3QEOA 3SJZA 4ZKDA 2DPLA 3IC5A 3ZXUB 4GBJA 1ODIA 2OZBA 3ZZTA 2RHLA 4O2AF 4UBKA 1R6KA 5FV4A 2Y77A 3NWEA 3PUWA 4I7ZB 2WDZA 5LMZA 4I3FA 1P18A 1X7YB 2H00A 3ND9A 1G3UA 3KJHA 5JPDA 1TA8A 2WSSA 3OPXA 3SGIA 1E6LA 1JKIA 1HYHA 2FFHA 1XTUA 3KVVA 5EEGA 2PJZA 1JIVA 4J7ZA 1QHGA 4G4VA 1L1FA 3VYVA 3LWRC 1YRYE 1P31A 3IRVA 1NUAA 4CKWA 1DRVA 2H4XA 2IZOA 2YY5A 2EF1A 3F47A 3PL5A 4HF7A 4I8IA 3A32A 4NZMA 4B34A 3MFYA 4U8HA 5DHRA 2G77B 4URYR 3WLNA 1H4VB 1U8XX 3ASNB 1X8KA 4FOPA 1XNHA 3DBOB 4ZU1X 4YIPA 1E4YA 4GR5A 4YS6A 4E2FA 1QU3A 2JAXA 1E1CA 2JBAA 4KPYA 3GC6A 1OKKA 1F2DA 3R0XA 4DIDA 1YXBA 4IPTA 3VA7A 4NECA 2TMDA 4FLYA 2HF9A 4F45A 2PX4A 1U3PA 2FSUA 3O6VA 3ERNA 2HREA 3EUWA 2QE7D 3VTKA 5I7HA 1MSWD 2G9QA 1YE8A 4HB3A 1J8DA 2TECE 1XNGA 2ZRFA 3IDFA 4HO1X 4KN6A 5I51A 1TAUA 2B37A 5I7WA 2C2KA 2F2TA 1FYDA 1K7SN 3IP5A 4NBUA 2X6BA 1UXHA 2G36A 4G63A 4TT3A 4YT4A 3MCTA 3R9WA 1O54A 4BN4A 3QEKA 4JBGA 1V8FA 4YRNA 3QVXA 7REQB 5CM9C 5KQSA 2Q6IA 2EATA 1NZDA 2D59A 1J70A 4FXOA 1I5OA 1D8AA 3OM3B 2EVWX 3ONNA 3PUIA 3UKDA 5LSAA 4MQBA 1U9JA 2PRYA 4ZVMA 1G8HA 2RG7A 5T6MA 3CM0A 4K6HA 3JZIA 3TIGA 1CVIA 4LXGA 1GPAA 1QYCA 1UPAA 3D3EA 5JI2E 3T7KA 1QGUA 5ADUS 1KKCA 4OHUA 3A9VA 3CJRA 3JSLA 3RFUA 4M1WA 4ER3A 5DE3A 3UFXA 1US8B 4CMHA 1JOYA 1QTNA 2HCFA 3AFGA 4MV5A 3VOUA 1F17A 2P90A 5IKOA 1D3AA 4ERNA 3MPUA 3G2PA 1DFIA 1BA2A 5B2ZA 1OYWA 3HCPA 1A9PA 2QYOA 2QTCA 3UT6A 3WHIA 4YCLA 2CJWA 5DLPA 2NAFA 4IH4A 3T7TA 4CTKA 3KKMA 2ZVPX 1KI9A 2IV7A 2FSSA 5C7LO 3LP6A 3QLVA 3S55A 1PR1A 5K8CA 3R0JA 2C7GA 3LNMB 1D2EA 3OICA 1FP7A 3ZKWA 1C30B 3VYSB 2QWOB 2K4MA 1X1SA 1JEYA 2A0YA 4NMHA 1E7WA 1VL2A 1MH9A 3UZUA 4FHGA 3ZHYA 2XOKG 1SZDA 4ZFNA 3H18A 3TG8A 3PXEA 5CFNA 2YHSA 1KGDA 1QQ7A 1WDTA 3PFNA 3B53X 3VDRA 4M4SA 3TKAA 2F9ZC 4RAOA 3IE1A 1YFLA 4MQEA 1W9MA 1WSAA 4IILA 3VDMA 1FEZA 4ZKIA 3CWCA 4WCFB 1U6KA 3WLMA 2ZYVX 1P2BA 5MGNA 3LPLA 2N05A 4PHHA 2JIMA 1KBZA 3CVXA 2F55A 5F2KA 1L7MA 4OUKX 1NBIA 1G9SA 2MHCA 2GA8A 3MMSA 4WKBA 3E81A 2RKWA 1JPXA 3D59A 3UKMA 1DK1A 4J3NA 3LPMA 1NFRA 3EVNA 3KPJA 3ORSA 2CDYA 1HL3A 1T15A 3X3HA 1DTOA 3ZHRA 1J24A 2NPOA 2PL3A 3UUFA 2RH4A 1H05A 2CUZA 3QG5A 3SIXA 3KZNA 3TMYA 3LLVA 5FBLB 3S2ZA 3WL8A 1L5FA 2LFRA 3M82A 1YQUA 3JVIA 1FFCA 2QVYX 4YUYA 4R9NA 3RVQA 4H0NA 5IHXA 5IKXA 5KVCA 1ESZA 5E7IA 1PYDA 4G4SO 1DTWB 4INOA 3ZMVA 1SCBA 2VK1A 4PFJA 1K86A 1NBOA 2B4TO 1C50A 3AFOA 1IU9A 3L7CA 4W99A 4YJ3F 5C3UA 1A95A 4UQOA 5TXGA 3R8XA 1EUCB 4O25A 4JL6A 1U3FA 1JBQA 3HVIA 2IH3C 3OUTA 4WZAB 1UC8A 4WNCA 2NU8A 4DIEA 1LDMA 1Y5IA 1A2KC 2CHTA 4LF4O 5ADVA 5HJEA 3KE1A 4LVOA 4Y2GA 5FI3A 3KRTA 5ITVA 3BCUA 4KREA 4H27A 4C1BA 4KAAA 4GT1A 3NRCA 3W9YA 1C9EA 2ZJFA 3K31A 1IONA 1A9RA 1GM9A 1D2GA 2AVDA 3ZY3A 1E2DA 3WO1A 3GCXA 3ZKAA 4AZTA 1WAMA 4I9GA 4AF7A 4JLOA 5LU9A 3TR0A 3W06A 4W7SA 2Q9LA 4N01A 3QNWA 5F7ZA 3WL7A 2X6QA 3LBAA 1M0WA 1XL1A 2B2XA 1ZW6A 2FG6C 2YZKA 3H0EA 3N0VA 4HX9A 1J42A 2GFQA 4OBXA 4JY7A 1XE3A 1L4HA 2WLIA 1N1EA 3PQEA 4M9SA 5FIUA 2BBWA 4ENPA 1E5TA 2ZE7A 1UOOA 2RDMA 2WFMA 4ZCPA 1CETA 4MVWA 3A6KA 4MGZR 3TOZA 3N87A 5ALJA 1VJ5A 2FP3A 2INGX 2R96A 5JECA 1P6QA 2OHXA 3HVRA 1BSMA 4W9NC 3SVZA 2GAAA 1JEYB 4IQ8A 2ZT8A 1H0SA 1HFWA 5EE1A 4RDXA 4C0SA 3ANYB 3I39X 4FVTA 1UPTA 2Z3YA 2P5TB 4MRSA 1JJBA 3HDQA 2EGGA 2QLNA 4NENA 2GEDA 3RC1A 3SC4A 3WBKA 3QKSB 1IIRA 2UUAB 3VOBA 1UK6A 2Q1XA 2ID8A 1P3Y1 2IPMA 3N8KA 4G9BA 1GIAA 1WMDA 2X0RA 3PQ5A 4NYMR 5D1NA 5H83A 