5KX5B

Crystal structure of tubulin-stathmin-ttl-compound 11 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
430
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Cytotoxic Evaluation of Novel Tubulysin Analogues as ADC Payloads.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 167
structure length 427
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kx5B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kx5B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kx5B01
5JVDA 4LNUB 4EI7A 4EI9A 1SA0B 4ZHQB 5BMVB 3WGKA 3UT5A 1FSZA 3N2KB 5KX5B 5LA6B 1Z5VA 4O4HA 3JARA 4EB6A 4YJ3B 1JFFB 1TUBA 2RHJA 4E6EA 4I55A 3M89A 3E22A 5FNVB 1FFXB 4WBNA 1Z5WA 4TV9B 3HKEA 3JAKA 4O4JA 3RYIB 3VOBA 5CA1B 4U39A 3RB8A 4I4TA 5J2UA 3HKBA 4X1IA 1W5BA 2R751 5IYZA 4O4HB 5JQGA 2BTQA 3RYFA 3N2GA 5LOVA 3JARB 4EB6B 3JALB 5JH7B 3UT5B 4YJ2A 5BMVA 3JAWA 3WGJA 3N2KA 5FNVA 3WGLA 4IHJA 4HNAB 2XKBA 3RYIA 1TVKA 4YJ3A 1W59A 4I50A 5EZYB 4X1YA 4F6RB 5LXTB 5JCOC 4ZI7B 4U3JA 5CB4B 5IYZB 5LOVB 5CA0B 5CA1A 1W5FA 5J2UB 2Q1YA 5J2TA 4O2BA 4O2AA 2XKAA 3V3TA 3WGMA 5MN6A 3HKCA 2BTOA 3HKBB 5EYPB 4ZOLA 5LP6A 5GONA 1W581 1TVKB 5JH7A 1JFFA 1TUBB 4I50B 4YJ2B 4I55B 3M8KA 4X20A 4IHJB 5MN5A 4TUYA 4ZI7A 4WBNB 4FFBA 4X1KB 2VAMA 4IIJA 4TV8A 5EZYA 5KMGA 2VAPA 5IJ0B 4DXDA 5LYJA 5LP6C 5CB4A 4X1IB 5EIBC 5CA0A 2BTQB 4LNUA 4O4IA 3RYFB 3VO9A 2RHHA 5M7EA 3JALA 4O4LA 4B45A 4O2AB 4O2BB 4X20B 3HKCB 3ZBQA 3RYCA 3ZBPA 3VO8A 5KX5A 5C8YB 5IJ9A 4ZOLB 5LP6B 5EYPA 4HNAA 5ITZA 2RHLA 3JASB 5KMGB 4B46A 4TUYB 2RHOA 4X1YB 4F6RA 5LXTA 3JATA 4X1KA 4FFBB 4IIJB 4TV8B 5JVDB 4EI8A 3RYHA 4DRXB 4ZHQA 4I4TB 3VOAA 3R4VA 1SA0A 2VAWA 1OFUA 5J2TB 5LYJB 3RYCB 2Q1XA 5JCOA 5EIBD 3HKDA 3C8LA 5LA6A 1W5AA 4O4IB 5GONB 4O4LB 5ITZB 2VXYA 1RQ2A 3JAWB 3CB2A 3ZIDA 1FFXA 5MN4A 4XCQA 5IJ9B 1W5EA 5C8YA 3JATB 4KWEA 3JAKB 4TV9A 2R6R1 3HKEB 3WGNA 1RQ7A 4O4JB 3JASA 3RYHB 4DRXA 1RLUA 3E22B 4U3JB 5IJ0A 3HKDB 3VPAA 3N2GB 5JQGB 4M8IA 2GVIA
