5KX5B

Crystal structure of tubulin-stathmin-ttl-compound 11 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
430
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
publication title Design, Synthesis, and Cytotoxic Evaluation of Novel Tubulysin Analogues as ADC Payloads.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 167
structure length 427
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kx5B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kx5B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kx5B01
3WGKA 4TV8B 4X20A 4IHJB 5JH7A 3WGJA 2XKAA 3HKEA 4O4JB 5M7EA 3RYFB 3JATB 5EZYB 4E6EA 5CA0B 3ZBPA 1JFFA 4TUYA 4TV9A 5KMGA 5GONB 4WBNB 4X1KB 5CB4A 4X1YB 4O4IB 5LYJA 5ITZA 4KWEA 5EYPB 5C8YB 3VO9A 4O2AA 4I55A 4ZHQB 3JALA 5MN6A 1TVKB 3RYIA 3N2KA 4B46A 4O4LB 1OFUA 4IIJB 5JVDB 4O2BA 3JARA 4U3JB 3JAKB 4ZI7B 5CA1A 1TUBB 4YJ2B 3WGNA 4LNUB 5LXTA 3HKBA 3UT5A 4HNAB 4EB6A 4O4HA 4F6RB 3JASA 2BTQA 4X20B 5JH7B 1SA0A 3WGMA 5MN5A 3HKEB 5FNVA 5IJ0A 3HKDA 1W5FA 3C8LA 5J2UA 1JFFB 4TUYB 4TV9B 5KMGB 4XCQA 1RLUA 4U39A 4DRXA 5CB4B 5LYJB 5ITZB 3V3TA 2VAWA 5MN4A 5KX5A 5LOVA 4O2AB 4I55B 2VAPA 3JALB 4I50A 3RYIB 5BMVA 3RYHA 3CB2A 3N2KB 3N2GA 3M89A 2RHHA 3VOAA 5IJ9A 4O2BB 1FFXA 3JARB 5CA1B 5J2TA 5JQGA 4YJ3A 3VO8A 5LXTB 3HKBB 3UT5B 1RQ2A 4EB6B 4O4HB 3JASB 5LA6A 2BTQB 1W59A 4EI7A 4X1IA 3E22A 1SA0B 4FFBA 1FSZA 1W5EA 5FNVB 4ZOLA 5LP6C 5IYZA 5LP6A 5IJ0B 3HKDB 1W581 3VPAA 3RB8A 5J2UB 3RYCA 4DXDA 1Z5WA 3JAWA 4EI8A 2R751 5EIBC 3HKCA 4DRXB 4I4TA 2R6R1 2GVIA 3ZIDA 5KX5B 3VOBA 3M8KA 5LOVB 4TV8A 4IHJA 4I50B 5BMVB 4O4JA 3RYHB 3RYFA 3JATA 3N2GB 5EZYA 1RQ7A 5IJ9B 1Z5VA 5CA0A 2BTOA 1FFXB 5GONA 4WBNA 5J2TB 2RHLA 4X1KA 5JQGB 4X1YA 4O4IA 4YJ3B 4M8IA 4EI9A 1W5AA 5EYPA 5C8YA 5JCOC 5LA6B 5JCOA 4ZHQA 1TVKA 3E22B 4X1IB 4FFBB 2RHOA 4O4LA 4B45A 4ZOLB 5IYZB 4IIJA 5JVDA 5LP6B 3R4VA 2VAMA 2Q1YA 2RHJA 3RYCB 3ZBQA 5EIBD 4U3JA 2VXYA 3JAKA 3JAWB 4ZI7A 1TUBA 2XKBA 3HKCB 4YJ2A 1W5BA 4I4TB 4LNUA 4HNAA 4F6RA 3WGLA 2Q1XA
chains in the Genus database with same CATH superfamily
4BTEA 3FAVB 2XWQA 5M04A 1KJQA 2QQFA 2X5OA 4D43A 5CR9A 4CIWA 4EELA 5A06A 4L7VA 3HDYA 3IB3A 1VQ6F 5EIXA 1R88A 1EVEA 1U99A 2WMYA 3MB5A 1I0ZA 5JH7B 2IF0A 5A9SB 4HAVA 1TXGA 5F64A 4MHTA 1IDSA 3K06A 2QE7A 1PT7A 2EINC 1XTBA 4YBZA 5ILQA 1ZVMA 2OTLF 3ZYZA 1DCTA 5CB6A 2Z83A 4F3KA 2O1SA 1SC5B 2ZRDA 3Q4HA 2PVCA 4UVIA 1P5ZB 4JL8A 4XYLA 4FK5C 1P91A 3HLYA 1AUQA 1C5KA 4NATA 3MBMA 3QVUA 2EINB 3SF0A 3B52X 4UOEA 4DZRA 5KDDA 1W46A 2ADPA 1WDLA 3FSGA 2Z1EA 3M99B 4ZIRB 4JWTA 2NTJA 4RDIA 2GTAA 2I34A 3PC8A 2LW1A 2HKIA 2ZSIA 4KQ6A 1Z22A 1J6UA 2AWNA 4MEBA 1GQSA 3ZCRA 4PO1A 4CM3A 2C2OA 4AF8A 2MSWA 2D00A 4ZT2A 3A1EA 1FW6A 3JQFC 3WLEA 2D5BA 2ZRBA 3RASA 5E1AC 1RHKA 2CYCA 1I7QB 1E20A 2JL1A 2VHVA 3DVAB 3T9AA 4LE0A 4IHJF 2IU6A 3WG9A 4A16A 5CRIA 4FU0A 1E79D 4EVSA 2JJQA 5JO9A 3VJRA 3EORA 3PENA 1PI3A 3T61A 1GG9A 1UMBB 4KE7A 1CRQA 5EKUA 3AI1A 4DTIA 4QARA 2WYVA 1RACA 3AVYA 3HNPA 4MWEA 2IPXA 3RC9A 1L5OA 3AVQA 3O1JC 5HFNA 4DJDC 3HVJA 2M1XA 3HYRA 4DW1A 4CEJA 2G9RA 4CBVA 1PSDA 2G88A 2W6IG 5C8DA 4U7OA 4TX1A 1LDNA 2BC9A 4YPFA 5J5CA 1TK9A 3RT7A 4OXSA 5AK5A 3UF0A 1TYDE 1O4WA 4ZDJA 5CLGA 4HQLA 2B37A 3E8GA 1F1JA 1YQQA 5HQ3B 2E82A 2FGJA 3SPJA 2KQUA 3TVYA 3UOGA 3KYJB 1XLTA 4D8WA 1KVRA 4C5BA 5F76A 3HGMA 3HCOA 5EJEA 4Y9SA 13PKA 2XDQA 1VQNV 4URFA 5IBCA 3ZCXA 4H44B 1WQ3A 4OO3A 1WCYA 3PIDA 3E03A 3WL4A 4QYIA 4PQGA 4OI4A 4KXWA 4J4TA 1A0OA 1UDRA 5AHOA 2VBIA 2AW5A 3P9SA 2FUEA 4FOLA 2FPWA 4NDZA 2Q6KA 5FOWA 5SZHB 5ERGB 2HHHO 3VDXA 1E3LA 3O26A 2AUTA 4UBLA 4EHIA 3HKCB 5CP8A 1Q74A 5FFNA 3ZWBA 2EIJC 1A4IA 3IT1A 1NH2D 3JQPA 2QOEA 3CGWA 2HVJC 1S1MA 1TCVA 4EHLA 1MV8A 3C7TA 3AFGA 5F7XA 5L7TA 4FKBA 4WDRA 4CC5A 3LDAA 3Q15C 2CK3A 1SHJA 1L5QA 4L3OA 2EIJB 1TAHA 2EEPA 1E5LA 5ILOA 5AXBA 1UQRA 3SAJA 1PTJA 4CDGA 3DMTC 1Y48E 5I9MA 4OAQA 1N1DA 1QDUA 2X8WA 4GX1A 3ZLTA 2V8BA 3UBMA 3N27A 3GT4A 1WSBA 4HEHA 1DUIA 2P3SA 3HN6A 1IK4A 2QRPA 3KFXA 4C7OB 1GRQA 1YTFB 3CCEF 2NSJA 4LI0A 2Q3EA 1N1EA 3CV3A 1W5EA 5IJZA 3IKTA 1QYVA 1EUDA 4CG0A 4HGZA 5ESWA 4JDPA 3RC2A 4DR7B 4BZWA 1SPBS 4ATNA 4D4LA 3SE0A 1O57A 1BFKA 3ZWVA 1GFZA 2QN1A 1SC6A 1BN6A 5BURA 1VSVA 4LQLA 3W6UA 1XRJA 4PAQA 4KE9A 2CHQA 2VEOA 4EMSA 3TMKA 5B2FA 1NDQA 3JWHA 1KDOA 1ORIA 4GGOA 1DCFA 1D2AA 1FJGO 3HJHA 5TPZD 5H1YA 1DC8A 4N8SA 3O4FA 1GNSA 1PFQA 4ZYUA 2VJDA 4D3XA 1AP6A 1HI9A 2K9PA 2J7KA 4F4UA 4B4KA 1ZA1A 2Q5OA 4QU0A 3ZN2A 4B7EA 2J87A 3UM7A 5HXAA 1Z0DA 3WL7A 2P3OA 1JRLA 3Q10A 1Z63A 5DGCA 3OC0A 2CSLA 3OR7C 4B7CA 1RKUA 2CYBA 3COZA 4UNNA 2C2GA 2R84A 2PD6A 2X6RA 1KJWA 3UCSC 1N3LA 4NYMQ 3HXQA 4M3NA 4WJZA 3E7WA 1JQ5A 1ZOOA 3SOZA 1Z0JA 3JZIA 3UHFA 3F1KA 4KAJA 3ABKB 3CVJA 4HB0A 1Q1ZA 2R66A 3K15A 4GVPA 2ODMA 3CCQV 1ENOA 3OIGA 1KQNA 4YACA 1PK8A 1LUVA 2JK1A 3CXRA 2RHJA 4JA0A 5I8PA 3BJZA 3NIBA 3PZRA 4J2TA 1USWA 3NHJA 4I6GA 1HNNA 3VOUA 1GPBA 1NJ8A 5HOQA 5IZCC 1COWD 4X63A 4IDGA 4WXPA 3GZTB 3PVSA 4I5IA 4LJYA 3I9KA 5ELMA 4W6ZA 3KOOA 4C89A 3OICA 1TAGA 4K05A 1WXQA 4YCMA 2PWZA 3RE3A 5B12A 1HE4A 4OAOA 4E2WA 2PZAA 2FDXA 5CIQA 4L4UA 3VQWA 4MTLA 3V9PA 