2RHBA 4C8GA 2G80A 1X9GA 1BGWA 1J25A 3FZEA 5DV9A 2X0EA 1QANA 3OCWA 4LJ6A 1D2HA 4I4IA 4X8HA 1U65A 1ISSA 2ZRPA 6GPBA 1W46A 1ND5A 1V16A 5EAZA 1ZESA 3C97A 4R2IA 5F1PA 1Y3HA 5BSUA 1COZA 3K9LA 3Q7RA 3ZZUA 1DAIA 3K1AA 4FTWA 1P0IA 3D4BA 3DFKA 3IV7A 5ICMA 1WMBA 4EAQA 2JCGA 2Y9MB 5FBZA 3RF7A 1R4NA 5JRDS 3PXCX 3SYMA 1JJ7A 5DCWA 1QMPA 1GN4A 1EXNA 3I09A 4JK3A 4BLPA 4EO7A 2GBFA 2D2CB 2NLJC 2X4LA 3DV2A 5FL7G 4Q1CA 2I67A 2XRMA 2OXTA 1ABFA 2CTWA 3O4GA 1QK4A 1RHKA 5A3JA 4XUGB 1HA3A 2V6MA 2PVPA 1O87A 1M73E 3B1VA 4KZPA 1X92A 5CVVA 1C14A 2YIBD 2YJ3A 4ENTA 3FOEC 3U10A 1S0VA 1NTMH 1BO6A 5HZMA 5IRCD 3KPUA 4EENA 2QI9F 4GECA 4JLKA 1C8VB 2YEVA 1M2EA 2C3UA 2IUTA 4PLFA 4URUR 3URMA 3LDTA 4BX9A 3QPVA 4MAAA 4RHXA 1IIBA 1TK3A 3DOHA 4FFNA 5EP4A 3UG7A 1GV1A 2W2LA 3EG5A 3S3XA 3GRUA 3W0LB 1Q81W 2RBKA 4RVUA 2BE3A 1ACJA 5CDFA 4TYNA 2AI3A 3RBVA 3LSUA 2EJVA 4NV0A 4JBHA 4D1YA 1U7DA 5BRNA 1K06A 1KZ7B 2HBYA 3FAKA 4HOYA 3ZDFA 5FEUA 1GTOA 1NSYA 2GCOA 3DUFA 2QN7A 1WUHS 3GA7A 3MJTA 4FCWA 2X9GA 4IQFA 2OYRA 4JR2A 1K88A 2EFEB 1TEVA 4X62B 3FZNA 3SU8A 3WIEA 3L73H 4FEAA 2N1BA 2Y67A 2P78A 3HS3A 5DI3A 2X6CA 5DDIP 3QMPA 1DC4A 2RMKA 1Q15A 4CLEA 2WLNA 2BKUA 3K1YA 2CNWA 3VO9A 3ABMB 3ZRWB 2RGWA 4RGVA 4X91A 2WAMA 5FPRA 4BKRA 1CZRA 3GXBA 1A8QA 1O1YA 3MB8A 1ZVVA 3LY8A 1JKFA 4ZXPA 5M5BA 4PS1A 4X1YA 4R1SA 1V96A 5J2UF 1T1GA 2Q69A 2Q3MA 2W83A 5J9FA 4BVQA 5LDDC 2JGFA 2CMFA 4P36A 2OTMA 2XNSA 4GWLA 1SD5A 3C4QA 2VN8A 3O26A 3ZTWA 2DWUA 2WU8A 2X4DA 3IJEB 4JNCA 1QLEB 5FWYA 3E4CA 5LP6C 3K2QA 3G6BA 4YMVA 4JI7B 4UPEA 1OI7A 2QE7G 5BZBA 1KHTA 2Y1GA 1VQ6V 1J90A 1IMOA 1CC1S 3G5LA 4KN5A 4PIPA 3ORRA 1AZTA 4XARA 2GCNA 4BLUA 2YUAA 3OTOO 1NMSA 2BCCH 1C7QA 3W5DA 3RSHA 5P21A 4DCVA 4M7OA 4YXWD 2WKSA 4G89A 1CT9A 3L72H 1R0KA 5ECYA 1Z0FA 1BKDR 4ZRMA 3I55V 1Y66A 2I1QA 1K6IA 1H0KA 2P9GA 1SULA 3VPCA 4PLHA 4M8IA 1SUFA 4WY5A 3B5JA 4BS9A 2GAJA 4Q5IA 4QOSA 2DFTA 3CCVF 1G16A 3MMPA 5FPPA 2A84A 5JLAA 4HDRA 3CWBH 2PCLA 3N2KB 3KYBA 4OL9A 4N5MA 3K20A 2X6TA 4DDUA 4CF7A 1YR6A 5ICGA 5KCZA 4MJLA 2KG7B 1N5JA 3QYPA 2GTSA 4DLTA 4XDYA 3C3TA 2E1RA 2GGSA 2QAGC 1HDIA 3NXKA 4MARA 1Y9JA 2LW7A 2FW8A 1OMOA 1KFCB 3KEFA 4HUQA 1OCOB 1BH2A 4X64O 4TS9A 5DSZA 3VO2A 5AKKA 4CTMA 2XZDA 3BBLA 4WXPA 4ZA2A 2D1RA 1M2VA 5DYNA 4TMXA 4OKSA 3TYXA 3TPFA 4HDCA 3SI7A 2DMXA 5CG1A 4LBYA 4V24A 4QAQA 4HNUA 1NUUA 1NIPA 3SM3A 2QG6A 4N0DA 1XL4A 1HQKA 1T4DA 2X76A 3BYZA 3ME5A 4Y6LA 2IY9A 3SC2A 4BT2A 4IYHA 1RYEA 4QHSA 3OCJA 5E6RB 3SXJA 2ZF8A 1TKAA 2C4KA 4L8YA 4ML3A 2HRRA 3U7IA 5AI6A 3I72A 4Y7CA 4B46A 2E3CA 2XE8A 4CG0A 2OM6A 3STXA 3B51X 4U2DA 4IIUA 4GC5A 1F4LA 2OFXA 1CR2A 2QX7A 3VHXB 3NR7A 4X1IA 4HDNB 3ZWMA 2BMDA 1E1RG 3EC2A 3RFFA 2R85A 3TRFA 4GKAA 1CEZA 4BWVA 5JXHA 2HP0A 3P3PA 1V8DA 5G4KB 2CEAA 3WLRA 2XV1A 2OTLV 4X93A 5B3LA 2B2NA 1N4AA 1RCUA 2QZPA 5H82A 3VPFA 1E99A 4YMTA 5KNCH 1SG9A 1XJQA 3O8RA 1A7JA 2LFSA 3EIEA 3IO3A 3ZE1B 4A5SA 1B23P 2XI4A 2NZWA 5D87A 3BEDA 3C3DA 3BGSA 3PENA 4G37A 1YL7A 4FZ5A 2XYRA 4W7HA 3O4RA 4COOA 1JDUA 1KY3A 4PSAA 3C7CB 3PCTA 1TFRA 3E9ZA 1AI6A 2QUZA 4ZREA 4B3TB 1M74A 5ALWA 3LY5A 4RPJA 4YAUA 4I1YA 1TUIA 3QK7A 3QJYA 2DOSA 4R2XA 3OBBA 2Y2UA 3T9BA 1O0CA 1FYVA 1PNQA 1YA8A 4KQ6A 2YWRA 1HOTA 2BFBB 3N2YA 5IJAA 5HKLA 3AVVA 3R6WA 3OJEA 4TOIA 4QNNA 3UM7A 3ZI0A 2REBA 1TU3A 4B3SB 2AFHE 2G9ZA 2QKYA 3GEEA 1QZUA 3PITA 3D6NB 1L8OA 1PJCA 1X1RA 3KL4A 3ONFA 5DGDA 4D92A 1SQGA 5JVDA 