chains in the Genus database with same CATH superfamily
4R0NA 3AG5A 5CP8A 3TTUA 3MMNA 5IU6A 4JOCA 2PUDA 3IUYA 4LV6A 3QX3A 4WWHA 3LCCA 3SZUA 1CDZA 3ABLC 2QOEA 2I1LA 3U40A 3OIWA 1VLMA 2CLEB 4ZAZA 4BV8A 5LDHA 4S1VA 1S7GA 1GZ7A 4NCAA 4KNYA 3WB2A 4FMDF 3HCEA 3ZS8C 1AT1A 2NM0A 3UH1A 4YP1A 2JH8A 2XMQA 3O65A 2Q5IA 2ITCC 3R5XA 4I9UA 1YOBA 5ICCA 4P9OA 4RTSA 3BILA 2QWOB 5K8IA 1J2YA 1PG0A 2Y3IA 3LCMA 4ZRMA 6ABPA 1A8IA 1Z6ZA 1ODEA 4EO4A 3MPOA 4RJ2A 4RZSA 3KQOA 1UMBA 4YO8A 4YFYA 2EP5A 3GEBA 3K9WA 3ND8A 4W7SA 2O19A 5CT4A 4ENQA 3GVMA 2Q50A 3LRTA 1UBFA 4O1HA 4JYBA 2CH7B 2PH5A 5IBRA 1OKKA 4EZIA 3K15A 5A05A 1Z5GA 4PA6A 1U4SA 3L4BC 3OVMA 4N3CA 2IY7A 4OQDA 4YJ3A 2Q7OE 1KJJA 1QNFA 3FWPA 2RI1A 1LPPA 4P3OA 3DOOA 3FDZB 2BGMA 5HDQA 4JXZA 3MUFA 1XZDA 2IYZA 2MSDB 2RJ3A 3E8GA 3TD3A 1DBPA 5LOVB 2ODPA 1FZQA 3DMNA 4FSXA 4MWOA 3RVNA 2F3TA 1CQJB 5T41A 1WDMA 1NBOA 2I5PO 5H68A 2JCGA 3CCBA 3TD6A 3E27A 3AUKA 3IIIA 1A9XA 5LYYA 3HUUA 3WGMA 3MHSC 1UWKA 2F4NA 2QLBA 4BB9A 4IDGA 2ZUWA 4BLQA 1RXWA 1FS4A 4OX9Y 3RH0A 3R9WA 1VARA 1AUQA 1CY6A 2J67A 2O5VA 4G4SP 2IHYA 4S24A 4I50B 1XO1A 1RWQA 5EP1A 3OFKA 4LYEA 3QQ5A 5BY2A 3H3JA 2HHHB 4BNFA 1ZI9A 2Z9CA 4XSVA 5C34B 3ZRXA 1RRVA 1ZD9A 4FYHA 3O4HA 3GOQA 3ESQA 4YASA 4FSHA 5JZ9A 4TXHA 1IOWA 3PWZA 2Y6UA 4W5WA 3U31A 1E98A 4MQUA 4XGIA 4HSGA 2XCRB 4EUSA 3ZIUA 1TJ3A 1ZI6A 1NOKA 5AKLA 1WDKA 1GUBA 3NEJA 5FBQB 3IEIA 2G08A 2GASA 1J39A 2QZPA 4MLZA 1FNMA 3RI3A 4NDNE 4UXHA 1APBA 4JT2A 4QGSA 2ERCA 2WM2A 3AM5A 4NH0A 5CH8A 5LLDA 3A3KA 1LBEA 