1PP4A 1BHSA 4UE3S 1RQXA 1CIJA 5G1PA 1VZ2A 4HN9A 2ONYA 4C6HA 2IV2X 5L3QB 3L0DA 4LZZA 2CLKB 3QE0A 2E5FA 3QBEA 1PWEA 3DE4X 1G64A 4BMDA 1PF5A 1IPAA 2IHUA 4JPRA 4E5DA 2GPJA 2EF0A 3I0MA 2EDAA 2XE4A 4J75A 5EIBD 1ZI8A 2NW6A 1KO4A 4F8YA 2J32A 4PX9A 4F3RA 2QLNA 3AVOA 1N8RW 3HWRA 4FUTA 5EWJB 3TXSA 1S5LZ 4F6EA 5IHPA 1D2NA 1Z83A 5JNLA 2BFEB 5T8KA 3IESA 1N8NA 4DR6O 4JCOA 4YP7A 3C9SA 3NDRA 1OX4B 3PFWO 1E89A 5BMOA 1KZGB 4LHEA 4BFLA 2QHXA 4QDXA 3QUBA 1DBWA 4FMCB 4DCSA 5FI5A 2RJZA 3WJ2A 2XADA 1T3ZA 1UM9A 3OEWA 4PYRA 5JMTA 1BG6A 1C1HA 1NT4A 2QROA 3M82A 3V9AA 1FX1A 1CJSA 1SGWA 3OJ0A 1Z12A 4WN9B 3K1ZA 4AURA 5FL7D 5AK6A 1J1UA 5FNVB 4D6XA 2FK7A 1ZC3A 1YRQA 2YXEA 1T4CB 2Q73A 3LF2A 2XUIA 3B2EA 2Q69A 1UZMA 2I33A 2YXYA 4EHJA 5JY6A 1YOBA 3RSSA 1U7UA 2HF9A 4J07A 3S2YA 4TTVA 1SUSA 2OHVA 3U0OA 1U43A 4MS1A 1M54A 1UEIA 3H2JA 2NZXA 4EJSA 1QBKC 3I2HA 1SQFA 5I5EA 2DP4E 4Y2UA 3ROTA 2X9GA 1PNOA 3DZKA 2N46A 3C3EA 4ZT3A 4RFVA 4PDRA 2WM2A 3FMGA 2I5PO 4AUMA 1T2AA 4G01B 1DMRA 3ESYA 3L7NA 5G4KA 1KH2A 3G1UA 2LRHA 3W7AA 4Z7OB 4QU9A 1L4UA 4FDUA 3MS7A 3HACA 1U5CA 2FR1A 3Q6IA 1ZX1A 1Q1EA 5AVTA 2HU7A 1HM5A 4X54A 3WADA 3BFRA 4BVSA 5LMUB 3KO8A 1HGXA 2X41A 4BE7B 5AR1A 3A6PC 2IU3A 3I42A 4S0XA 5AKYA 4NG5A 3DE2X 3INRA 3K0EA 2DXIA 3IXQA 3ZHBA 4PC3A 2C2BA 1UM8A 5JNUA 2P9EA 1DI0A 4C0JA 4RVFA 3HG7A 1Z2DA 4ENUA 1IN8A 3ES9A 1JZSA 2OQIA 2BSAA 4HRVA 3OT1B 3QI7A 5E1OA 3FYDA 3EFOB 2QQ5A 1R8XA 5KYGA 1FVHA 2PWBA 1QHNA 4L72A 3TLEA 1KC8W 2PYLA 2QTVB 4O1HA 5CLHA 4D9IA 4E6PA 3ZHVA 5NULA 4IMPA 2YJ6A 3T4UA 1P3DA 5AJWA 3CFYA 2GA9A 2NV2B 1VQLF 2Q99A 1NJ1A 1PK9A 2H2WA 5JFOA 4IDEA 3GFVA 2QI9F 1AJEA 4NVPA 4NYIR 3DYVA 4TKUB 3UBTA 3ZCUA 3P2OA 5K8CA 3V7UA 4YHHB 4G2NA 1UFVA 1W7AA 4CE6A 1S0UA 4PQFA 4CU2A 1CY8A 4YRSA 2WWFA 4E3WA 4UV9A 4F9FA 2QX6A 3LY8A 4BAGA 1HRKA 3I8XA 5HGXA 5CVEA 4BMVA 3IO5A 1Y1LA 1ZHFA 3N05A 3OSZA 4P80A 1UDBA 1CHNA 5IT9A 2VQFB 3H2BA 4KVGA 2H1HA 3NIGB 2F8MA 2FF5A 5JS1A 3N4ZA 2JFVA 1OHHD 2OEPA 4I8XA 4C0WA 5A3JA 1QIDA 4B85A 2HDNB 4U6NA 2YXBA 4A82A 2RGUA 3OM0A 3GH3A 1FVOA 2CD7A 2IZ1A 2EJRA 1ODEA 5ADVA 2BBOA 3H75A 1F8GA 3A1FA 2EL9A 3Q8KA 5ALNA 4XR4A 5IJ0A 3NJ4A 3OUZA 3HYSA 5TMBA 1XTUA 2I2XB 1QIFA 4I4IA 1IXMA 4I50A 1W47A 2ZW9A 4JJFA 2A0WA 1PL0A 1VM6A 2R6CA 1IZ3A 2QA4F 4YDQA 3RVQA 2OV4A 1KIMA 4I46A 4Y2XA 4JAVA 3G0IA 4PBRA 4MRMA 3CCMF 1ONPA 3FBWA 1QV6A 1VQ6V 1YKFA 1RZ3A 2AXEA 1OWMA 4DXAA 4IDDA 4MQUA 1QP8A 1ADCA 2JIMA 5AOAA 1V2GA 4FFWA 3G59A 4BVBA 2R1ZA 1QAHA 3CCVF 4YDHB 2ZM6B 3SC3A 1U1IA 4ERNA 2DR0A 2C7BA 3FHJA 2EYQA 2JEYA 2HRDA 1VL1A 1POXA 2V96A 3OFNG 2IG8A 2CNWD 3WIDA 1CR6A 2XY4A 3A11A 4DC9A 1R8JA 3E81A 3OQ6A 4EY6A 4LF9O 1RI5A 1UKZA 1EE9A 1T8SA 2EJWA 1S8AA 3OZBA 3ZKWA 4FOOA 221PA 4Q47A 4M22A 4PGFA 1CNEA 1YMUA 1YFLA 4PAOA 2ZDHA 2BDTA 1HEYA 2IZ6A 4Y1FA 1P1FA 4B31A 4XIFA 2WLIA 1MEEA 3AEUA 2EW1A 3QEJA 1A2OA 1FEZA 2CEAA 3HXKA 4QIHA 3QF4B 1NW6A 3V80A 3CKKA 5CA0A 4AO8A 3DMHA 1URPA 1BS3A 1Z18A 3EMVA 4H7EA 3GAMA 4ZHQA 3E8MA 4Q7JB 3RI3A 2QBYB 1JBQA 2H16A 3GARA 2IWRA 4OHFA 3ETHA 2FWIA 121PA 4HJRA 1EFCA 2JW5A 3JCUZ 2X1LA 3QUWA 4CIAA 3NBMA 4X1KB 1RC1A 1SUIA 1GT6A 4FCCA 2QDKA 2DKOA 4PFQA 3TTYA 1JX9A 1HX7A 5BYKA 3TRKA 4URXR 2I62A 3DBVO 1GV1A 4M1MA 4PNZA 4UUQA 3VGPA 2X9LA 3NTXA 1Z0FA 2JIDA 1U0BB 1JJVA 1S77D 4DSTA 1QRRA 4PLCA 3TD4A 3IH5A 1RPRA 1RU3A 2C77A 4ZVNA 4EY3A 3UT6A 1DT9A 3W1EA 5DM2A 1ISJA 2ZCUA 3KE9A 4FGLA 5DDIP 1W94A 5IJXA 2PXAA 4LHSA 1CQIB 2LBWA 1UBEA 1I2BA 3G0OA 1I30A 3TETA 4NYJR 4GCZA 1S8OA 4Q03A 5FORA 4L15A 2VPZA 2GD6A 1KVTA 1K8AH 2Z08A 4UHFA 1RAGA 1NUAA 1KJ8A 4B6OA 5IYZB 2Y0PA 2QZ4A 2YH2A 4MW4A 4R98A 1CERA 5AKZA 4B3HA 1LPAB 3A9RA 3NTQA 4K9LA 3ZCQA 3SI7A 5JCPA 4A1OA 2B21A 1OFUA 1J8QA 2H2IA 4P7BA 1UKAA 1R3UA 3Q3JB 3LYAA 3RANA 4UTOA 1QKKA 1ZIXA 3NM4A 3ENZA 3SPHA 1JFFB 4ZYWA 3PYXA 3LS2A 4D8XA 3IS3A 1K9VF 2LZ0A 1VDMA 2QVYX 1XI1A 1EBFA 4CCAA 5IJ9A 5E2IA 1LK0A 3GZ4A 3C3TA 4C3ZA 1QC5B 4NZPA 1OU0A 1YRYE 5AVWA 2BFDA 1MFZA 1LS6A 4RMIA 5DV9A 4PO9A 5GJVC 4PZAA 3UK7A 2YZ7A 3MCVA 1HLDA 4LWPA 3R3ZA 1R6TA 3PR3A 4G0WA 3APQA 4WNAB 2R9VA 3SC2B 4LYAA 3C15C 3VISA 4QQNA 2AFIA 1A4XA 4W9NA 4P9PA 3O8DA 5K3CA 1KVQA 1ZMBA 3BWMA 1AS3A 2ALJA 2R8PA 1SD2A 4PJ0Z 2N48A 2QR2A 4XYMA 3VSDA 4LF6B 2HMUA 1NQTA 3ADBA 1NQ3A 1OTYA 3IP1A 4DGQA 2UZ4A 1HDRA 2BH2A 1IHDA 3U56A 4CQMB 3VV2A 5A6SB 4WK0B 3U13A 5B66Z 2QM3A 1W6UA 3DOIA 3SHQA 4MPDA 3GMTA 3T7JA 3ZJTA 1OPXA 2FX5A 5CITA 4QJ5A 1EA5A 3IVGA 5DWQA 4F4DA 4DIMA 1DCKA 1JJBA 2QW1A 2FPGB 4NAUA 3FYUC 3VNSA 3GLQA 2H4YA 3TINA 1H5QA 1VQ7F 2HJDA 4G85A 2HRRA 4Z1MD 1TI7A 4LTNA 1G18A 2F59A 3B1FA 5DYIA 4ON9A 3A9CA 4YV1A 4PC6A 3FYUB 3DLPX 1B42A 1K97A 2DE0X 2BWJA 1DJQA 4P3PA 1BTOA 4PZZA 1A7JA 1ORRA 2D2XA 1KDYA 4F6LA 3GHHA 1F6BA 3PXDA 2VAVA 1MHPA 1I4LD 3GG9A 2FFBA 3PNVA 2YJNA 5EHNA 4MUGA 3FUTA 4BFCA 2OD7A 5A2QA 3WOVA 3KKEA 1CK2A 2HK6A 3RU2A 3U09A 4II3A 4A0FA 2ZRGA 2R8EA 4JB2A 1AB5A 1IY8A 1LDBA 3UMBA 1NZDA 3DTUB 1MLDA 3D0QA 2ORYA 3BBPA 2GTPA 3PTZA 4G0XA 2H0AA 1NIJA 5EEGA 2FG7C 2PVPA 4KPUA 4JOQA 4A36A 3KB8A 3OTGA 5JYDA 4MXDA 1ZK0A 3JAWA 4G56A 4ZV4A 4P34A 3VU9A 1LTQA 3DR5A 1E5QA 3FNQA 5JAIA 2Q3MA 2YVLA 3USCS 