1AU9A 4NEQA 3SF8B 4B1FA 1Q82W 2W0MA 4EEKA 4QODA 1XBLA 5EI5A 3UGJA 1SA0B 4UCTA 1ULAA 5ALXA 2IS6A 5BWNA 1OWPA 3EFFK 2K1EA 4BO5A 1RJGA 3RF6A 5FWXB 1MT3A 3JQCA 4A0SA 4E4RA 3NAGA 5ESWA 4MP3A 3CSDA 1WOMA 1YFKA 1FMLA 5IT9M 1GGVA 4MLZA 2FMIA 4EKYA 4EJFA 3LHFA 4UHKA 3LPNA 1YIDA 4NV1A 2DHEA 3BG5A 4MPJA 2HI0A 4R8KA 5ES3A 4ZO8A 1Q0LA 3KWLA 3EY4A 3HUDA 4F7WA 1Q7YH 4YV7A 1EXMA 2V9CA 4BP8A 3WV4A 4AYXA 1Y7HA 2PUJA 3OZFA 1G98A 5BW6B 4I3HA 5J5VA 4BX8A 3FI9A 3N2LA 3FSEA 2BHSA 3ODGA 2FPSA 3TLBA 4Y2PA 4BU1A 3COWA 2FQYA 5FF9A 2ZNIA 4Q4DA 3NHBA 2VQFB 3MGKA 4DS3A 1H8HG 3TNFA 2ZTUA 1IHYA 2VRCD 1OA1A 1EJ6A 2WWWA 2J6CA 2O8BA 2CHSA 1GCIA 3UMRA 2F3QA 4QOIA 3RUCA 1IUKA 3GP8A 4JUAA 2AMJA 5AW3A 5IEJA 1KBHA 3C3YA 4FYXA 4K9NA 5CT9A 1ORHA 2XUQA 3VU8A 1YS1X 2I4LA 2V7UA 4J2HA 4RF5A 1K5DA 2IUEA 2ZIWB 5DRTA 2PLFA 2PYZA 1IURA 3IAFA 1BWPA 1Z5VA 1IATA 2VDOB 3AJDA 2HS0A 3HB1A 3PHIA 4FONA 4MVJD 4TKMA 1WM1A 1G5TA 5KX5B 1YS6A 1ZUWA 4EBFA 4HLDA 1C4XA 3NHMA 1CUFA 2F3RA 2GB4A 3DTTA 1SIOA 4WACA 3SJCA 3FYUC 4CMEA 5I4KA 5H3CA 2AOTB 13PKA 2WOOA 1ZUHA 4D4KA 3MHHC 5K0JA 1XAJA 3QEMB 5DNDA 1RYFA 4MYSA 3H0CA 4UCSA 1N8TA 4ZRDA 2ZIXB 1E66A 4YLEA 2C8LA 1JH8A 1XMVA 4XEUA 4C5AA 3BGWA 4MV4A 3ABIA 4GX2A 2Q2QA 1GTJ1 4MQFB 5IH7A 1KVSA 1PJQA 2NMUA 3HWX1 5J2TF 4ES6A 5C7YA 3QW2A 1PR4A 3CF6R 4HAUA 2H7YA 3V7QA 4WK6A 4MQ6A 2BONA 1G1MA 4YJ3A 2IOYA 3L4JA 2FX5A 1KRWA 4I4TF 5JSHA 4E6PA 3GVHA 3ZY4A 3OPMA 4PPQA 5G0SA 2QT9A 2C9YA 2C3OA 2FOLA 4EZBA 3FWNA 2O8CA 4Z1MG 3K08A 2FQWA 1QLHA 2X7JA 1SUIA 1IZ9A 1UPUA 2IF0A 1JVNA 3AF5A 2EWCA 3Q3HA 3R6LA 3P4YA 4F9TA 4CH4A 1U0EA 1AS0A 2PKEA 3T35A 2K9PA 5TV2A 5BWMA 4AUMA 5I7UA 3HYNA 4BO9A 2OVBA 4UCWA 3WGLA 2I22A 2VHEA 1K6XA 2VP5A 4JAVA 1TEHA 4MVXA 5EJ7A 3GO4A 2QU7A 3CSUA 4IRUB 4ZV9A 4TMTA 3ECCA 5DP2A 1L4KA 3WXMA 3ZNNA 2CCGA 1FS5A 3WOHA 1NQTA 1VLHA 1HYBA 1T9KA 2BFNA 4ZZ0A 1B3RA 4GWGA 4MUGA 2V7WA 3SQNA 1CUGA 1W47A 3PQ2A 4OK3A 1DEHA 4E21A 4MK4A 3FX2A 4U9IS 3W7WA 5DOZA 4X3MA 3R09A 4LAFA 3VNSA 3U56A 1YZQA 5K51A 4QLAA 2IJIA 1V5FA 1ZM7A 1MKYA 2B78A 2OCDA 1BJRE 5DLEA 3DOOA 4KVAA 5KNDD 1SZQA 3UO8B 4Q1AA 2BFWA 1OT3A 5B58C 3H1EA 1AI5A 3ETJA 3HUUA 4EHHA 5EKUA 3I9FA 5I45A 1EWQA 4ZAGA 1R8YA 4JJGA 4GOXA 1OZHA 1T0JB 4YI3A 2IYZA 2JVKA 3TFWA 4DUGD 2PRZA 1Q95A 1YVPA 2BJVA 2X22A 2ZS8A 2VTBB 1JHVA 4KR6A 2H1HA 1GDHA 3ADDA 1GLGA 3EIOA 4BATA 2JEOA 3DFZA 1CV2A 3DOIA 5EQFA 1MV8A 1NI3A 2X1MA 1ZJ4A 5E1BA 3VYUB 4ETIA 4H6XA 5CJJA 4PM4A 2Z6AA 2JGDB 1LCIA 3BT7A 1P33A 3K35A 4ZEMA 2FGJA 1VE9A 4OHFA 2FWAA 3TNYA 2HU8A 1DI0A 4MV1A 5D1HA 4FFBB 2CHVA 2UXBB 1OVGA 1T5SA 1XWIA 1LVGA 3QKRB 4HAOA 3FWYA 4JBLA 4MDFA 1WTAA 5KLVH 2Q28A 3NK7A 1LZLA 2VNHA 3LG2A 4L76A 4ANFA 4US1R 4NCBA 5H81A 1C3LA 5A04A 1T5HX 2J9GA 4NMXB 3CCBA 4P5DA 2AK3A 5A71A 3HGMA 2OV6A 3A3PA 4HDKA 2AGAA 1STOA 5DGTA 4X9QA 1M75A 5FADA 4CGYA 4EZEA 3UXEA 2I3DA 3KELA 2FN9A 1R4MB 4UBLA 4MW4A 1THGA 2PANA 3H7IA 5M2QA 1Y4ZA 3B6KA 2QTVA 1CIVA 5KUKA 1KJYA 2J3QA 3GLRA 1KOFA 3A6JA 1O6BA 2RJNA 4KH1A 5AVJA 4AY3A 2WOJA 4U6QA 1YIJV 3HJAA 4BYGA 1RAFA 1MOFA 4WFJA 3KOZA 1B93A 4CCWA 2GZLA 1JLLB 4AURA 3MLEA 5U9CA 1TYBE 2PUAA 1BMFD 2IKQA 2C4UA 1OZ0A 3UGQA 1FUUA 1K1EA 2NU6B 4NS4A 1G38A 4G81A 1XALA 2WYHA 4JEIA 5TPWA 2Q5OA 2QD2A 2Y9PB 3GFFA 2GEBA 3H8WA 3TQTA 1XZHA 3M1IA 4IHQA 4JJEA 3QU9A 2B83A 5TQ0B 3RSCA 2FSIA 1T36B 1PT5A 4RSMA 2GEFA 2HQOA 2WVHA 2FEOA 5EB1B 1CUAA 1LBQA 1VXRA 2X4IA 3KV1A 