4P7JA 3U9LA 4B9EA 3NVMB 5EQDA 4HD8A 3CIFA 3S2YA 5KREA 4GX0A 3DTVA 1A8PA 5C4GB 2FZVA 4FKMA 2LGJA 3GWGA 3H04A 1DC7A 2X0EA 3UAZA 3AK2A 1N5LA 2RAFA 3NXSA 3JQ8B 2CXPA 2W2KB 1U6KA 2W6NA 1Q12A 1D5CA 2J3QA 3KKNA 1JWBB 4FFKA 2XNKA 3KFVA 2MMCA 4FYKA 4MW2A 4WLVA 4KV7A 1IZ3A 4DJDC 5AM2A 1U43A 3IKEA 1I1QB 2DPLA 3PFIA 2RGNA 4JP5A 3IXMA 4QBGB 5EL0A 5L6LB 2O8EA 1IBCA 3JTEA 2QZZA 3LDHA 4G23A 1AQIA 1L5HB 4AP6A 3W6OA 2HLDD 3DVLA 4G67A 4MV4A 3ORYA 1IJBA 1NBHA 2OHIA 3HB0A 1FOEB 3SZGA 4GFDA 3WGGA 4B3XA 1AA9A 3RRMA 2CWDA 2NU8A 4BDTA 3F6SA 3ZDDA 1VSTA 2KB1A 1SQQH 2YJ3A 3DBLB 3HCBA 2C98A 5IX8A 5A6VA 2OE2A 4PC3A 1W35A 1BHQ1 5LMNO 4EEKA 1W87A 4NZNA 2W2XA 4U9HS 3TAXA 5CTJA 2FQQA 2ZYUX 1NMYA 3FCEA 2PPVA 3B4SA 5A62A 1L5GB 1XHOA 4FC6A 1FDIA 4GSKA 1MJHA 3KYJB 4WKCA 4ZT2A 4D6PA 3ADDA 3GMSA 3KJGA 1N5JA 3OT5A 1OXXK 3OFNG 2QM7A 2ZT6A 4TRNA 4JR1A 1W4CA 1UWVA 1XCPA 2QWXA 5TQ0B 3V4PB 3VR6H 4YRTA 4CIDA 4L7QA 4O4JA 4EG7A 3D36C 1ZVKA 4GL2A 1TAUA 4IIFA 3EG5A 2JD2A 3AUYA 4UM9B 2OWEA 1J8YF 2P4QA 3MUNA 3NBFA 4OQPA 2DKFA 3B3FA 4YB8A 1YZLA 2PEYA 4RYDA 4YRJA 3K5NA 1QLNA 2FUG6 2PY6A 3VH2A 3UQZA 1SG0A 2ONZA 4WZAA 3AOEC 4AKHA 1AKMA 4KIFA 5LHIA 3ONEA 4LNHA 1E7RA 1FXSA 1GGJA 1Q7TA 3DWFA 4M1WA 3PICA 2D06A 1JR3D 2VHWA 4KXWA 2R44A 3LP6A 1V9LA 4RD0A 1GZ3A 1TL7C 2IDJA 2QTAA 3O92A 1J0AA 3J81A 1A5TA 2HO5A 3AP1A 3D2LA 2FYUH 1QKJA 4M37A 4BEJA 1NBAA 2AG1A 4PZCA 1V8FA 4H9GA 4Z1OA 1PUJA 4OGFA 5JZSA 5AG2A 2ZCJA 1YJ9V 2OHJA 4K9MA 5MGNA 3MDOA 2KKWA 1A7AA 2ASVA 4FW8A 4YQYA 3F3YA 3D6MA 1Y8QA 4UMVA 1XL6A 3KG2A 3B85A 4GOMD 1RYYA 3O73A 3ZIAA 1J2TA 4Z0HO 2QM4A 2J0EA 3B20A 1KP2A 3ADPA 1VLJA 3FW1A 1QO9A 3HXKA 4R81A 2QA5A 1Z2AA 4RK0A 1PZGA 2MYTA 3T7CA 2HSZA 1JOYA 1XCBA 4G4XA 3NHUA 9LDBA 2R7KA 2WIDA 