4P93A 3ETGA 1AA6A 3OZXA 3C45A 3WJRA 2UYCA 4G9EA 3HFJA 3G2PA 3FB8C 4B4UA 1CUJA 3OD5A 5D5PA 4IMJB 2CCJA 3F0EA 3ZW7A 1I0LA 1GZ7A 9LDBA 4DV0B 4TUYA 2GK6A 1F2TA 4ZOQI 3R7AA 3GEHA 1YHZA 3C8ZA 2YYEA 2NO0A 2WIBA 3UMGA 4JHLA 3LX4A 2PZMA 2PUJA 4TQGA 2BCEA 2PQ0A 1NP7A 1G20E 2SKDA 3EIEA 3DJFA 4YMLA 3C8HA 4KXXA 4RKRA 5BQ3A 3H1JH 5CNKA 4ZOAA 3PLAC 4DHEA 3PIRA 1P74A 2MSDB 1MFPA 2QGFA 1DINA 5F3WB 2WJYA 1CEXA 1OI2A 2WVAA 4E2ZA 4QPPA 4BNJA 2ZIXB 3NWBA 5K0CA 1NP3A 1H2BA 5JNWA 5FPOA 4UU1A 4RADA 3B6KA 4L8VA 5C8YA 5AO9A 3ZLBA 3ODPA 3KCXA 2GZ1A 4OBXA 5BRNA 3GN1A 1ZRHA 1W1UA 3LDTA 2VP3A 3CTPA 2UYGA 3EIWA 1UOQA 1JILA 4TQ9A 1GCGA 2C7PA 4DYHA 2QNRA 4D7SA 3M2TA 1LEHA 3NBKA 3RT3C 3OIWA 1XD8A 5EZ5A 1AKTA 4BNDA 3Q5EA 1GPMA 2RBGA 1DC6A 4FI3F 1ORQC 3KXDA 2F23A 1TCCA 4DDWA 4D8YA 4GZRB 4KXRA 3AINA 4LKOA 3TUJC 4FR5A 4C4WC 2A0XA 2ZP1A 4OIFA 1ZN8A 1P4AA 3M5WA 3G5LA 1XU4A 2Q6OA 5JEEA 5AVUA 4LCEA 2Y1KA 4EF6A 2C0CA 2XITA 3RG8A 1THTA 5KJ6A 4K8XA 3RA6A 5KAFZ 4MLPA 4RMHA 4MUMA 4XEUA 3JQQA 3QSYA 3CN7A 6LDHA 2PKRA 3TR6A 1MSWD 3PX3A 2OZBA 1OLXA 3X2EA 4QPKA 2OIEA 4JYAB 1XVIA 3JD0A 4MJXA 2AOUA 1DOZA 3DW3X 2FMFA 4UHDA 5H5NA 3W1WA 2HSDA 5JWHA 2D2FA 2YNMD 2PK3A 5DTIA 3JCMM 4DR7O 2I67A 1IY2A 1X7ZA 2LIPA 2FX2A 2LCAA 1ZUIA 3ZLJA 3OLQA 5DTEA 3ETJA 1H2YA 3KJQA 4OGQB 3WGMA 1SELA 5HY0A 4R1UA 4M0DA 2ZR9A 3OCXA 3RSFA 1SN7A 2IRWA 3FWYA 3QMWA 2FPIB 1AGNA 1H94A 4OPMA 3OJCA 4Z4CA 3PHCA 3CE6A 1PQPA 3FOFC 1CZRA 4NCAA 4QUGA 4CMEC 2Q3CA 1B04A 2X6CA 5KSPA 2RGNA 5LKAA 1QU2A 3VTIC 1GAEO 2ZATA 3CCBA 1VSBA 4IQFA 3ASOC 4UARA 2OT5A 1DO8A 4FFLA 1B6QA 5DBIA 1VA5A 3STHA 5IVHA 1CF9A 1XKXA 2JFOA 1NU8A 1KMNA 4Z9FA 4QDJA 2AMJA 3ITNA 2QM0A 1EGMB 1P0QA 4MW9A 5IC4A 1Y3CE 3ASOB 4YTEA 1RVV1 4N3NA 3BAFA 4NU6A 3ICCA 3AT1A 1BC5A 3BSYA 4U2KA 2GEBA 4B3MO 1IL0A 4MW0A 4LOHA 4LY9A 4KR6A 2E5WA 5AW0A 3CR8A 4CH3A 3EUFA 1M90H 4ASUG 2W2VA 1E8DA 2GN0A 4D9GA 4GPZA 3TD5A 2K1SA 3CUKA 4F1WA 1XTSA 4X64O 2VRBA 1U2SA 1NVKA 2R1TA 3HL0A 4F46A 1H6CA 4R2XA 2IYAA 3MB8A 2VTBB 1JAYA 3FDXA 5FYQA 3QUTA 3ZDFA 4I0XA 4XX1A 3SU8A 3F7YC 4RJTA 2OKGA 1RQPA 4PZDA 3KJXA 5GMOA 4HDRA 3TLKA 2DZDA 4PRZA 2IXAA 2PU7A 4QGHA 3KUDA 3U4IA 1YS2X 1P7YA 3E18A 4J1QA 5KQSA 4K6FA 5B1EA 4LXQA 1GOTA 3FPFA 4BBZA 4W6QA 4P35A 3TOXA 5EB0A 1A5TA 3A7EA 1B16A 4UUBA 3CX5F 3VO9A 2V7PA 3C85A 1CY0A 3EXAA 2D2VA 4R83A 4D80A 2X0FA 3NOOA 1E0KA 3CCMV 2EVWX 2JPDA 2CKMA 2FSIA 4RTKA 2AD5A 5HVNA 3CONA 3ZUGA 4UTXA 1R9NA 4MDFA 3GY0A 3CCVV 2AG6A 2QZPA 3U3RA 1L7OA 4MA5A 3QXSA 4PBSA 5DM4A 1T6BY 2WLTA 5AVYA 2VBCA 1V1MB 3ZVMA 5CLJA 1I2ZA 4N3CA 3ZU2A 1NLUA 4Y2GA 1VQNF 5FFMA 1HYQA 3VR4D 1X42A 1B1AA 5EMNA 5KJFA 2OXCA 3UAYA 3TQTA 5JD5A 1THMA 3E9EA 3PXEA 3K9WA 4HATA 4BTLA 3WJ1A 3E2PA 3GLIA 3T3PB 2CCKA 2NU8B 1CUHA 3KPYA 3E1KA 4GZ3A 5EUCA 3WKDA 4HOYA 5ABPA 3FPBA 2POCA 4Q05A 1MNQA 1TMYA 2HEGA 4LWZA 1OFUX 2XZPA 3CH6A 3AUKA 4IOKA 1T4BA 2IJJA 2JH3A 2PLRA 2PBFA 2OWDA 5FHRA 5EIEA 4X8LA 4RMGA 4G27B 3UFXB 4IH9A 3RVYA 1AO0A 1SFRA 2ZD9A 4YLGA 4ID9A 2WINI 6ADHA 4F60A 3Q12A 2DUUA 3K59A 2VYFA 4LV5B 5I8WA 4UV8A 3NQ41 1GN6A 1SKYE 2OORC 4D0GA 2NXJA 5DYYA 1DTWB 3L7MA 1ZUNB 3I9NA 1H8HD 4C0LA 1R4ZA 2CJPA 2ROQA 5KWEA 2X2FA 5LMUO 4HTAA 5BMVF 2WKQA 2CLFB 4IDCA 5KMGA 5BSFA 3SHFA 2B1GA 1FB5A 1M2OA 3WAJA 3T9FA 3RAEC 1R16A 3PUXA 2V9CA 2YXPX 2QRGA 5LP6F 1TLTA 2TMDA 4ZQFA 1T0BA 3D54A 3F6MA 1TM5E 3H7IA 2NLOA 1S6YA 3LE8A 2TSYB 5B2EA 4ZV9A 1I3CA 2Y4OA 2OZEA 1XAJA 3H1BA 2QLJA 2YEVB 4PZPA 3U61B 1LA2A 5LN1A 4GZMA 1CZHA 1SKBA 4BAUA 4I1OA 1FFEA 3O8CA 4I4TA 1SERA 2GLTA 4JVMA 3L0CA 1XPJA 1OLSB 3R0JA 1KFKB 2BFFB 1SXJB 4Z7QB 4IJWA 4LQDA 5C3MA 2P1DA 1AUOA 3R5FA 4IIJA 3FMPB 4K9PA 3S4YA 5JYEA 1ISFA 1ZIDA 4YHHO 3JVIA 3CCQF 4BO7A 5ALGA 3MT7A 3LP6A 1TA8A 4QE9A 3C9RA 4K9NA 2WT8A 2J5BA 1M76A 2HF8A 3QWIA 5ECWA 5EXSA 3HCBA 3FTDA 4G1FA 1PHPA 2UXXA 3KVNA 3QU7A 3OAAA 1NXOA 1S2MA 2VQFO 5D3ZA 3SMQA 3TAXA 2GNOA 3L8EA 4ER5A 4GC5A 1S2GA 3WGGA 3LG2A 2EOAA 1JDBC 4H59A 4X66B 3HE3A 2WQ6A 3DW1X 1ZVJA 4QUDA 3H2SA 2GQ0A 2ZU0C 5BQ5A 2R70A 1W2WB 4C4PA 2KBFA 1JDBB 1UMDA 1U0FA 3JS5A 3HVIA 2C92A 2P0YA 4LOJA 4JUBA 4FM2A 3LWDA 2I3BA 3SJCC 3V8RA 4DLBA 1KYXA 5JAHA 1XMVA 2IITA 5ECYA 1JLSA 3WLLA 1P5RA 4D5GA 3AJ9A 2Y6VA 5KTOA 1MW9X 1PJQA 4E6EA 3IJEB 3KBBA 5HCUA 4MCIA 2F43A 3PSHA 4HQOA 2GUZB 5HBGA 1O6FA 1Z62A 1VQ7V 2VH5R 1V1RB 5CIWA 2O1XA 4FYWA 4PG5A 4B2IA 2WR8A 2KB0A 4EUKA 2ZM6O 1E3SA 4I9FA 3EF3A 3RC8A 3RVZA 5KX5A 1RI2A 4EB0A 4OJTA 2VZEA 2LGQA 1I4OA 4N3AA 3VTZA 2GBOA 4JB8A 3AU8A 3NT4A 4QBTA 3L7LA 3EBLA 4ESEA 2DPMA 1FRQA 1TF2A 1H48A 2QJFA 7MHTA 2CFIA 3AH8A 3T6KA 4YLEA 4Q15A 2DQSA 1UAYA 1JR6A 4WBNA 2QL5A 3JYLA 2GK3A 3R3JA 3CO0S 4XOIA 1RHMA 3T7SA 2ZM5A 2VUUA 3BXFA 5ARCA 1UK8A 2HG5C 3QEKA 1NKSA 4JK3A 3VMFB 1DTSA 2ZE7A 1GG2A 1XPUA 2HNBA 4F71A 2EQ5A 3KKLA 2PSEA 3VYTC 3VBBA 3K4QA 2J9YB 2AFIE 2Y0IA 1WB4A 1VIMA 1GRVA 3K2BA 5C4MA 4BQFA 4GECA 3K9NA 4X8OA 3W6OA 2DWQA 3J81k 3C9TA 5FBWB 4UCVA 1DT5A 4I14A 2ZRMA 1XZDA 1EWRA 2JFYA 2MSEB 1KDRA 3VYTB 5HY1A 1Z38A 5KPJA 3P96A 2EULA 2X40A 4YRDA 5HPYB 16PKA 3ASVA 3GPIA 4CKBB 2BMFA 1W0JA 4G81A 4GD3Q 3H1EA 1RI3A 2PUGA 4CT5A 4CH6A 4UM8B 3A9WA 