1Y1RA 1D7AA 1S2LA 2Y76A 3KAQA 1Z22A 3M9LA 1TYZA 4MVJF 5IU6A 3E1YA 2HHHO 5DLDA 3M99B 1KNQA 4IYIA 1QZTA 1CZKA 1AKWA 3K59A 4QGPA 1CHNA 1N1GA 1KR5A 1WTCA 2FY8A 2NW6A 2PKQO 2WJIA 2ODAA 3HDYA 3N59A 4RQEA 3OKCA 1ZISA 1ARZA 2DBRA 1OAAA 1QR6A 2OHVA 4TXJA 4D98A 5CA0F 3ABSB 3TOSA 3W8NA 1W5SA 1JMVA 1DLIA 5JEDA 4KNWA 1LNSA 3ROPA 3KYCA 2EIJC 4BQRA 3FUCA 4CCYA 3O9ZA 1S5PA 3ZQKA 4RUFA 2BISA 2BVNA 3F5WC 5EZYB 2IHYA 4BPBA 1QX3A 3BKWA 3GUUA 4MUNA 2L19A 2Q3DA 2Q5QA 3ESAA 4J75A 4MYUA 4PEVA 4PGAA 1G7CA 4GH5A 2H8PC 1GDDA 2OXIA 1LPMA 1N8NA 2G9UA 1BJTA 4HDMB 2ZIAA 2OAGA 4ZOAA 4YXWA 3WWYA 3HJRA 3P7MA 4E09A 5JXJA 1A1VA 3NPAA 3L4BA 3OX3A 2W2PA 2Z56A 4MRAA 3HXMA 1WABA 4ZDKA 2X0FA 3HB5X 1H0HA 4GPAA 1AA9A 5JXIA 1TU4A 2J3EA 3PR2B 4MVRA 3LF2A 1RBZA 1OXKB 3KE9A 3Q5DA 1XVLA 1H23A 1DG3A 1OLUB 2IVFA 3GZNA 3JQFC 4OMFG 4RY0A 4TMZA 1NASA 2O5CA 5LHGA 2C5AA 3G02A 3V7UA 4OXKA 4U7WA 4I5DA 1W4CA 3CRQA 2UYJA 2Z4SA 2J6HA 3C8MA 3CN7A 1PV4A 1J39A 2PNJA 3ZQJA 2ZSEA 3JAKB 3N0WA 2W6OA 3SDSA 1TKCA 1BZKA 1VQOF 3TB4A 3B78A 4WRRA 5DYIA 2WHYA 1C3JA 1VSTA 2ET6A 2VK4A 5KWSA 4L3WA 4JBYA 2RE8A 4NG4A 1R7RA 1RVDA 1RQGA 3PNYA 1GPUA 3Q9NA 2YYZA 3AESA 1V26A 3ORQA 4QTUB 3ZRSA 3JQ8A 3N3AC 3PVCA 4GKVA 3PC2A 1RNLA 1SETA 4IGAA 3SG0A 2QE7A 1XZAA 3OO0A 4G0NA 1E58A 1G0NA 2SKDA 3A70A 3TNDA 1HDYA 1A98A 1AZLA 4FD2A 4RXTA 1XTKA 1XZMA 3BTUA 4UDYX 2HGZA 1E2EA 3F4LA 4FGZA 4QL3A 1P0MA 2MMGA 4EFDA 4JV5O 1ZD8A 5JHGB 5L4NA 3WIBA 3W5HA 4Q1BA 3KBOA 1W5AA 3JRXA 1KBQA 1KFEB 2FQQA 4P9PA 1HTBA 3GWGA 4XTCS 3SS8A 4Q3KA 1CVLA 3F6RA 4KSCA 2WLHA 4R54A 4EEZA 1JD1A 3ZR4B 3CVUA 3G6EF 2Z3WA 3LDCA 2A8YA 3DXFA 4OQZA 2QLTA 4DLNA 4DSNA 2ZW9A 1GARA 1L1EA 2GARA 3CINA 2IQQA 1IUOA 5GONF 3EW9A 3L0IB 4H44B 1S76D 3B3QA 4XH9B 3LWZA 3WYCA 2OECA 1XVUA 3AFIA 1NWHA 5TEWA 4V0KA 3M5WA 2RGGA 5ITWA 2BJWA 2RAVA 4U3FH 1O5OA 2W71A 3H9VA 4X89A 1I10A 3NHUA 4KQXA 4Q39A 3C6XA 1CEXA 3RROA 3ZV7A 5F98A 2JL1A 3AG2C 2PZKA 2XJ9A 4IG4A 1Y3AA 1FTNA 3PQDA 3GELA 4QTXA 2WIDA 2GKSA 2D5CA 2VYVD 1V4BA 4MUJA 1VP7A 3PTAA 1RLGA 3RE1A 3SSOA 1JU3A 1WV1A 2DYRC 4D4LA 5JD6A 1ICIA 4L8VA 2BYTA 1XI2A 4MPTA 1GTG1 2GPNA 3D8RA 3ASNC 2F4VB 1D03A 1KK0A 1XRJA 2OO5C 5CTAA 5E9QA 3TL2A 3ZWBA 3E1GA 5BQ3A 4EQZA 2MWMA 2Z30A 2ZBDA 5C9ZA 3LCJA 4G88A 1GADO 1VIVA 1JX9A 4GMDA 5CK4A 2PKRA 3TQOA 3F78A 4CL3A 1GPKA 1EGQA 1V41E 2JIBA 2Z1TA 4N5IX 2GILA 4REQB 1YDFA 3BVPA 4N47A 4PSVA 1NXXA 2ZJ2A 3IKTA 2QTFA 2CLSA 4LJ9A 2CYAA 2NO6A 4I1VA 4ND6A 4RV5A 5AKEA 4U4AA 4Y2XA 3AG7A 3V1TC 5EIBC 1WHSA 3GJQA 3I1YA 1TYEB 3H87A 3IDQA 3LUCA 5BN3B 3GAFA 2QM8A 1Q8RA 1KC3A 1RTTA 4PFSA 1QIIA 1MQ8B 2ZJ3A 4C89A 2W42A 4N0QA 4B6SA 1EZ4A 1B14A 3D00A 2Q5JA 3S2FA 3NW9A 1FVHA 4RLQA 1G19A 3LUHA 3VR2A 4QEDA 3BSSA 4HQFA 5IP5A 4NNJA 4MP6A 2H2DA 5B1IA 3RU7A 3D4IA 4EMTA 1XRNA 3KDPA 4Q20A 4JI4B 1NJGA 1IZYA 2Z5LA 3K9BA 3HXLA 4OM8A 1I0IA 2VGNA 1A8SA 1P45A 1Y7TA 2FWIA 2QPAA 3Q7QA 4INJA 4JITA 4Y1EA 4YDRA 1DXQA 5FTWA 4ECEA 1IJBA 2PV0A 1BOFA 1M56C 4FVMA 2YZ2A 3L0BA 5AHWA 5EJ5A 3LFTA 4EDHA 1TCVA 2IGBA 3PC8C 1FSFA 1ISGA 1PV2A 5JZMA 3VI3B 1Q5PA 4X8AA 2PQ0A 1WPBA 3GEGA 1N0WA 4RFLA 3WRXC 5HKOA 5M29A 1CDZA 4RC9A 3RJ5A 3N4ZA 1FZTA 5DCYA 4QOGA 1C4OA 1QRRA 2XMQA 4B2LA 1CQJA 3P3NA 2NXJA 4EOGA 2FMHA 1FF9A 3AFHA 2GN6A 3IP8A 4JROA 2IX9A 3EJ6A 3LQ1A 4FN4A 4AB1A 5A4MS 2QZSA 1IPFA 1CXZA 4K0RA 3UGTA 1EE1A 2H0AA 4BZWA 3I9JA 4MVJG 2GQ0A 1MX9A 1DGSA 1FUEA 5CDTA 4MDHA 3IEMA 