3GY0A 4INZA 1N33B 4KXUA 2H3EA 4E03A 3SIPA 4EITA 2C7PA 4M36A 5DEOA 4BFVA 4LMBA 3GWZA 3T95A 1JH8A 2NU8B 1CY0A 2LKDA 1N92A 2G25A 3ZY5A 1PI3A 4C03A 2NW6A 5IDQA 4P0TA 2Q07A 4DW1A 4YR9A 5MFZA 3O1HB 3F7TA 2YFKA 4UOEA 3FOFC 5EG5A 2H1VA 3C8ZA 2JBAA 4Y6PA 3PD0A 3BVOA 1CB0A 2OYSA 4KBYA 5DMHA 4ND4A 1NZ6A 5CFLA 3VKVA 1U11A 3GJ5A 2VWGA 4RS4A 1JJIA 3NHYA 3DKPA 4RVNA 3T1YO 2D54A 4YCNA 1RMYA 4QFCA 3SQMA 5F3WB 1T36B 2QVZX 1M2GA 2FPIB 4B46A 4FE4A 3VTZA 1QRTA 1KFJB 5DPMA 4D8UA 5I45A 4X1YB 5CDUA 5BW4A 1CRQA 5DLDA 2G6BA 3QENA 1GNLA 2MIIA 1I2MA 1TCBA 5ALQA 4BAGA 4D9JA 3GHZA 4DR6B 1CQZA 1HLDA 2WF8A 4MUGA 5ALGA 2Y1FA 5AOCA 1T5DX 3GLUA 2X0IA 2GEKA 2JIZD 5K05A 2YJTD 2ZTLA 4NABA 4I1UA 4CLRA 5LNK6 3SFZA 4BLWA 2QSAA 2GA8A 3PUWA 2F2TA 1T1EA 2WE7A 4IH9A 4JWKA 3OZGA 2BHLA 2XCTB 3KJZA 1GDDA 2GSDA 3O03A 2ZRPA 5HF8A 1JSRA 3C85A 3T41A 4EJ0A 4HDNA 4ZVQA 4BV2A 1KAQA 2GFIA 3LZDA 2BUBA 2C84A 4J9ZB 2O1EA 4GZMA 5TC4A 1JDBC 4JJGA 3TRHA 3BB3A 3L6OO 1ZLZA 5A9RA 3HYRA 2L18A 1B2LA 1PK9A 1IK4A 2JAXA 4GGPA 1SURA 4RSRA 5F76A 2VCYA 3L0DA 5EZYF 5CAEB 3SLKA 3D64A 5K0GA 3FRJA 4K8ZA 5JWRA 3CNQS 4YV0A 3A6KA 2AG0A 4YLYA 2IJKA 2CL6X 3PLAE 1HNWB 3UFBA 1EFAA 4EFEA 1DIOB 2V6BA 1OLXB 1CUHA 4A8TA 3Q7QA 5LA6B 1W8IA 4AD8A 3B8HA 1XCOA 2WYWA 4IRMA 5DSXA 1B00A 4FLUA 1N6NA 5F5NA 1MJNA 2Q4RA 4JHLA 4JVLA 1RR6A 1MTOA 3LXMA 1F8YA 2OTJV 1LPAB 3C6KA 1GV0A 3PXCX 1WAZA 3DYVA 1M90W 3KLBA 4Z99A 2PL5A 4BPRA 1E3JA 3HGTA 3BXXA 2AHYA 1ISFA 2XJ9A 5CVVA 1T2NA 3DQQA 3ZI0A 1S2DA 2FKNA 3SC6A 4IG4A 1N8SA 4V0KA 1FW8A 1ACJA 4MVJE 5DM2A 1V2GA 3DMRA 3WGJA 1M8PA 1OWOA 2VJAA 3OEHD 2DQ4A 4IIXA 3PKJA 4KSYA 4ML3A 5PNTA 4KOEC 2ORWA 3BDIA 3O4FA 4DC0A 3AK1A 3F2VA 3GFRA 4MVOA 4BWAA 3IP1A 4P86A 1X1TA 4WV3A 5CT6A 3QHQA 3S3XA 