3HA7A 3P0JA 5DASA 2X9VA 5LGTA 1F7UA 5CH8A 4WDQA 4OP3A 1L5HA 4GLFA 4D9JA 5M7EA 5HKAA 4G4IA 4A27A 1DPGA 4Z4HA 2IYLD 3NH6A 4KAAA 4WY5A 5JSQA 1JDSA 5COAA 1CLIA 3ZV7A 4DMHA 2W2LA 2P2NA 2UKDA 4IHKA 3ZHUA 1CR2A 1XLWA 3Q9SA 1YZVA 3U4MA 2SCUA 2MK3A 2R48A 1LSSA 2NIPA 3MJSA 4BFUA 4L16A 1GAXA 4RFSA 2X2PA 2AUNA 2XB2A 2CDCA 1DWOA 1EFHA 3CEIA 3C3SA 1NLZA 3F0FA 5JAMA 3QW2A 1X8LA 4HGNA 4DG8A 5FTKA 1PJZA 4AAYA 4L5JA 4PINA 1PN3A 4JQZA 1Y37A 3HP1A 1GNPA 1PSZA 3U7RA 3EC1A 4YA6A 3G68A 2ARKA 3T5BA 3BBLA 3BJEA 4WHMA 2HI0A 3LUJA 1YQNA 1F06A 4RHEA 1IXRC 1ZL2A 5FHQA 4MQ4A 1YCHA 4A2WA 1GNVA 5IVIA 1G291 1KC1A 4TV8B 2WSYB 5LOVF 4MQFB 3T1QA 1CQJA 4Y2QA 1XG5A 1V9PA 3ZDEA 3LNMB 4G4GA 4EY8A 2OZLB 3KV3O 1X9HA 5HZKA 1O2DA 4YBRA 3MERA 4KYVA 4S24A 1LWOA 3JQDA 2EIKC 1VF5B 2CSUA 4CF3A 1V48A 4KOAA 3W4JA 4IJ6A 1HG0A 3ZBHA 2B4QA 4OYRA 4JX8A 1AQ6A 3Q6NA 1SY7A 1QF6A 3LIPA 3W5JA 1CR1A 4FJCC 3I04M 4LRTB 1HDIA 1YTUA 1YJCA 3KZNA 5TT0A 1REQB 4MRVA 1S72F 4HGOA 4YCBA 1ZX3A 3KLPX 3E22B 1T6ZA 3L6OO 5AW9A 1KO8A 1JBEA 1Q7YW 2J5KA 3IBFA 3Q1KA 3DKKA 1ZZEA 4A0GA 4GRDA 3T94A 1VG1A 2D0OB 1H6AA 1YT5A 2F8SA 1JPUA 1ISGA 4BVQA 3STWA 1ZSYA 2JGNA 4KXQA 5DLDA 3DLBA 4RLFA 1IDN1 4D4JA 1AXEA 2NM0A 2JAUA 3BD7A 3I12A 2ZZNA 2HQ1A 2V45A 2ZIWB 2JJ1D 2ZB4A 3ZE7A 4RZ2A 5MF6A 4CWAA 3K94A 1YHYA 4PHGA 1XLTC 1SQGA 4W5HA 2CYAA 1EDDA 2FC3A 3Q0TA 3BF8A 3O74A 3N59A 2OCXA 3R7LA 1JN1A 4PYKA 1DNPA 3ZRWA 4CM4B 3OPYA 1WNTA 1IZ8A 3HWX1 2Z3ZA 5TISZ 1JXQA 4CEIB 3P0ZA 3TRJA 1HR0B 4U5XA 4P84A 1Z29A 3OEEG 3I9LA 3C3CA 1AXGA 3IQZA 2QRVA 2YN0A 4CU5A 3S29A 3EMBA 4TTJA 4ARZB 1DB3A 1B74A 1WZUA 1P0CA 4LC9A 4HWOA 1QX3A 3SYLA 5L53A 4C7JA 1EXMA 3DUFA 2Q3BA 2FPOA 2QNBA 3ROXA 4X97A 3SEAA 1RYBA 2GXSA 5A03A 2VQDA 5I01A 2RGAA 1H23A 3VU8A 2AKEA 1T1JA 3OWOA 1G3RA 1OAPA 1NN3A 4ND4A 4CKCB 3B3FA 4F5WA 4QJBA 3GK3A 3DLIA 3MWJA 4UREA 4DV0O 1LF5A 4JYZA 2LWIA 5K03A 2YVKA 1P9RA 2DQZA 4H18A 3DXFA 1JDVA 3BKWA 2F4VB 3C5WP 3ZNOA 1R6VA 2AVDA 3UJ7A 4C81A 3LQYA 2H94A 3Q5GA 5AXDA 1KO5A 4RLHA 3TR5A 1C3OA 2NUAA 1EWQA 3LT4A 4XJVA 5FQNA 5HM6A 5IULC 5MHTA 1EZ1A 3ZBQA 3WYCA 1HE8B 3FAZA 3EG9A 4HDNB 2QTAA 3QOWA 3SBEA 2CHGA 4ZEMA 1TYEB 2WTXA 1WQ1R 3O4IA 5JXHA 5KPDA 4NR1A 4MGYR 2UVPA 1J95A 3HUTA 3ZVKA 2VWKA 4IOJA 4TVOA 3SC4A 1ZH8A 1ENYA 3JAMN 4EHBA 5IAAA 1JDTA 2QM4A 3HYCA 3GO4A 1QONA 3LYHA 3UG7A 2BKVA 1ZITA 5A4IS 1O97D 2FPPB 3EAQA 1U8ZA 1G20B 2B83A 4IJVA 1SESA 1K5GA 3QE9Y 1EK2A 3TJZA 2O8DB 3RJMA 1HDCA 4AWXA 1Z6PA 4KSCA 1QQBA 2ETVA 1C9EA 4NH0A 4INOA 4IFTA 1QKJA 4I8DA 3TEFA 1X7PA 1GTMA 4BUCA 5FL3A 4TYWA 4PZUA 3PJDA 1O6BA 3R3XA 2W6JA 5AVSA 3OMNB 3LVFO 4KACA 1JEAA 2DR3A 1I32A 2OAP1 3II6X 1KNKA 4K6HA 4HAIA 2A1TR 4Q66C 2HMTA 1SOMA 2RGDA 3FVTA 4XDZA 2ZVQX 3WFVA 3LF1A 5L6MB 5K5EA 4CMGA 3A2LA 5JMPA 4JYAO 5JRDS 3MIZA 4O2AB 4B4OA 3GJYA 4OA5A 4FE3A 1JPVA 5FUYA 1OCCC 3FJOA 3HU3A 4B1FA 3LCMA 4A0QA 1MX1A 4EMBA 1KU9A 3QNEA 1Z16A 3GD5A 2FWNA 1PD1A 5F23A 2RE8A 3OZDA 4DIOA 3B7WA 1YF2A 3VH2A 4G9BA 1OCCB 2RHLA 1ODKA 1IBSA 2NQTA 5B58T 1OFHA 4PEVA 4CHGA 2VWPA 1XKQA 2F3UA 1Z3CA 1A77A 4FMDF 4TVSA 2A94A 2O07A 3IAAA 4J29A 3OCWA 1P7VA 4REOA 2QRJA 3AG7A 3PX7A 3D01A 2PBLA 3NC4A 1V41E 3GEIA 5AM3A 2PYDA 5JCJA 1ZK4A 3GLIE 4G1CA 1SQQH 4G4WA 1E2HA 5G40A 2AN3A 4ZPXA 1I9CA 1MPXA 1JKIA 5CDHA 3JYPA 4MSUA 4EQ6B 1ZS9A 1J23A 3ETDA 5LYJB 1Q5PA 1X9IA 1DK1A 3ZTWA 5IT4A 2NVWA 3NPMA 1GG5A 4AP9A 2Q2VA 3CP1A 3ZV4A 2DWEC 2V59A 2J33A 1OPRA 2HREA 3P20A 1RXWA 4LXTA 1ZVKA 2BZ1A 5CFLA 3G82C 4UE2A 4YN3A 3C9UA 3R0PA 1P0PA 4IEIA 2A88A 1ZM9A 4R2IA 4R8MA 2J0SA 2YWHA 3OJEA 1OIVA 1T9GR 4Z4IA 4WZAB 2JAHA 2B35A 3UMJA 4F6RA 4I3FA 2XX3A 4B0PA 4MDYA 4IEEA 3NG1A 4WE3A 2ST1A 4TYMA 2PQ6A 4L5CA 1SIWA 1Q6HA 1C1XA 2QVLA 1QTQA 1Y7TA 3HV0A 1MMMA 3RYIA 1XZGA 3LPAA 4EL5A 2VQSA 3DFIA 5E2AA 3LCUA 2HSJA 4KQGA 4HDMA 2PX4A 1KFJB 2YS6A 5B3KA 2O4UX 3W2EA 3OTHA 3WL6A 2V7VA 1QZZA 1QR2A 1YC5A 1ZL8B 2VDOB 1YR1A 3IHKA 5HE8A 4IH4A 3MCZA 4ZOLA 4LOIA 1R50A 5AVMA 3IELA 1X7OA 2PUWA 4FYYA 4FCWA 2JLVA 1W0KA 5K0FA 3G3EA 5C31A 4OSPA 1Z8NA 2ZBVA 1P81A 3DHNA 3AF5A 2VS1A 2Q4DA 4L22A 1S96A 3TLGA 2WSLA 3EPRA 4DN6A 4G0UA 3C5HA 3A1CA 1A9PA 5EC2C 2E6KA 2RIPA 4WACA 2QVXX 2IQQA 3LYUA 4JSYA 4LJ6A 3N2LA 4BB6A 2FU5C 1TAQA 4J11A 3CXHF 3P32A 3QU4A 3RG2A 5JJ5A 1JIJA 2WHXA 1U5AA 4XVHA 1V95A 3PC6A 4XDYA 4Z4EA 2Z95A 1BE3H 4XDHA 2XKJE 2O3UA 3MWDA 1SZDA 3O73A 3BB1A 2DQYA 4EFEA 2PPVA 5BW6B 3MRXA 1YQ9A 1R3DA 4GLXA 4ALLA 1IG0A 4EW3A 1T5SA 2FFJA 4BMPB 3OOWA 4XDGA 3EMDA 3AM1A 2G8NA 3SIVA 3HR8A 1H2LA 5F2KA 4P7GA 1E63A 3UKMA 1XQWA 4DSAA 3X1XA 1VQ4F 3SZ3A 1ESZA 3KE8A 4JJZA 5IY5C 1Y7LA 1R1BA 1NLYA 5MGBA 1GYPA 4PZYA 3KJZA 1YS6A 2NNUA 4G4SO 4LMRA 4QTXA 5TQ0B 3TNJA 1ZN7A 4NR0A 1US8B 1EX6A 4AICA 3OFVA 3LXUX 2YIBD 4NYKA 4MVJD 2AI3A 4URYR 4J7AA 5IY5B 1ZM2A 4Q48A 1JJ7A 3TLJA 1X7WB 1JJAA 3T1OA 2A9KA 1GRCA 4KKVA 4DUZB 1LVHA 4IY1A 4I55B 4R31A 1M0WA 3WXMA 3B1JA 3GCDA 1G16A 1K8QA 4A2PA 3OOEA 4RELA 1T13A 4LPSA 3UY4A 4MA0A 1P8AA 3GRRA 4KK3A 3E8HA 4W4LA 2H5IA 3THSA 4BWFB 4DMFA 1M8FA 5AVQA 5ALLA 4N01A 3EUWA 1RIIA 5KHIA 2FRVA 2IV3A 2IODA 1K89A 4C5CA 1Y8RB 3B9BA 1SBNE 4JAVC 4QIWF 3C14C 5F2EA 1FZQA 