4L6AA 3H6KA 4RELA 4UQPA 3G17A 3FROA 4HD8A 2XITA 2QM0A 2CE2X 1LZKA 2XMGA 3C41J 2LZ0A 3DLCA 2ITCC 5DNCA 3NIDB 2ANBA 4UFPA 4EIWA 2AC7A 2V0CA 1E4EA 1PJRA 4FJ1A 4XI9A 2O3QA 1GSHA 2PSHA 2ZITA 2FG5A 2X8AA 4KKVA 4R2HA 4XB6B 4DC0A 3DC7A 3BXHA 1QRUA 1JVMA 1PL4A 2BEKA 421PA 2JAHA 1D4OA 1L4NA 1N34B 3F67A 4YAIA 3LQYA 3NANA 3W2GA 4M8SA 4O4JA 3EISA 4PBSA 3CCQF 3CIFA 4G0ZA 4BC1A 1PX2A 2NTYC 3L8DA 2ST1A 2DEUA 1PL0A 2O5EA 1EUQA 2W0SA 3VR4H 1N8RW 3C7KA 2YUTA 1M34A 3ORFA 2P6UA 1WMAA 4LOKA 5LB4A 5C93A 2A5LA 3ZN2A 3FGOA 1JJVA 3T4XA 1Y67A 5I4CA 3MFQA 4FDVA 4ZK7A 4UU7A 1G0OA 3VDNB 1PWZA 3D6FA 5B37A 1Q17A 2JLUA 1JFFA 4WESB 4QGSA 5DASA 1NU8A 1BS3A 5K0BA 4B7AA 1HQCA 5JHHB 5CB4F 4JC4A 4L0QA 3G2QA 2VDPB 2JGUA 3GGCA 2AMLA 4HTAA 6NULA 2ZR9A 2XGSA 1D0VA 2YYAA 3OIWA 3UHPA 3EBLA 3R7BA 4MNTA 2GDSA 5CXQA 3AOEC 4OGKA 3BIJA 3K5PA 2OBMA 1PQPA 2V74B 4GPZA 1ZNWA 5JOQA 5AOVA 2ZIOA 3DWEX 4IVQA 3LY7A 1KFKB 3IFSA 4EVSA 4Y2HA 2GM3A 3DB2A 3WG7B 5JE8A 3T1OA 3KALA 2Q7EA 5JEEA 3UCEA 5K6AC 3P26A 1DEOA 5DNYB 3IRUA 5ALNA 3W4KA 5IG2A 4U0KA 4PNPA 1UFKA 4I3GA 2O8DB 3PS9A 4NWIA 3ZW7A 4P98A 2P9EA 1WF6A 3OOWA 4J4TA 3ONWA 3K9QO 5BN4A 3E2MA 1MT0A 4Q03A 1SC4A 1RM0A 3RFCA 3OJWA 1RYBA 4YWHA 3N4YA 5T6BA 3T95A 3QLJA 4ZKEA 4ALLA 2YI8A 1IWBB 2D6FA 2Q3CA 3KKLA 3A1TA 4D9HA 4EKWA 2NG1A 2EWWA 1K7DA 4EFKA 5KNBD 2FPGB 1VSQA 3W5BA 4XDLA 1IX9A 3EF3A 1A8IA 4G5QA 5C37A 4IS2A 2H0QA 5COAA 4X1YB 2OCCB 3A10A 3OSUA 3QVGB 3AL2A 4MR8A 1SVMA 3TVYA 1L8XA 1JIUA 2ZJOA 3M34A 4MIYA 2EINC 4MB0A 3SS7X 1M2WA 2WK1A 3BH6A 1J5PA 3EFOA 4V1CA 4KK3A 3OBWA 3R7FA 3J80A 3INGA 1T9CA 3IKEA 1QP8A 3KVNA 1RM1C 3OTGA 4RD1A 3KQKA 2CNWD 1PGQA 3ZW9A 1KI3A 5D5PA 5CA1A 6Q21A 2PBRA 4L85A 1GGFA 1VMDA 1UEXC 1F9EA 2D2FA 4WT7A 4K8RB 1I80A 2R7MA 5CFMA 4L50A 3DT9A 1ZJ5A 1GZ6A 3FYHA 5H59A 1LSUA 1MA0A 1WOYA 1Z7BA 4YCAA 4DV3B 2QT0A 2V96A 1U5BA 3V3KA 2OE2A 4JI5B 3R6GA 1ICEA 3M1XA 1JYEA 5TQ2B 1K5PA 2I6XA 4DV4O 3OIVA 4CC5A 3CCJV 1MG1A 1WY7A 3AVUA 4FWIB 121PA 1ML4A 1P9RA 1ZK3A 2OENG 3DB1A 3JQAD 2I6DA 3C1TA 1NSFA 1A04A 3A1SA 3O38A 2WICA 2BCGY 2WQZA 4HB4A 4WGGA 3IBGA 3FF4A 4ITRC 4BASA 4EELA 1QCEA 1G8MA 2XMPA 4JI6B 1ZUNA 3AESB 2WNIA 4HDSB 2VZ9A 4JOQA 4YQZA 2PO5A 5IJXA 3VQYA 3X2FA 1WBBA 2PGAA 1J4AA 1OFIA 3KG2A 1C0LA 4ONEA 5JRZA 3W8FA 1SC9A 1W0KA 1XD8A 3AWIA 3F49S 2QOEA 4HNTA 4N41A 3L8MA 1E1MA 4EQ6B 2XVMA 1BVRA 3CC7F 3QV2A 4YPOA 2GN1A 4EJ2A 2CJXA 3VNVA 4V2UA 5T4BA 1E2UA 3NHAA 1DXYA 1JBEA 3THRA 2C00A 2QX9A 1ZA2A 1X7DA 4WOJA 1ZOPA 3LLSA 4BB5A 3OI7A 2HF7A 1W1UA 3DYIA 5DM2A 5BQ5A 2F90A 3R7AA 1RJ9A 3IUQA 2I7XA 4MZDA 4D6YA 2DR2A 3QVLA 4FHZA 3SIRA 1KYTA 1VCHA 3FR7A 4UZFA 4K1LA 5A1JA 3LI2A 3N5KA 2PF4E 4RJJA 3VMMA 4ZAWA 1AMNA 5LBUA 2YNMC 4AJHA 4PWTA 1DV2A 3R2JA 3DWGA 2VDQB 5KIAA 3BFRA 4ZHWA 3SYAA 2R62A 2V3WA 2PS9A 1U1DA 3EQZA 2XEXA 3KKNA 4P53A 2WAAA 1BHBA 4XWTA 4CDRA 2QD3A 2SECE 3HLYA 1SPBS 2J9ZB 3EQ8A 4NJMB 2FN8A 4R3WA 1PZFA 4R9VA 4UAVA 2OQVA 4AJPA 3MUFA 4IXTA 1HI9A 2D62A 3UOWA 4JU8A 4K88A 1NTKH 5IDJA 4A36A 1H8ED 4JI3B 3JD4A 2G82A 1E0DA 4LQLA 5B66Z 1PGOA 4XAQA 3BFXA 4F2HA 3K9AA 1OZGA 3LDFA 4XLZA 4DHEA 2RNBA 2C0CA 1TM5E 5IVKA 2Y68A 1VQLF 4UBIA 4H1WA 1A9YA 4KI0A 4L27A 4EW2A 2BGUA 3PJDA 2LBWA 4AG5A 2PJDA 4FLZA 1XNQO 1UZUA 1Z2NX 1ECLA 1VPTA 3BXOA 1WEKA 3QJ5A 1SHJA 4Q37A 3MMXA 4W1PA 5B3AA 2EC5A 1UC4B 1HMPA 4Y2VA 5EGSA 5FR1A 3OQMA 3IDSA 4OQXA 3ZV5A 2JNWA 3ABLB 4G0WA 4LZNA 3CPSA 2XGJA 