3KALA 1I2CA 1Q3HA 2EBFX 1VQMF 4RKQA 5D87A 1M7BA 2Q2QA 3PNVA 2WJJA 1R3KC 3CN7A 3AVYA 2P6MA 3UKMA 3FKSG 1HYEA 4JUFA 2P1RA 1G6Q1 2ISSD 4PYNA 5IG2A 3EIWA 4DZTA 1MNQA 4RBNA 3BCCH 4OA8A 5DGTA 3P8ZA 2XDQB 2A4KA 2C82A 1S3GA 3C7KA 1CF9A 1QS0B 4UHCA 1NFQA 2PS1A 4U4AA 5DRYA 4YXWG 2OCYC 3MGKA 2BDUA 2GK7A 4U7JA 4URUR 2UUBO 1S2GA 3DA8A 3EZFA 3OY2A 4UEOA 2AMVA 2C83A 4B4WA 1QVWA 1R4MB 1E3WB 4XIYA 5JTUA 4DXDA 1N33O 2OKGA 3PC8C 4QDXA 4DMHA 5JH7F 1PJSA 1PGJA 1RACA 2RN9A 1WF6A 4WK4B 3DZDA 3HDYA 2Q5HA 1OXSC 5CGQB 1Q1QA 5KCZA 4ZZ2A 3IR5A 2IG8A 2GERA 3HL0A 5A4JA 3E8XA 2P5TB 5KKNB 4R40B 3O9MA 1N36O 1U8ZA 3M6IA 2Y1LA 5FA5A 1IURA 2JHFA 5HX7A 1BHJA 4OSOA 4WKBA 4A1FA 1VI5A 2CVQA 2GPAA 3SIRA 1RXVA 4Y2SA 4M6WA 1VSUA 1M2WA 5CAEA 1MC5A 3T1YB 5GTIZ 2YXEA 2V65A 1F38A 5BV1A 2Q4PA 1V2HE 2B92A 5AM0A 2HOQA 3MTIA 4INAA 5JDIC 3IE1A 2B1QA 4RV9A 3I2IA 4FHEA 2JBAB 3IKMB 4PAOA 3TAUA 1ZPDA 2VWQA 4N0DA 1HT1E 3LS2A 4LXQA 4YCAA 3W8EA 4B3DA 4BNHA 4C0SA 1RP7A 1X7WB 1VJCA 4AKTA 1AI5A 2VF8A 4JI6O 1H0RA 3U4MA 3DBIA 3MJFA 3L7IA 1MEJA 3U3MA 4DRXA 2QHXA 2F3PA 3A1TA 5A9SA 3JZDA 4L8WB 5EINA 3CM0A 4FONA 2HR1A 3VMMA 1Y3FE 1EP2B 3ENWA 13PKA 3QE4A 5IH7A 3LLCA 2H3OA 2W6IA 1YJNV 2J3JA 2P75A 1VL1A 3FI9A 4GBJA 1QIDA 4TMYA 3SDBA 4F6EA 3RC8A 5HZGA 2BCGY 4LYHA 2QZ9A 2VP4A 1FFEA 5B8FA 1GZ0A 1WLSA 1GNPA 4EJ2A 3A2KA 4RAOA 3OBYA 4QDJA 1GJRA 3F78A 3BRWD 1KXZA 2WY2D 5EJ8A 1M0SA 4I55A 3BCRA 3K2QA 4FGJA 4OB6A 4A15A 2AIFA 1QUFA 1Y5NA 5HSGA 2GOYA 4QHSA 1I51A 4F1WA 3RTEA 7ABPA 4RHEA 3T38A 3KYDA 4ME6A 3EPJA 1BJRE 1S5PA 1SCQA 1ZICA 2V7BA 4BX2A 3SPHA 1ADGA 3P0EA 5TRTA 3WXMA 1IYZA 4DW8A 5BYAA 4FYIA 4QLAA 1IUOA 1UR5A 5FYQA 3OUZA 4CG0A 3GGSA 3O8OA 5EO3A 3MMXA 1W5BA 3WLKX 1B14A 4XR4A 4LX8A 5AQ1A 3I01A 3N2GA 2D1SA 