2QQGA 3KE1A 2FPRA 2G63A 2O2YA 2UZIR 3ISVA 1SKYB 3UPDA 3UC5A 1G38A 1UJCA 5CCEA 5FBHA 1GXSA 5TPWB 1PJTA 3U37A 1D0IA 4JR2A 3QHAA 3QPBA 1INLA 3PJSK 3G8CA 2D5LA 4B3SO 3HC7A 1I6MA 1H8ED 2GN9A 3R5HA 5M29A 2ZQMA 3HRHA 2IVZA 4HP8A 1JHVA 4X84A 2OFPA 1RJ9A 1EJ2A 4QODA 2JVDA 1LDGA 4Q3NA 2AOWA 4HPXB 1XREA 3PA8A 3GQVA 3IE1A 2Q4OA 3JALB 5HRCA 4Y67A 5BSMA 4I1SA 3K03A 4NEQA 2FUCA 4EUEA 1Z6ZA 1YDWA 1JZTA 4WIAA 4LF5B 5CYOA 4OQQA 4GMFA 3AB7A 1F7YA 5EKSA 2DCUA 3I5MA 4NZYA 3FWZA 4IX1A 5TGZA 1C3VA 5FI3A 4WK2B 1JQEA 3A8TA 4X66O 3LWQC 4QTYA 3TTWA 4N5DA 1JEEA 2WUGA 2WIGA 3N86A 3FKSA 1DIOB 3IILA 2R6ZA 5I7AA 5K2MA 1UJBA 3PFHA 4AILC 4H17A 2D0DA 2C4TA 5DO9A 3U3ZA 1ESMA 1QHGA 2P9TA 3WPXA 5KNCA 4X93A 1Z6TA 1TU3A 2UVQA 1KJJA 3K5PA 2I54A 5H68A 3ZE9A 5EVCA 3PLRA 4UBMA 1U90A 1S72V 1FNDA 1E3TA 4PAMA 2Q8VA 2VT3A 3KR1A 1F51A 1ULBA 3JQ6A 4ZODA 3G7UA 3RS0A 3WIOA 1RYHA 3K73O 4YASA 4FBGA 3IIKA 1BDJA 1G3IA 4GPAA 4K0KB 5D5QA 4GWLA 3F8SA 3L4BC 1IHUA 4KSBA 2ID8A 1MF7A 5JSKA 6REQB 4ZT6A 2B7CA 4NPCA 3WQQA 3JD3A 2G3YA 5LIRA 3IKMB 2B6NA 3QE4A 3ZV3A 2QN6A 1W88A 3UQ8A 4WPGA 4H1TA 3BA1A 3SM9A 1KSGA 3R20A 1BEUB 1ENVA 4S2UA 1GTRA 1KEVA 4CCWA 2H65A 2WTAA 2NTVA 2GDSA 5KAIZ 3AF1A 4C0BA 5FBKA 5BYAA 4RZHA 2M1ZA 3WZ2A 5HDQA 3CW8X 1YJXA 4J43A 1XVAA 2GRUA 2KG7A 4DV3B 4YJFA 1XVVA 4YRLA 3NEYA 3A0BZ 5AVZA 1SBYA 2WWHA 3VAYA 1KYOF 4BBAA 2OHWA 1KAEA 1JDUA 1L5VA 2IIPA 1Z8FA 3ORFA 3R7WB 2HH9A 1XR3A 1BE0A 1IY0A 3HADA 5IKXA 1RM4A 1LK5A 3GROA 4OHBA 1Y74A 3EASA 3FMFA 2H5JA 1Q81W 2GUWA 2GN2A 1ZJ6A 5FLYA 1HTTA 3RVOA 1KKUA 4YJ3B 2VPTA 2A0UA 3SX2A 2XT6A 1E4EB 1KB9F 3N5CA 3D8RA 3QEBZ 1RAIA 1XYGA 1G9TA 4CI9A 4BNKA 2JGIA 3BN3A 1L7BA 4P3OA 3EWIA 2C7OA 4HRXA 3UJ8A 4WLVA 3S55A 5EHIA 4QXRA 3AKDA 3H2GA 1XF1A 3UWDA 3HFGA 3G9XA 1OXSC 3KKOA 1XCOA 2DG2A 3OJLA 3MPOA 5C4GB 1DJPA 2H4FA 4F4IA 1AOXA 1H47A 4WFIA 2RHBA 1FSPA 3OCUA 4LQCA 1WCWA 4ER6A 1XJWA 3P1JA 4MOWA 2GBGA 3A4YA 4MQEB 4JU8A 1RNLA 3X1KA 2J3MA 3OBBA 1EM6A 1SC9A 1VDZA 5DX1A 1DFIA 2PSFA 2QXTA 2ZUBA 1KBOA 1WZNA 2GJSA 4UU0A 1JJOA 1WVMA 2BM9A 1PGPA 4RSRA 2BI7A 5DN6D 4MR9B 1NQVA 3G8AA 4MTCA 2BHNA 3FMVA 3NUZA 3BUSA 2JFZA 4M36A 3S5JA 1TD1A 4X94A 3N28A 4MZXA 3ZQUA 3U4GA 3W7TA 1XZBA 4R40A 5DLQC 3QF7A 3OD4A 3U49A 3HO1A 1EE2A 3T5GA 2D1TA 4A0HA 3W4KA 3GVPA 3DHEA 4RL4A 5FUXA 4DARA 3A2MA 3U7JA 3UGJA 4PSKA 2W90A 3HB9A 2W4IA 3STVA 1IQRA 4B74A 1OE0A 3GPDG 5FOTA 1WBJB 3GDFA 4FZVA 5KYKA 3W5SA 4Q82A 5HUQA 2M9MA 1PDVA 3CNNA 1ITZA 3HBNA 3CC2V 1ZUQA 4MVSA 3R9IA 3GUYA 2R72A 2CN1A 1CCWA 3S1AB 4J0EA 1X52A 1P2SA 3ANLA 4AMVA 3LP8A 4I99A 1DKRA 2G25A 5BPHA 4DJFC 5BN1A 3S68A 1PFKA 4QJIA 4JI6B 1W5AA 1IBKB 4PZ9A 3KZVA 1Y3IA 1P60A 4RV4A 4PA3A 2OV6A 4YRCA 3WIEA 3TBKA 1EVLA 4QVKA 3FYEB 4WTOA 4JYCA 4XIJA 4O4JB 4IJKA 2PY5A 2CVZA 5A9RA 1GN8A 4WASA 3B3AA 3F6PA 3FFQA 3IBSA 3FCSB 3BFPA 1D09A 1VXRA 3EIUA 4GXRA 4N7RA 3EGXB 3ZGLA 4RK4A 4C1NA 2B33A 4KMRA 2PMBA 5DSTA 3NZEA 4LC0A 3M3DA 1V7ZA 5EHXA 3IDFA 4XWOA 2YIVX 1YB2A 3FROA 1CIPA 2OMKA 2RMKB 2OHHA 1PSWA 1SS3A 4ISBA 4BNFA 1SOUA 4Q1DA 1I1QB 3T1VA 1BXZA 2WM9B 4B8YA 3JQRA 4K8ZA 3WWOA 1T5LA 1KU0A 2CW4A 1QR6A 4HSGA 4HLQB 1WSAA 2O1EA 2CT8A 1PR6A 3N6XA 4BP9A 4BIOA 1EG7A 1Y3AA 3GFQA 3CLVA 1Z8HA 4BAZA 5DNVA 1K5PA 4M9SA 4Y98A 3UO8B 3KQYA 2HYIC 1M1NB 3GT0A 5L3VA 1F2UB 4Q7KA 3EXFB 4IXMA 2YWDA 4OJMX 4DV1B 4AF7A 4YI3A 3KKPA 2XSZD 2QTMA 5LJLA 2JCGA 1OH7A 3NWJA 2QL7A 4H1UA 1IVYA 2CXNA 4F2WA 2LBTA 2H48A 3FUVA 4XD7D 1TF5A 3JQ8B 3RAGA 5ICEA 5F9HA 4EH1A 4YUYA 2YYSA 3EF0A 4LJ9A 3IRUA 3BGDA 4KV9A 4ZYZA 2RC6A 3KKZA 2AF4C 3K0SA 3INNA 3FZGA 2OHFA 3BMNB 1JOYA 5JJCA 4V02A 2Q8NA 2PWYA 2QTNA 1QHYA 4XRRA 1A98A 3OQBA 4D46A 4YQZA 3ZVNA 2BKEA 1ZBQA 4L2IA 3DTVD 2XOKA 3H86A 4RE6A 3Q1LA 2P7IA 3H5RA 5LBTA 1A69A 2F4VO 3WB2A 1U2TA 2IH3C 1E9BA 3OKAA 3BM5A 4XYBA 1USUA 3WTBA 1VGQA 4CTMA 5I4CA 5BR7A 1RRPA 1G4HA 2DYRC 2B30A 1G63A 1FXWA 4NU5A 4K46A 4L5BA 3ZH2A 4Q18A 2EBHX 5KC8A 1X4TA 3A26A 5FWXA 1NMYA 1YI1A 3VHQA 2DYRB 4D42A 5TB5A 5FKJA 1PO7A 2WF9A 1R3LC 3FD6A 3L6UA 4A8HA 1E1RA 4EITA 4FYHA 3K96A 2V97A 1H2ZA 5DTMA 1I7NA 3IHWA 5KQPA 1PV4A 3LDCA 2V3CC 4MVXA 2NPFA 1DBFA 4GKBA 3A9VA 4DPMA 5B1DA 1MJGM 4DIFA 1DJOA 1GQYA 4R50A 1FRNA 4N0MA 4MI9A 2W4MA 3KT0A 2Y1LA 4Q1AA 3S3WA 1X7XA 1DBSA 1NBAA 3PC3A 4IIGA 1P9WA 1W5TA 5HIMA 1XTPA 2J59A 3TZBA 3LSUA 1YDFA 2QEQA 4YJHB 5F1KA 4ZCQA 5F73A 3GELA 1NJ6A 3ZMTA 2Z2JA 4O6VA 2NP6A 3LT1A 1FFHA 2P2LA 2C2ZA 2Q4EA 1Q21A 4I2NA 2Y71A 4RCVA 3N8GA 1LNQA 1VQ4V 4A5SA 3CLTD 1DGSA 2PGLA 1W9MA 2NXNA 4FQ7A 4JL6A 3UGQA 2MMCA 1G2PA 5IX8A 3JZFA 1SK9A 4TOIA 4M7PA 1SU8A 4TTIA 2OXTA 1KXJA 3PNQA 4DJJA 1HDXA 1A95A 2XVXA 3ZNNA 4ZYXA 4KL1A 2SECE 2XMPA 2C84A 1FE8A 1N6KA 5K6TA 1WKCA 2XT9A 1JEJA 2B82A 4LDZA 1HDOA 2X4LA 1L7VC 4GOOD 1ILEA 2AYYA 3ILVA 2VHZA 3I01M 3G17A 1GUAA 4CL8A 4E4RA 4EG0A 3ZXXA 1JAHA 3HXOA 2DW4A 3VTAA 4IHQA 1HE2A 1X1AA 1KECA 2PUEA 3WFZA 2H29A 2VHUA 4QEDA 2ZG6A 1AKUA 3H9GA 4UFNA 5IDJA 4MB6A 4Y6PA 4KWTA 3R8CA 4MQMA 4G26A 1E5TA 4F4JA 1QNLA 1A9ZA 5I9LA 3C5VA 3WBKA 2VPIA 3WDKA 3HDHA 5H81A 4BNMA 1M5TA 1GQOA 2OUKA 3LIIA 4C87A 4JMLA 4QGBA 1KORA 4BXOA 2JKZA 3V2HA 3MMPA 3B2EE 1XCJA 3GFGA 