1OU0A 1ESEA 3G5AA 1JILA 1YK1A 1IEVA 2BF7A 1Y0BA 3B6NA 3REGA 4J03A 4UUQA 3V7YA 4BN5A 3PGLA 3W78A 3PYMA 4B76A 1LD3A 3GW8A 4KW7A 2F9FA 3GCGA 5FUMA 1OXMA 3BZBA 2GTHA 1C0EA 1NFFA 3QKIA 3WG9A 4BZQA 2I71A 4JLNA 5ALEA 3TDNA 1F14A 2J3KA 2OCAA 3CR3C 3E9RA 4RQTA 3O31A 2QDOA 1YD7A 1HXHA 3ROQA 5K8UA 3CG6A 2X8WA 3HI6A 3LK6A 2AJDA 5DYYA 2R1VA 4NYIR 3DZHA 3L70H 5DMHA 4EI2A 4KKXB 3NAMA 4UNPA 2AMTA 4MGIR 3F9CA 3A27A 5FH9A 5KYKA 2ZZNA 4X9XA 5IC6A 2ORIA 4C4TA 3CMMA 4Y7DA 3ZMZA 2RGNC 1H2SB 1T3ZA 1ETHA 5BT8A 4WK2B 1FW8A 4EBBA 3PXUA 3GK3A 5EJAA 1QFMA 2OXCA 3N0TA 2F8TA 1MB2A 1T3TA 1NVKA 3QKRA 1PGPA 1MVLA 3WGMA 1IQ0A 2ITDC 2IHZA 2EINB 2KX7A 1O6GA 3NWOA 1AXGA 5L3EA 5HY2A 3UHJA 1U9CA 4CTJA 3DEFA 1K5HA 1YAHA 1E6KA 3T3GA 1D2CA 2FUG1 1CUJA 1E6WA 3MTQA 4BU0A 4RMNA 4D8TA 4Q21A 2R9RB 4REOA 2OBNA 4IDPA 4PWZA 4AZSA 3LWPC 1O0BA 2EJBA 2Q8NA 3R3WA 2E18A 4M0UA 4XIYA 3W9SA 5A05A 1W34A 2LCQA 4EKEA 4BZPA 3YASA 3VR0A 3JYCA 2CK3A 1YF2A 3AZOA 1I2AA 3NASA 5FBVB 3C3WA 1EXVA 4DQXA 2HOQA 3D7KA 2WZQA 1GHTA 1L5ZA 2P22C 2P6OA 3CU5A 5A3SA 1V7PC 4WFHA 4KYIB 3W9BA 4K8XA 1P7CA 3EFEA 3HJTA 4EUEA 1M1XB 5AVWA 2F00A 1G8YA 2CLHB 4GD3Q 4H7HA 3O8QB 4IOKA 4OQPA 3VNAA 1QYDA 1B74A 4YFVA 1ENOA 4AY4A 1SVNA 3VHRA 2UUBB 1EFPB 3IMPA 2WJYA 1L5NA 3AVWA 3K1JA 3LKBA 3AG1B 4CR7A 2XCRB 1HZZA 2EKDA 3AP2A 2H48A 2ZUVA 3RAGA 3IUPA 2LGWA 3O74A 4IDCA 2R6CA 4EITA 1J7JA 1PG0A 3G8DA 4ZT4A 1YUNA 2VUHB 3LBNA 4DR1O 4J0IA 3DVAA 5JO9A 3E8BA 3HWRA 2K2QB 4DQDA 1KP3A 1EFPA 2DY1A 1YKSA 1A69A 2JJQA 1UBGA 3KSZO 4R3UC 1C0IA 2AEFA 1EZJA 3KCQA 4FCTA 4FB4A 1W4RA 4RNDB 1YVWA 1JKJA 3GPDG 1F51A 2AF4C 1JZSA 4LPSA 1ZD2P 2A78A 4P6VF 4PC3A 5IFKA 3E03A 2HO4A 1FDRA 2CDCA 4RPHA 1P80A 2OB2A 3STZC 3WJQA 2ZT6A 4K9MA 2QZJA 3AJAA 3OZXA 3F5TA 1Z0IA 4DNFA 5CFZA 2OO5A 4GPIB 4PZPA 4OO3A 1EAYA 1G2IA 1MOZA 1YDGA 2PFKA 5CNMA 5AO9A 3SBEA 4D2IA 4ZHQF 4JEHA 5CH3A 3F0FA 5KSYA 2OK7A 5L40A 4EW6A 1QG6A 4Z1VA 2P9YA 2V4UA 3RV3A 4E03A 2YN0A 3ICOA 2QVGA 4YPFA 4UCRA 3GUHA 2ZOVA 1D5AA 1R4ZA 1OFGA 1O95A 2XZOA 3DEKA 3IERA 4BEWA 4G28B 4UCOA 1IPHA 4OLBA 4PZYA 2JEUA 4X63A 2QN9A 3AHJA 4G67A 2OZPA 3HVKA 1PD1A 3IXQA 4UTZA 5EERA 2QTNA 1ZWKA 2NGRA 5JCOC 1V5GA 1NE2A 4X7PA 2FZCA 3MWDA 3ZW8A 1EFAA 5LBQA 2EG5A 5IUKC 4O4HB 1EGHA 2EOAA 2G76A 2R65A 4L5BA 2JGMA 3T5MA 4DQ0A 5BXYA 4PG7A 5D3KA 1QFYA 2OL4A 3IAEA 2PXCA 4RF4A 4DV5O 1GGKA 3SPJA 1SB8A 1K6JA 3B1WA 4HEQA 4M99A 4MH0R 1SKUA 4KTTE 4NSNA 1ZMTA 3H86A 4U7JA 5J59A 1C1HA 2Q73A 1Y7IA 1XEXA 3HY3A 1Y98A 1N2IA 2AJ8A 2OZKA 3RRFA 1R8QA 4MVJI 5BUZA 2N0SA 3LF1A 1JLLA 3KB8A 3VJRA 4QELA 1UBUS 3VX3A 3F98A 1YZKA 2I6QA 3FKSG 3CQ9A 2K6GA 1E9CA 3JWJA 5AK6A 1KO5A 4E22A 4PDMA 2D1SA 1G5HA 4D4HA 1I30A 2IVZA 2ZR0A 1E9SA 1IMJA 5A4KA 2IFTA 1DLJA 1G5PA 3G2HA 1VHQA 1IM5A 4QNMA 2BM1A 5I9SA 2YS6A 3DONA 1CZOA 4W1QA 4D82A 1LVHA 4B7EA 1ADCA 2VUUA 3SNHA 4D56A 2I3BA 4A3SA 4TMFA 3H2HA 3MELA 4G5FA 3UUGA 1KH3A 1SVLA 3NKLA 2FPPA 3L02A 4JP2A 3KWJA 4GZRB 3OURA 1USKA 3JS5A 4MUMA 3SHFA 4EB3A 4PE5B 3REQB 3AG5A 3UAWA 5GW7A 3ZU2A 5I4BA 4BW9A 4B45A 2VP9A 3IB3A 4IUDS 1DKOA 1B8OA 1KO8A 4HQ6A 2RC6A 1R4AA 2PWYA 4C06A 4D43A 2TMYA 4B33A 5BN5A 2ACVA 4ER0A 1II0A 5EMNA 1J7HA 2DUJA 1QO0A 4BTLA 2J85A 5JBQA 4PTZA 4OIFA 4UVIA 1SBYA 1TO2E 3TPZA 1XTRA 2W6IG 3BWEA 1H9CA 3ZS8C 5ESXA 1QKJA 5EJ8A 2HH9A 1WUJS 1GA6A 1YU6A 4JQYA 1TZJA 3K57A 5LR6A 2Y1LA 5HTKA 2KJQA 3A1FA 4WXYB 2DYRB 3PDCA 4XSGA 2DQ0A 3AERA 3B70A 3OU6A 1O6CA 3H42B 5ERXA 1CIPA 4NPCA 4FFMA 3SF0A 2Z2JA 3I9LA 2BY4A 3SKVA 4M8LA 1YHQF 1MRSA 3OCCA 4RQAA 1KI6B 3LHIA 1M0TA 3PZRA 4CEHB 2PSDA 1OWMA 3DVAB 1XLTA 2BF4A 2QRJA 3LRPA 1FS4A 4OQNA 1D1PA 5KYTA 5BMVA 4RTRA 2C2AA 3WZ2A 3M4SA 4ARBA 3BDVA 2H5EA 4DWWA 5KYYA 3JWHA 3MG9A 1CS0A 4W1SA 2QGNA 2EP5A 3FSGA 1WLYA 2J07A 5GJVC 5HCUA 2C5FA 3S1SA 3Q7PA 3D2AA 3KXIA 2P3QA 2V3VA 4UUOA 4N6GA 4BNUA 1EN5A 2RGEA 1SQVH 1Y9EA 3N2EA 4W8HA 1R5OA 3VQTA 3PX7A 3C4JA 2YDXA 4N5NA 1U3UA 3MMNA 4QASA 1E96A 3F6CA 2WLSA 4DLYA 4MWCA 1WLEA 1L7XA 1ZGJA 2JGLA 1BHJA 1D2DA 4S2UA 4BKUA 5EL0A 3QE9Y 1QHNA 1KIFA 3OUSA 4LOHA 3OQJA 3NRBA 4PC2A 4LXQA 4E5VA 3B09A 5JSUA 1N2CB 2IYFA 1KY2A 4CRWB 3IV9A 3BFVA 4AD8A 4KO3S 4F46A 5KYGA 1VQNV 2CD7A 3MILA 1GL3A 4G4WA 2F3PA 4NCKA 1PAUA 2WJ3A 4TSKA 5EIWA 1OCCB 1EFTA 3TKLA 1WXQA 5JFTA 3E0XA 2NSHA 4IMPA 5FULA 3CY6A 3U0VA 1MFZA 3INNA 1IBLO 5LIRA 4UHBA 5CCDA 4AC9A 4LMBA 5LP1A 3RIMA 2UYPA 1N4DA 1SUEA 3G1UA 4WW0A 3TNLA 3QFSA 1E92A 3FYUB 3CO0S 5KCMA 4CLHA 5IK2D 2OESA 4J1SA 3FNGA 1R3DA 4OU4A 4MVOA 4DBVO 3C6YA 2X3YA 4GQIA 2XODA 1W35A 2ZSUA 5FBWB 1BS2A 1NHWA 1VE1A 4IL5A 4ABMA 1CF2O 3UY4A 4K35A 1H2BA 4NE7A 3I61A 1SPXA 4ZIBA 5IYZB 3D7SA 2ZXEA 3HYCA 2V7BA 1R88A 2V98A 3UAZA 3PICA 4UMVA 4AZ3B 4CN9A 5JAQA 2QKCA 3ZD8A 1JN0A 4NKGB 3OQBA 2PYIA 1KIAA 1K66A 1AHHA 3ML0A 2G8NA 3SBXA 5KWIA 5JH7A 2AMVA 1OZAA 4L08A 5IDVA 1AR4A 5IXYA 1TEZA 4X8MA 5IS2A 2A2ZA 5AM2A 4XIJA 5IY5C 4TRNA 4DV7O 3ESDA 4TTVA 1J0XO 3I52A 4B74A 1FFYA 3IAAA 1DJOA 2XKJE 1RKQA 1AKUA 1DX9A 1FFHA 1ZMRA 3SYPA 2D06A 1Q3EA 3KKQA 4CM4B 2DT8A 3AV0B 5F1OA 3V8EA 1QKIA 1HDEA 2J41A 1Q2UA 3QF7A 1QE0A 5A3VA 3KZOA 2V5VA 5DRYA 4RDCA 3A1UA 4A9AA 4JYPA 1M1NB 4U63A 4US2R 2V0NA 3QP9A 1DT5A 2RIRA 3COPA 3KSUA 2FRXA 4HWOA 2OYCA 2QX4A 3ZWVA 2XYGA 4CLOA 4D6PA 3FWKA 4XIIA 4XYLA 1KYOF 1RWVA 4LY3A 1WL8A 2PGOA 5IXJA 1KC8W 4KC0A 3LP5A 3LKZA 4EPTA 3G0HA 3ZHOA 3RVLA 3T6KA 1VH8A 3IILA 1O0SA 3QE0A 1W36C 1QWOA 2QA5A 1RQLA 1V55B 3LPAA 3QWAA 1AILA 2EKPA 5DWDA 3EGXA 3X44A 4ZOLB 3IIIA 4GZLA 2BRUA 1H3EA 5JSZA 3P5SA 1W49A 2ERYA 4R6XA 2GRUA 4TV9B 2CMDA 4Y9UA 1XVAA 4M0CA 2IEZA 4DY4A 4TWJA 4XPZA 3H2ZA 1PN3A 2BGTA 5EWRA 3UA4A 3N3BC 4GSYA 1RRKA 2E48A 2OP1A 5EIHA 4CQMA 1QVZA 3GBSA 3G2NA 3QG1A 5EYPA 4IIXA 1OXVA 2NZUG 2AXPA 3DDOA 1RXUA 1W76A 2JAPA 3DUWA 3LLUA 1YTFD 5I9TA 2JZOA 2H2AA 4ZCRA 1UP6A 1G42A 3ED1A 5EJEA 1J97A 1ORWA 3R7WA 2H8EA 1V6AA 2FPXA 4Q9AA 5JQGA 4QBKA 1QQ5A 1ZM4A 3KHUA 4X84A 1AQJA 5B7PA 4E6EA 4TRRA 2CCJA 2EQAA 4TVOA 2GPSA 1A9XB 2EZUA 1PZHA 4GXTA 1X13A 3U11A 4LJAA 1LJ8A 1PPJH 3L7QA 4RY9A 1SVSA 5BSRA 2HP0B 4EFMA 4PA6A 3ETCA 1FSGA 5LOVF 2P6RA 3DMHA 1HURA 1X25A 1EUDA 4RPCA 1YU9A 2UVPA 4RHFA 4LCKA 1GO3F 5HKKA 2P1ZA 1SQQH 3TLMA 1E1DA 4WA7A 1VJ0A 1Y34E 2B25A 2I2DA 3CLUC 2DF8A 3ABTA 4LV5B 4Q9DA 1X7OA 4YJGB 4ZC8A 2BI7A 2N74A 3QQ5A 3UJ3X 3X1JA 5KVAA 2VHTA 2X77A 4GM4A 2YN2A 5KB3A 2PX8A 1EQ2A 1R50A 3IMGA 4FZVA 3EPKA 3IAUA 4JFAA 1ZU5A 3VDXA 3ADOA 2IUSA 4AW9A 2FPIA 3LUDA 5AJUA 1ONBA 2CVPA 2O2ZA 3IVMA 1NQVA 2HXGA 4NC9A 5LXTB 3UUEA 4A0HA 4RTPA 4PPNA 1ZAYA 1YJ5A 2AKYA 2PUWA 3I1JA 4B3RO 1GZVA 1TI7A 1JFRA 4GDMA 4DN6A 5JDIA 5ALKA 1NNI1 5LUAA 4I99A 3T0IA 4KPFC 1OCOC 1UJCA 4FM2A 1ZZGA 4GI7A 2YZ7A 3JVVA 4M7RA 3H5NA 5I4IA 1A8PA 1AZSC 4GS5A 1U8TA 3TX2A 3TQRA 1MJGA 2A6PA 3R5JA 4Y2RA 3KZIZ 1K9MH 2VPTA 4C7VA 4F4JA 5IM4A 4EECA 5C0OE 1LF0A 2A33A 5EIAA 5BSGA 