4TS4A 5IDXA 4AMGA 5KHHA 3L18A 5EPOA 3FA2A 1OAOA 4AZWA 2AHYA 1CY1A 3KL2A 1ZIPA 3GAFA 1JEYA 5F7JA 4URUR 1ZD1A 2J85A 3EARA 3TUZC 3I6ZA 1Y7PA 1R00A 4IGEA 4XSVA 3ZVRA 4QLOA 1Z2PX 3PI7A 1Z2NX 4C2BA 3GFTA 2PWPA 5IHXA 1R18A 1BCSA 2BGKA 3F5QA 1JTFA 1I5EA 3PQ2A 5ALFA 4J7JA 1MB9A 4E09A 1K5HA 2NOAA 2BEVB 3CPHA 1I6WA 3VU0A 1VCNA 1E69A 4BLTA 3IX7A 2I4OA 3RS4A 4JTCB 4REQB 1UH5A 2Z8YA 4BIIA 4L1KA 3LW7A 3D3NA 5AUNB 4WFGA 1SHTX 1Y9DA 3L5OA 2D4HA 1YQUA 5TQ2A 4FZ1A 3T9CA 1K6MA 2JD1A 5IM4F 1HW7A 5JSYA 5KNBA 1Y6RA 1OCOC 4POAA 1AR4A 4A7PA 1M8JA 4TL6A 2Z5GA 5HKOA 2CB9A 2HM7A 1ANKA 1RAHA 2WKSA 2XNDD 1JR4A 2XA9A 3FNIA 4XUCA 1PQYA 3ABSB 1YR8A 2AZTA 4GP6A 5DH9A 1OCOB 1E1MA 1R73A 1XMQB 1XA3A 2WM8A 4XWWA 4GO1A 3SZOA 3PWTA 1W48A 2GHIA 2WJGA 5FB3A 3T1TA 5B3LA 3HCEA 2C4VA 1CJKC 3GNTA 1VL6A 1YR6A 2PWAA 3HJTA 2GN4A 4RDXA 3EPJA 3IEPA 1DAPA 1DVRA 2G80A 3QRWA 2E4VA 1FRZA 1OV6A 4MV4A 3H18A 4MV0A 2D13A 3E5RA 2JAXA 2YCLA 3RYHB 3JSLA 1ZXXA 4L51A 4S3MA 3AR4A 4S2EA 4O2BF 4O0MA 2Z4SA 1J5EB 2B1RA 5DM1A 1I2AA 3OPQA 1HWYA 2C78A 4WZBA 4K3AA 4V0MA 4EO4A 3FYIB 5G0WA 2SICE 4Y6LA 4J94A 2R25B 5REQA 4Z3KA 1DKLA 2WAYA 1H2SB 3RFTA 1G3MA 2XZTA 1UZNA 1K7SN 1RKQA 3IFXA 2FZKA 2G9NA 1RJGA 5EY5B 1XZEA 3U81A 3F7MA 5GM1A 1MQAA 3X1WA 3PTLA 1P84F 3WKEA 4YRKA 3KJEA 4DM7A 4UVAA 5L7WA 1Q16A 4MQ5A 3RWOA 1GU1A 2OXRA 3KVOA 1YAJA 4FLFA 3UOWA 4Y7CA 1GL7A 2UZ1B 5DISB 3DFZA 2FLWA 1K6JA 4G2TA 1NOIA 4BLSA 1HFEL 1Y76A 1CZNA 2JIOA 3KXIA 3H3JA 1UXKA 3KQNA 3VZCA 1VRVA 4DIUA 3Q85A 1JU4A 2LGWA 2OENG 3VPGA 5GPBA 4IUCS 3AK4A 3Q7TA 1E2EA 1DWPA 4DUZO 3K4HA 1V8DA 1F51E 5E7MA 2VT6A 4HVAA 3SJQC 2RGWA 1GSIA 1W29A 1V5EA 3DZHA 1ZFNA 3UA4A 4TKMA 3L9WA 1Y5NA 1E7WA 1WMFA 4H0LB 1T1EA 3H42B 4FC6A 1X0XA 4E70A 4DCPA 2CXHA 3FLBA 3CNHA 4KVZA 5E4TA 4OAPA 1GGKA 5HFMA 1IZ0A 3WGHA 3TOSA 2XYGA 4RVOA 3ETNA 2PKQO 3DE0X 3GFFA 3BQMB 5LD2C 1MJ5A 1TMKA 4G4XA 2F62A 3ZGZA 5GIOE 3UGKA 1CR0A 5GONF 1LV7A 2H17A 4O02B 3WLFA 4YP1A 4NP6A 4RY0A 2XEDA 2EHDA 2RHCA 1AQYA 1VRWA 1G6Q1 3N70A 3SICE 2A1UB 4ND2A 1SVLA 3EZ9A 5LD2B 4DMRA 2PH3A 3EXEA 3OTFA 3BD6A 1ICIA 3R8XA 4ENWA 4BO0A 5H0IA 3T7AA 1MJHA 5KOJB 3KTAB 4MT8A 1WU7A 1O95D 1NNSA 2YBEA 4W5NA 3RREA 4MA4A 1BWRA 2OXFA 5B1SA 1GTOA 1D2DA 4DNPA 1LPPA 3AR9A 1GLGA 5AJYA 1T26A 2E4ZA 1VGVA 3CIFA 3LUAA 4LF5O 1CY2A 1QOQB 1GP2A 1IXBA 2W93A 1USIA 1IJFA 4PTLA 1O0BA 5AD1A 2O59A 3IDSA 5EJ8A 4UM9D 2PV7A 3M1AA 3MHTA 2Q5EA 1I7DA 2ZUEA 2CY0A 3W2FA 4KV7A 2GESA 3VU1A 3SPCA 4R0VA 3AY6A 3RWMB 1YZFA 1DL5A 1Q3TA 4CKWB 2R62A 1T24A 1RAFA 1UPAA 2XD9A 3L9DA 5K99A 4CKXA 1VRCA 2SKEA 5JQGA 3O8OA 5D6OA 3X2FA 5DOVA 1PEDA 4QOEA 1QOPB 4EEXA 1USGA 4DILA 2QRKA 3CWBH 3DOJA 3REFA 3D0RA 3RARA 3VPSA 3SJZA 5TF4A 1Q7EA 1ZXBA 2AE1A 5DM60 3TAUA 1KKMA 2BTOA 4F84A 5IKMA 4RV5A 2P4VA 3AEQA 3GW8A 2Q3DA 3DYIA 3BICA 3VAAA 4PPFA 4D56A 3WQBA 3IR7A 4I1RA 3DMPA 3M4XA 4B47A 4ZP1A 2HMAA 4ZRNA 1D5CA 1ZUWA 1G5RA 1EXDA 4RTLA 3I8SA 5ULLA 1R0YA 4FIDA 5LA6F 2GN6A 1TZMA 3LNCA 4JBNA 4OREX 1D2HA 2ASVA 4ENPA 5EQJB 1I0HA 4TTRA 2JFNA 3FNHA 5FTWA 4RLSA 2CZWA 1I9GA 3RS8A 4JQCA 2NU9B 3G6EV 1M5UA 1EGHA 4HD8A 4AZ0B 2ADFA 4HGRA 4KWCA 3OKCA 4JJ6A 2TECE 3H1AA 3DB2A 4BT3A 4N40A 4ZAXA 2WHQA 1OBVA 4H2DA 4DV3O 1XRRA 3STLC 5HCIA 4RVHA 4UDNA 2PZKA 1WXXA 2G9ZA 1TU4A 4JODA 1IBRA 5M2QA 5F9FA 3IPYA 4KBYA 4ZZIA 1VF6C 3DZCA 3NX4A 5D3MA 1AJNA 3G6KA 3AG2C 3DTTA 5E4YA 3BDAA 1WY7A 1Q82H 3LWVC 1JHUA 4G5RA 4Q4AA 4GUDA 1BZKA 4BNXA 4PC2A 4MHOA 3BTSA 4BN5A 5ALZA 1LPNA 3AG2B 1MCZA 1Z6QA 4HY3A 4BEJA 5AW1A 5EIAA 1OZFA 2R6HA 3LUPA 2QGZA 2K87A 3KCNA 3N76A 4R01A 3J80M 4PE5B 3FZYA 3A4VA 3I61A 1DRUA 2G08A 3PIIA 1U81A 3OI7A 2ZAUA 2PO5A 3RODA 2ZR8A 5DHTA 2OGWA 4WNIA 5AK0A 2P4SA 1OJHA 4B6PA 1KZ9A 3M6AA 2QQ0A 5EPUA 1WULS 3H8SA 5B7NA 4LCJA 3VZSA 4FZ0A 1NF9A 2HJ9A 1JG7A 3L0PA 3RVSA 2ZUCA 2XWJI 2E48A 2VAMA 3GNSA 2QR5A 4MRNA 3W9SA 1XEWX 1UUFA 1G8GA 4X20A 4ZAVA 2YOGA 1JR2A 1GQRA 3GJ7A 4AVYA 3KT3A 2NXCA 3K09A 1QHXA 1SCIA 4DV4B 2VPPA 4FGJA 4QUJA 1I10A 3SKVA 4JI7B 3EGDA 1XMJA 3PN1A 4D92A 4ER7A 4MJ7A 2XIJA 1EQUA 4AWAA 3AK2A 3TKLA 3B3JA 5HOEA 2FZEA 3Q2KA 1A2BA 1T9CA 1SETA 5IABA 3DAPA 1UFYA 3OM1A 5K45A 4ARSA 5LSAA 1MR3F 2ZQYA 4WNCA 1U7PA 5EN4A 1JI0A 5BWMA 3WY9A 4CV2A 1Z7WA 3FE2A 4DMGA 3AR3A 1NQ5A 2BGUA 5E1MA 2ATVA 2VRCA 1Y4MA 4JUFA 2BEWA 2R8BA 4KN5A 3R24A 4CMBA 4RJLA 5B3AA 3OQNA 3Q4HB 1KMCA 3OFSA 3HEAA 4DE5A 3SHVA 1GCOA 3PC8C 4QPJA 4J1NA 4FJ2A 2DMRA 1BD3A 2ZT5A 2HCJB 2EZUA 1NVBA 4JAAA 1WD7A 3INGA 4AX4A 3BWCA 4NMXB 1SQ6A 1YEWA 4ZICA 4QT4A 2H57A 1NTZH 3EAGA 3SDBA 1JIXA 4JI6O 1YULA 1SBCA 5TVKA 5EFOA 5CA1A 4LF6O 1IBKO 4MV7A 5BZBA 1Z2GA 4QYMA 1P77A 1G4AE 2NAFA 3IBYA 2EIKB 3RABA 3HU1A 1HY3A 4ZYTA 2ZAOA 1VSUA 2I03A 2C9CA 2H7YA 1PJRA 3R41A 2QD2A 4DA8A 4U2GA 2JAWA 1R0KA 3FI0A 1AQUA 1FCJA 5TGDA 4NX2A 1YTFD 3OZTA 3LBFA 4FKMA 4E5KA 5BNTA 4P7FA 3JAMA 3VNQA 4XLZA 5H3CA 1SQ0A 1YJ5A 1E3EA 4HB3A 1W4CA 3GVMA 1U94A 4NE2A 4OSOA 3R0XA 1QGDA 1MB0A 2JIZA 1Q0RA 4EEKA 2VSNA 2J9RA 2BJVA 4RYLA 1ABBA 2I78A 4RUEA 3LDHA 3KEGA 2XCSB 3GJ8A 3RVLA 1IVNA 4CEJB 2Q46A 2ODWA 5JASA 3SQNA 4DAOA 1Z82A 1HH4A 1YJ9V 5LUAA 1DQZA 4Y1EA 1ULUA 1I7LA 4PN7A 3LA8A 4NDAA 2HBQA 1XTZA 1N7HA 4PO8A 1UKVY 3AFIA 2CDBA 2ODQA 4JD5A 4XUDA 1ZD2P 3SXJA 3ND6A 3OO0A 4AG3A 3NVKE 5E7IA 5E6UA 5IARA 4DEYA 2P91A 4YJ2F 1L2TA 4LCBA 1L3BA 1RZRD 1NI3A 1OGYA 1FSZA 1Z74A 1DAGA 4BO2A 2DWPA 1U1FA 4DA6A 1KBHA 4DV1O 3FCXA 2O7SA 3FTNA 2GGSA 1UOEA 3L4KA 4PO3X 3I30X 2WDPA 2XDQB 4NH4A 3PCXA 2C00A 3EWAA 3I4FA 3AP3A 4K9DA 3CG0A 1RRMA 3OE7A 3E9CA 2H31A 1Y6GA 4QYIB 5KCZA 2Q1YA 2A5FA 2YCBA 5GAJA 2AZ2A 1DJLA 4UTRA 3DL7A 1AVMA 1C3EA 4G0NA 1QCZA 2Y9PB 1BMTA 2FDRA 2Q7GA 4QXMA 2ZQ5A 3A31A 1BEZA 4FGUA 1N25A 2GF0A 1DZ3A 1ECPA 3QU9A 4J0CA 4X8AA 1NJ5A 5ECGC 4EM6A 2VPYA 2JAPA 5HBRA 1AGPA 3ORHA 1PTJC 4Y9DA 5T3YA 3VDMA 2H1WA 1QD9A 5BQFA 5DT2A 3IJPA 3GNQA 4HYQA 1U63A 3ACCA 1AQNA 5JAOA 2HOQA 3S1LA 1KR5A 3D0OA 3GMIA 5ALSA 4GM1A 4JI0B 3VXKA 3HNOA 3EVNA 5F52A 3W7SA 3F49S 3H5NA 1PR1A 1HDEA 2C5FA 5T4HA 3F7OA 1PNTA 1WAMA 4N6OA 4C6TA 3QENA 1CUGA 4V1CA 1Q6YA 3WNDA 3GEGA 3PE4A 4YREA 3UEOA 3EDOA 3K32A 1EUDB 1V45E 4M0KA 1I4TD 1NIPA 1PR9A 1QVRA 1YSCA 1JLHA 5JTTA 2GPWA 2WUDA 1VKOA 3GB9A 4N5MA 5A0TA 4N0DA 1VP3A 3ZNPA 5L3RA 2PJUA 4R8KA 2ARHA 1U80A 1YS1X 3GGOA 5DNWA 4BB5A 3V7NA 3CC2F 4X1IA 2XE8A 3GL9A 1MO4A 3O5AA 1T5EA 1PNMA 2RGXA 2E4XA 2HWXA 1WPBA 4G23A 3MBIA 1A8HA 4YDRA 4YWHA 5H80A 2R86A 4UNRA 1BQZA 1DV2A 4KN8A 1RTTA 4ZHYB 1SF9A 3K8YA 1CY4A 3QKTA 1G66A 1L1QA 4JCCA 4YECA 1I3OA 1YI2F 4JBLA 3D4PA 2JS5A 1DGQA 2YFYA 5FV4A 1T9DA 3PPXA 3RFCA 2XMGA 2CE2X 5KIAA 2E74B 4BV2A 4ZRDA 1WUYA 4UTNA 2OXEA 1LI5A 4R1PA 1CX9B 2REBA 5CFMA 1M2NA 1KYVA 5AM2A 5J4KA 2AN5A 1JMKC 1XEFA 3NYRA 3SP1A 2E4WA 1NOKA 3ZHQA 3V7YA 2ODEA 1SM4A 4LGYA 2VGNA 1UC8A 4V39A 3UG6A 4FLVA 3NTRA 1YCGA 1ZSPA 3VI3B 1Q2XA 2NG1A 1TPZA 1EZZA 1HOTA 2A9RA 5KU1A 3IP5A 5FULA 4DZTA 2I7TA 4Z99A 5THQA 1ZNWA 4RGQA 3ZE1B 2VF8A 3FFBA 2LFSA 1HL3A 5CVDA 2JLRA 3AI7A 1DC4A 1FDUA 4RGBA 5JBNA 5A1TA 1PFWA 5DEDA 4ZI7A 1UT5A 2B36A 3DMDA 2X8LA 1GVHA 2P2DA 2NPOA 3OH8A 3UHAA 2Q2OA 2C9OA 2NPIA 4G1BA 4FOSA 5T8KC 1JMYA 2ECQA 1BHAA 4KH1A 1CZUA 4V0ME 2ZUSA 2BUBA 4WJLA 2EU8A 4MGZR 2YJ5A 2Z8ZA 4LDAA 1WXIA 5A5FA 4YPOA 1ACLA 1SC4A 1A27A 1NC1A 4RZSA 4JBYA 4BLVA 3TLAA 5FLEX 4EA6A 4DCVA 3ZCVA 1ZK3A 3ZWMA 4B3RB 1TUGA 2Z1MA 3MXTA 5E4FA 1K68A 3CLSC 3LGAA 3ZQ6A 1QLHA 1QAMA 2GAFA 5DZSA 3B5IA 1UM9B 5FUVA 3KQVA 3W7WA 1GUFA 4NCNA 3DL2A 4F04A 3NBFA 1AB3A 3ABRB 3WYFA 2H06A 2HW8A 4EJSC 4D9FA 2PRSA 1J22A 2Q7EA 1Z6XA 4L8FA 5DEIA 5KEIA 2K7ZA 3QI2A 5JDCA 5A4FS 2F2TA 4UUOA 3KT8A 4MWTA 4N76A 3WJ7A 2BMVA 2H4JA 1HO3A 4MS1B 5HWEA 1GRNA 4EJSB 4L57A 5SYNA 3PICA 3N2NA 3IUPA 2XD4A 1HQYE 4ZO6A 4LH6A 4GR5A 2HO5A 3WWZA 4O4IF 3GAZA 4I1UA 2C96A 3MMSA 4AJ4A 5J2TA 4N5HX 1OXMA 1JWAB 5G4KB 3VI6A 2OK8A 1XMQO 3UJ9A 3A1WA 4LZJA 1PT9A 4R1OA 2R11A 4DYVA 2CSXA 1IK6A 3PXXA 4NQRA 5KKNB 3T1CA 3AR6A 1G6HA 1PJSA 1ID1A 1XEXA 1NQUA 3I4CA 1F5NA 3WLAA 3PEVA 4OF4A 4LRSB 1K73H 2XB6A 3VH3A 3DL4A 3K0AA 2G4CA 4IZOA 1PNKA 4LH7A 4DDUA 3C3YA 5EGNA 3VR2A 3G7SA 1F8YA 4II7A 4HQ6A 2CEKA 4ZCRA 5KNLA 2GVDC 5CHEA 1J5EO 5EGSA 1CEZA 2VVTA 1W0CA 2WICA 1WIWA 4GX2A 5J2UA 1Y9AA 2V03A 2NSHA 2O6HA 1FNMA 5JWOA 4Z86A 4CC6A 4GBGA 3QO7A 4JNCA 1ZNQO 2MSLA 2Z0MA 5IAJA 4EAQA 4FFOA 4FINA 1ZR4A 5G4UC 4QA9A 2QKCA 3O4HA 4GMXA 3RYCA 2RB9A 4AG5A 1HXHA 3R4CA 2A8YA 4RW0A 3CCFA 3KQMA 3DWIA 1QO0A 2RGCA 1H0HA 1PL6A 1AT1A 3N0XA 1SO8A 1WA5A 4PSVA 3JW8A 3A6LA 4TT3G 2H1OA 1WZIA 2Q5IA 5AH0A 1K8XB 1F4PA 1BVYF 2P2SA 3EK2A 2PS0A 5IF9A 1XZPA 3UENA 5CB4A 4KQ2A 3JX9A 1QDEA 4B76A 1DLJA 2W42A 4H31A 1KL7A 3HN2A 1GD1O 2C1EA 3IVAA 5ALDA 5GZ6A 1OV9A 5AVKA 2J4DA 3Q2OA 3EVTA 4M86A 3AFHA 3AERA 1EN4A 4FNGA 1M9NA 4QATA 3ZWAA 4TSFD 4D8TA 5JVDF 3WYNA 3GRPA 3RRBA 1YZLA 1ZKMA 3E83A 4HH0A 1TDJA 5IJ0B 4LZWA 1SVNA 2Y1DA 4HTFA 2HK9A 3S03A 1YZKA 1RDFA 1D4FA 3T7DA 4BO8A 3CE2A 4I50B 4YP6A 4ETMA 2QB5A 4JLUA 1XAIA 3BCCH 2A33A 3G6BA 3GT7A 4AN4A 2XI4A 1QH8A 5K9ZA 4CL3A 4MAFA 1VFNA 1XXLA 5AIBA 3ECSA 4MRMB 3V8PA 5EQTA 3CTMA 4B33A 4KUMA 2TRSB 3OE5A 3O0DA 4B0OA 4BQNA 4I1PA 1C7EA 3RBVA 1O4VA 4GNRA 2XCTB 4K6CA 3ZTTA 1XRQA 1XOUA 5AVJA 4XJTA 4BC1A 3J7TA 2NSDA 4U7NA 1M73E 5EA2A 1XWWA 4XCVA 1JA1A 5GIOC 1NVEA 3FSRA 1NVPB 1BD4A 5CA3A 3FTQA 2NZUG 4N5LA 4KLRA 3ON1A 1RHQA 1WETA 4V0OA 4DM4A 4B79A 1N6IA 3UM9A 2OC4A 1PP9H 4KWHA 3HJFA 1QHSA 2AX3A 3UK1A 2ZIGA 4ITUA 4OGWA 3NYIA 3MGBA 3VPDA 4TRJA 2V55B 2XWPA 3ZKWB 2KYRA 4QGAA 3HP4A 3ESXA 3U0VA 4C0AC 1E2QA 2ZVPX 1JAXA 4BO3A 1L6RA 1SUWA 4FDVA 2RGGA 1Y6QA 4RKEA 4OOEA 4LZLA 4E08A 2WLIB 2V6FA 3AEUB 4P4TA 4PNHA 5TF0A 4BLQA 1I01A 1GYQA 5CA0B 1TEHA 3O9OA 3SQLA 4D0LB 3EZ6A 2YI8A 4G8BA 4K03A 4ZHQB 3IMFA 4CQMD 2HP3A 5FPQA 1PWHA 4AD8A 2R3SA 1KGDA 4TLCA 4GX5A 5L3SA 4LCKA 1I5OA 5K1ZA 3L01A 1DZIA 1K6EA 1GWNA 1Y6XA 1ZNYA 2FOXA 1JFSA 1CR4A 3VR6D 1FNNA 3AVTA 1WUHS 4HAWA 3GJRA 2QXYA 4S12A 2XNJA 3AR2A 4QWMA 4KR9A 1PR0A 3FFXA 2LCQA 4K7JA 3T3GA 1K9MW 5GTIZ 2WSSG 3CEHA 4J7UA 1R6UA 1QWOA 1E2NA 5EJ4A 1EVKA 2VRWA 3HJWC 4KSYA 3LSTA 3B6ZA 2HS4A 5K8VA 1W57A 1EFRG 4PA9A 1E6MA 2PGNA 2IBMA 3V7QA 3IEQA 2IYSA 1OAAA 5KWSA 3S2IA 2D7DA 1CRZA 3VH4A 3SJBA 4EMTA 5FPHA 1SCQA 1S4QA 2HDWA 5I48A 4D3ZA 4Q01A 3KZIZ 5IVPA 1NA5A 4F1JA 1CUEA 2MHCA 1V4BA 1ZOPA 4D96A 4FLXA 