3D36C 1AB6A 5CEJA 3W3ZB 4GE0A 2JFGA 3S4YA 1U63A 2DJVA 4DUYO 1NU1H 3WR5A 3NATA 3NGMA 4DIBA 4IL6Z 2V6GA 3BMOA 4ZAFA 1PJTA 1VRCA 3E6AA 1Z08A 1Z88A 4N40A 5ICFA 1VGQA 3D6UA 3P2IA 3VOTA 3VM6A 4KQ9A 4XR4A 4BNTA 4CMBA 4DE5A 4F93B 2ESRA 5FPOA 1VL5A 2PK3A 4X8OA 5JSFA 5B4TA 5D3MB 3IKFA 2IDKA 1RPRA 3OZTA 4G0XA 4UUAA 4XA8A 2IYEA 3IA2A 4QM6A 1NBAA 1JDPA 3COYA 4XD2A 4XIFA 4LFBB 3K12A 1U8CB 1NG1A 3RA5A 1FU4A 4E32A 3NHFA 2B34A 4F60A 4D4JA 1BMQA 1UANA 1HO3A 3QXXA 3F0EA 1RRVA 4L0CA 4JI1O 1T3HA 1UBHS 2XVZA 2WWHA 1SZJG 4QUKA 1ENPA 3UJPA 4AF8A 4ZVRA 3ZWXA 3D43A 4ZZIA 9LDTA 3W05A 2FSFA 5TGZA 1E9VA 1JWAB 1MVNA 2FW0A 2PTMA 1L8DA 1KQSU 2UYKA 1DELA 2BKEA 3LNCA 3PE6A 3PR3A 3RT1A 2DQZA 1R00A 3WWPA 1Y6JA 3S0HA 6AT1A 5IX8A 1XLWA 1XWFA 2I80A 4X97A 2XLCA 1CE8B 2PZJA 4ZO7A 5HDBB 2PX3A 3SKXA 5KA6A 3D6VA 3KKKA 3LQRA 3NDIA 4GKKO 3ITDA 3MC1A 4DJJA 5FL7D 4E70A 1BX1A 3FJYA 2WLLA 1OAOA 2OCPA 5AK4A 3DAFA 3PNBA 4RVSA 3CRW1 2JK5C 2HS4A 2HPZA 4AMGA 4MR7B 5IKEA 1TTTA 1L8LA 1ROPA 5LQRA 4KHPO 1Z4OA 4UVEA 2GCOB 5KYWA 5JJBA 1A32A 1U9IC 3OCYA 4OFZA 4B2IA 3VKWA 1U0FA 3RQIA 2P9ZA 1UZLA 4I50A 2O6HA 4MTFA 3KB6A 5AVUA 5K0SA 3VNRA 3RVRA 1YR1A 3G5TA 2F8MA 3K0AA 4I55B 3D4OA 5L4SA 3HB3B 3HYTA 3MJVA 2HT1A 4JXKA 4NR0A 4NOJA 4K6GA 5DBEX 1FFXA 1MXHA 1QAQA 1YJCA 4A0FA 2A3NA 5LKRA 2R1UA 3HY4A 4LWSB 4O63O 3JQ8B 3ZMTA 1N5IA 1P72A 2GJ9A 3V7NA 1SQ5A 1EVYA 5FB3A 1OQAA 5TEVA 1V7CA 1UI9A 4DR4O 3L7YA 1GPYA 4CKEA 2O2JA 2C7QA 2Q99A 3BL6A 4OKIA 3S2EA 5EMLA 1GG2A 1KO7A 1RP1A 1X80B 1BQ3A 2BGMA 2BJHA 4TXLA 2VWJA 1PT9A 2WQ6A 1NLFA 5BMVB 5DM0A 1H2FA 4LF6O 4LBEC 1T1IA 2NU9B 2OLKA 4NQ3A 2WTBA 3N70A 1T25A 2BKVA 1FLVA 3D5EA 3KQPA 2YBEA 2JGJA 1M7BA 4X45A 1TKRA 1N2GA 3LQFA 4AQDA 3CEIA 1USWA 1O9BA 2H2FA 2JRLA 3E27A 3FHOA 4CQNA 1O6FA 5BQXA 4RVDA 4EY5A 5LYJF 5EE9A 1SC1A 2Y3IA 3GPIA 2Q1WA 1MO3A 3BCRA 1OTXA 1QBZA 1IQUA 1KY5A 1SBHA 3QVSA 3S5JA 1KAHA 2GXAA 4YHHB 4WF9V 2F1MA 1DEAA 2VNSA 2VBCA 1IK4A 1GUBA 3QUCA 4BV3A 5CIYA 2R60A 4B3MB 2VRBA 1TC1A 4KXNA 2ZRKA 2B7LA 4GZ6A 2ZJ7A 2ZNJA 3W5IA 3ZWYA 2ENWA 3NBXX 4HVAA 4OKNA 2ORWA 3MGBA 1CJBA 4FT4A 3VC3A 3MXOA 1L5WA 1OBFO 3P5BA 5DGCA 1K27A 1SVWA 3JYQA 1BDJA 2YWXA 3QEJA 2Y4NA 4JUFA 4LZOA 4L3OA 1RXCA 2CLEB 1WCIB 3P0RA 3QIVA 3SJ7A 2YRFA 1CYEA 4IINA 3TX6A 5HFLA 4B7UA 3V8NA 2DP4E 1D5CA 4BT5A 4DSZA 4R71A 1Z29A 4C8IA 1T24A 3B4SA 2BFEB 2CKDA 4G84A 1WHTB 3L9WA 1LPAB 4GCZA 1X38A 2RAUA 3QE4A 5EWJB 5SZHB 3V8PA 5BSEA 1IB0A 3E3MA 3VX4A 5JATA 2OMKA 2X8JB 2OFOA 1BROA 2V65A 2O7QA 3Q3VA 2HX1A 1NSTA 2OCGA 2UUPA 4TTTS 4XX0A 4FB5A 1TIPA 3LTNC 4GRAA 4OMUA 1AD2A 3U7HB 5C18A 221PA 1YTUA 3NEJA 2QUJA 3QWBA 1ISIA 4CS2A 3QTCA 3JR3A 1TMGE 2PWAA 3W5AA 4AUEA 4J42A 1C3OA 2IIPA 3B3AA 5G0VA 2AFHA 5IT9A 4FI3F 3OX4A 2VO1A 5G4LA 5BSKA 4LWOA 3JYOA 3Q10A 2R7NA 2PLNA 3AONB 4D02A 2YV3A 8ABPA 3OKAA 1SUPA 4KFTA 4F4DA 5F33A 5KOHB 4EAAA 4QDOA 1L5VA 1Z75A 1AGRA 2AYZA 1K4DC 5DYTA 3RGBA 2XMRA 3AHGA 1R0LA 2VZ0A 1O94C 4YB8A 2R5WA 1PD3A 1LTHR 2WMNB 2DECA 1KI2A 1ZFNA 3DJFA 4WN3A 3ZPXA 3P9YA 2EQ5A 3COJA 1SXQA 4KIJA 4BLQA 1Y82A 1QLWA 3L8EA 1HNXO 3OMXA 1EEHA 3PUJA 2JIOA 3WLPA 1LK5A 5IK2A 4D8WA 4RLSA 3W2HA 3HCBA 2ORED 1DBRA 2PS3A 3SE7A 3ZWCA 1IBSA 1MC1A 5JYDA 5B3JA 2P91A 1SCDA 2PPVA 2GZRA 3HZHA 1M2NA 3FCOA 3I9NA 1GFWA 2JGKA 3Q3JB 4MWBA 1DTSA 3TJRA 1GAXA 1W2BF 3FYUA 3CLTC 3LUFA 4XM1A 5SZIA 4CMEC 5KTYA 1I32A 4I8DA 4GSKA 1VGVA 5BY1A 5EMHA 1I94O 2H59A