4KQXA 1MA3A 1R6XA 4L3WA 3ZWDA 5HFAA 3DQZA 3QUSA 1ZSVA 4IOLA 2J0EA 2QTSA 3NK7A 3AFOA 1XJ5A 4QHSA 4GSLA 4YRFA 5CCXA 2QRNA 4ZCPA 2EX4A 3CXUA 4LSWA 3TPZA 2IPOA 1NL3A 1NVFA 2QW0X 1MG0A 2P3QA 4N6GA 2Y05A 3TZHA 4S1TA 2PUAA 2LV8A 3FJ1A 4WEOA 1VMKA 3OU7A 5LZ8A 5JZOA 5IJ9B 3A3YA 3B6MA 2Q4PA 3OZSA 2AC2A 5IWCA 4ZVVA 3NRJA 1KAMA 3ZK8A 4RTQA 4W9NC 4IPTA 4GMKA 4NZ9A 2BFDB 1DKQA 2DPGA 5I6DA 2LFRA 2Z98A 5SYAA 3FGZA 4RF2A 3QPCA 4GPIB 1LW6E 3WGZA 1II8A 1SWVA 4WCVA 2AFIB 4FT2A 2OQVA 4B46A 1BYUA 3OHPA 1QQCA 1Q14A 3I5DA 4MPPA 2BMDA 4BTVA 2Y2VA 1UPUA 4KHZA 1W30A 4IGKA 4IGGA 1WTCA 3A70A 3KYDA 4MTOA 3O21A 1GO0A 3LKZA 2W6NA 3TQSA 4B4WA 2QUHA 4DV4O 2XZLA 1Q1AA 3DLTA 2YIJA 1PR2A 1FTSA 3MTIA 3B70A 3M1IA 2X6QA 1A97A 5IYDO 3VR3D 4LZNA 4J41A 5TV2A 5JZSA 3WGTA 3LI2A 3AW9A 1F3LA 4INAA 3HA2A 3HTXA 2EFDB 3WO0A 3IUQA 3DGFC 2YHAA 1XMIA 2V7WA 3HZOA 3GUVA 1SU6A 2JI6A 4R2LA 3TSAA 4XSHA 4BNUA 1Q90D 4DYLA 2FN3A 1A1SA 1LRKA 3ZQ4A 2I76A 1VG9B 2X15A 3DA8A 2PT5A 1QYDA 5F2NA 3MM4A 3IAXA 2PKYX 3F6RA 2D5CA 4TS3A 4B7UA 2YHIA 3K8OE 3K5HA 5JBIA 5C1PA 3BXGA 4H1HA 1QORA 4AUNA 1B14A 5DSXA 4OUDA 3TE6A 2NXEA 2J08A 4IIXA 3ZY6A 1NBMG 3VPFA 2EWMA 1AMUA 2OHIA 3FLMA 2QY6A 4YQFA 1NKVA 1YI2V 2H5LA 3IEUA 4WWHA 2XF2A 1UBJS 3EOAI 4F92B 4AXXA 4M87A 5B1AC 3VPCA 3IB6A 3PNMA 2WFZA 2E21A 2JD0A 3X2SA 2QL6A 2GJ8A 1GFIA 1OYVA 2XUDA 1E61A 5H02A 5LR6A 2CL5A 3NORA 821PA 3A1TA 2I4MA 3TGLA 4Z2YA 3TTTA 4JLNA 4G5SA 3ZXUB 4YV7A 4KPUB 1VE9A 4MUAA 1TC1A 2BFCA 1T3TA 5F1PA 2VP2A 3JAWB 3VU9B 4YR9A 4IXDA 2FWRA 4H6PA 5EWRA 1JEOA 4WMLA 3PPIA 2W4QA 1CF4A 2J7PD 1OGJA 1ZW6A 4X6LA 2XVYA 4Z4QA 3ANTA 3GWOA 1Z5ZA 1F2DA 3DKVA 4Q16A 2YY7A 5D5HA 5TS3A 4TQFA 3WRXA 2IIVA 4MGHA 3UYKA 4DCNA 1K5SA 2OMEA 4TUYB 3F5TA 4XWTA 1F2TB 1I4DD 4BLWA 4EA7A 3T8YA 1Z4LA 5IJAA 3KYIB 2BTUA 3NIFB 1A4RA 3WMFA 5D01A 2C9BA 2BONA 4PRKA 1DTOA 5ALTA 1YK1A 1VLQA 2VNAA 2CFTA 2Q5ZA 5HK8A 1WS6A 1SHKA 4DV6B 1VLHA 2J1LA 2P9QA 3TW8A 3G6EF 3TRDA 2G04A 1GKKA 5KA5A 4EEZA 1F2VA 1TVCA 4OQ4A 3T5TA 4WGGA 3PL5A 1HR0O 3EXHA 2YRFA 1IN4A 6Q21A 1T2DA 3JRWA 3OPYI 5DWDA 4GMHA 4BFZA 2ES4A 3NCTA 1VECA 1VJ5A 3JQBA 2HMSA 5C8YB 4NBTA 2OCBA 4DDTA 1XAHA 4R9UC 2Q6IA 4IWYA 3A6FA 1NRWA 3EPLA 2B4RO 4MZDA 3OEHD 3OZ7A 1HQDA 3GT3A 2Y1XA 1Z4JA 3GUUA 2X3YA 3IPAA 1E79G 1G42A 4BNDB 5C1OA 1VLLA 5AM1A 4AY2A 1SUEA 1JPNA 4DJEC 1OT3A 4ZAFA 2V9PA 1UKBA 4E15A 2NMUA 4OPHA 1N2IA 3NVAA 2DWCA 2XUPA 3THXA 3TQFA 3EAFA 1IPHA 4HEQA 4L4ZA 2P5YA 4PYOA 2G07A 4H0CA 4MI1A 3RS5A 5KCMA 1QVAA 2WLHA 1UBTS 1VPTA 3FPCA 3TNYA 1P33A 5EE5B 3C3AA 3W90A 4JI0O 2APJA 1M34A 3WGJA 2CJWA 2ZRNA 3EULA 5KNCH 2WLJA 1JR3A 3H9EO 5KSOA 5KB3A 1OLXB 4C6RA 2DEUA 1KZ6A 2C8KA 2AOUB 4NONA 1WUIS 3JR3A 2R47A 2CVPA 1XX6A 3JZAA 3HZHA 4H33A 2CE7A 1XQXA 2A35A 3VNAA 2HFJA 3N2ZB 1X7ZB 3QWAA 2F9FA 2DH5A 2D1FA 2JFXA 2RBEA 2W0MA 3DEIA 2RGNC 3H2KA 3KL4A 3D7SA 1JF8A 3L3BA 4S1VA 3NHBA 4J9VA 3SNHA 4C3VA 4C8IA 3K0DA 4QFCA 3QJ5A 4MEAA 1WRBA 4MJLA 4WI1A 3H1GA 5CXXA 5EL0A 1Q5OA 4ZT5A 1MABA 2MSKA 2VJBA 3QVLA 5DNCA 2XUQA 1NM5A 1OIXA 3ZWXA 2GTIA 2P0EA 3PF9A 1E32A 1MVNA 1WDKA 1Z15A 5K0ZA 3SFZA 2CV1A 3MOSA 3WX0A 3ER9A 2Y1EA 4GYCB 4L9AA 3A1SA 4ABYA 1MT0A 5LQMA 3LRTA 2ZYTX 3F3SA 1X87A 4Z9XA 4EGQA 3WYBA 3RLFA 5AKEA 2GOYA 3WC4A 4GW3A 3QMPA 3OZUA 2NO1A 3MMNA 3AUFA 1SHZA 5B5EZ 1RXVA 4J91A 2LW7A 3OQOA 5JNTA 4Y1RA 2PYIA 3D6NB 3MQWA 1XUQA 3D8UA 4KRYA 2R1TB 1DO0A 2A86A 2PTGA 1ZWZA 1T9HA 3L7IA 4OXNA 4GOMD 1CVRA 3WK6A 1FFDA 4I0XB 1EB8A 2FB5A 4DQLA 2B4TO 3MWKA 4CLHA 1R12A 3DDWA 1G8JA 2WHPA 4IQ0A 2XKAA 4ZAWA 4HDRB 3PHBE 1OOEA 1Z56C 1ULSA 4QLAA 4MS3A 3NNSA 3F3KA 1GU7A 2Q9LA 4OBBA 1KJNA 4HUQA 4BEWA 3LC0A 4OHVA 1PS8A 1GM5A 3Q2IA 3IMCA 1YJ8A 4RD0A 3HZRA 2E1RA 4FN5A 3GLFA 1QWSA 1ECBA 1RMYA 4FP9A 3NWPA 1YJ9F 3BMOA 1ZCAA 1ECJA 3ZE2B 3IJ5A 1W4LA 1Q86W 4PLGA 3H1LH 1HUQA 1V5IA 1B15A 5T6BA 4MDEA 4JC0A 1TO2E 2I6QA 3TQHA 4UAVA 2DWUA 1AUPA 1NDHA 2DETA 1P75A 1PV1A 3VYSC 1TTPB 1LBHA 1AKYA 4LBZA 1SXJD 2ZT7A 1KOLA 1UIRA 4BCBA 5DBGA 2BE3A 1KJ9A 1V3VA 2WIDA 1G7CA 2Z1DA 3CNBA 1V9CA 5LQRA 1Y8ZA 4PAGA 2YWGA 1GL6A 3BDIA 4MI3A 4B3RO 3VYSB 3ZX6A 1ZU4A 4FGKA 1FY2A 5IDQA 1XDBA 3RTGA 1THZA 2A0FA 4PYQA 1H3FA 4WKNA 5TS2A 3BZBA 2ECKA 3EYAA 4I9QA 2B1QA 1COWG 3GLIB 2ZSUA 2OZVA 1TIPA 3BGSA 4G65A 1ELOA 2XJ9A 3F73A 3NALA 1DBPA 4N9WA 4P81A 1U11A 4J0KA 5CFRA 1KNQA 4MUJA 2CTPA 1UBNA 2ZLBA 2XMCA 1NF8A 4WZ6A 2QT0A 3WMXA 5FPKA 4Q24A 1KH1A 4MYUA 1HQCA 2FEMA 1RM3A 3H87A 1F4LA 4N1AA 1U9IA 1QHIA 3DMYA 1EK1A 1CNMA 1TYZA 4M8KA 5BV8A 4AI8A 2RK4A 5AW5A 1W19A 1RZUA 3UN1A 5DSZA 5AM5A 2QLTA 3F2VA 2UYPA 4NZNA 4TSKA 1ESDA 3TIXB 3Q98A 3HBFA 5DRYA 1KXZA 3BAZA 3DKRA 3FJYA 4XDLA 2LCIA 1V6AA 4JBGA 4WW0A 4DZZA 2O0MA 1R3IC 4NWIA 2ZRJA 4CV3A 2I6SA 1KNXA 4MUEA 3X2QC 3CUSA 3OD1A 5GWXA 2GYVA 4YFVA 1AGRA 1F17A 3U7FB 2XHEA 3H01A 4BNNA 4A15A 1BX0A 4BT2A 1STOA 4DMLA 3X2QB 5KMGB 3LL4A 1M2OB 5B37A 4CM9A 2DLCX 2P9FA 3OMWA 4L0MA 1H0SA 1A76A 3EIHA 1AP5A 3LC1O 3O85A 2RKBA 2X58A 1RBQA 3ICOA 5FL7G 4FVTA 2G1UA 2IJGX 4XWKA 3OBIA 2FVXA 1SXHA 2NZ2A 1YU9A 5I7RA 1CUVA 5JJNB 1QANA 2P11A 2JVJA 4OHMA 1O6ZA 1WJZA 2VTEA 3QPUA 3BSFA 3HVKA 2CHTA 3ZCSA 3ELBA 3T12A