3BTVA 3IPLA 2O3TA 3GCXA 3L02A 1ZEMA 4RLQA 1XJQA 2XNSA 2LBXA 4FB4A 2R9RB 1JD1A 1X7GA 2F1IA 3COJA 2VPPA 1K5PA 4UZFA 2V3VA 4W1QA 2X4LA 1E20A 4RWZA 1TQHA 5AVOA 2XOKG 1E2PA 2Z4SA 3DXRA 1G5FA 5KNDH 1Y6XA 3DOCA 3TEMA 4UUBA 4WL0A 3OX1A 3D0OA 4XE5A 1OFIA 5MHTA 3S81A 3VU1A 1PEAA 2O07A 3RA6A 1ZSYA 5FUYA 1LWOA 1RWKA 3MQ2A 4TT3G 1CUXA 2GZ3A 1DIBA 3IKFA 1BE0A 3LCVB 3TYXA 1T3HA 4P3PA 1ZD5A 2N75A 2PG3A 3HRIA 2WHPB 3OZFA 3QXGA 1E7SA 3BPSA 4KQHA 2XYVA 4TKVB 2OILA 5C4IA 1TTQB 2YL2A 3B3AA 3SHFA 4OHWA 2QRUA 2FX5A 3ZXUB 3GIDA 4D0RA 3U44B 3OPQA 1OXUA 1CT9A 1XTQA 3TW8A 4GPAA 4PGGA 4PNEA 1LDMA 1RWMA 2IJGX 1XL0A 5C1OA 1E6UA 2FRXA 2LKCA 4PQFA 2P90A 4F5YA 5KHGA 4XUCA 3CXUA 4GX1A 1FBTA 2QUHA 3K4PA 4AZ3B 2O0HA 4DGQA 2WLTA 1UKCA 3Q4HB 2Z2ZA 3V7WA 1XD2A 2YV4A 2IC5A 1BDBA 3ZHYA 3MTQA 2Q7HA 1QR9A 2BTQB 1K4KA 2NU9B 4B6FA 2HMTA 3Q72A 1I5XA 2BFOA 4JBGA 1INLA 1HOTA 4HWOA 3JRWA 5HF9A 3RUCA 2MSLA 2AJTA 3ZNOA 3HVIA 1FNJA 4K9PA 4XQ9A 2NX2A 4ZIRA 1JSXA 3ZD8A 4AN1A 2I91A 1W2GA 2PTGA 2Z2KA 5KWVA 1E9DA 1JKFA 2FX3A 2RSLA 3HDQA 4Q9NA 3GFPA 2F93B 3WY9A 3RDPA 3MCAB 4MVRA 1D8TA 3OCYA 4K40A 2REQA 5K0SA 2P1ZA 2C4VA 4E30A 1CFJA 4I4TB 2Q3CA 5FBRB 3DAGA 3NEYA 1AS2A 1QF7A 4QOIA 1HT3A 2Q6OA 4RSHA 3UG7A 1QE0A 1TCUA 2YWFA 1U5BA 3A9TA 1NH2B 1PIWA 2GN8A 1YK0A 4RZ2A 1L5KA 3A6JA 1QRUA 3W9YA 3ZE0B 4EPYA 1CZLA 1CP3A 1N4CA 1ML3A 3WFJA 3GRKA 4J42A 4D26A 5BV7A 1PD0A 5SZJA 2D1YA 1PEYA 3K92A 4CEIB 4ARAA 5KKCA 3CG6A 3WGNA 1C7JA 1PT9A 4XX1A 1ZK2A 2A5DA 3IV6A 4ONEA 3EOAI 2ZIOA 1ESCA 1MENA 1QH0A 1AROP 1X39A 3RV4A 3I9V6 2R1VA 3S5UA 1Q7BA 1BSMA 4U3JB 1PGQA 3L05A 4BT2A 5AM3A 4JT8A 3DP7A 5BSHA 4KYUA 3D02A 3N0RA 1Z06A 3VYTC 1UFKA 4R05A 2FXVA 1ADYA 4ZVNA 3RSFA 2J3KA 3NHLA 1FQOA 1YRAA 2X19A 3P9NA 4LF8B 5AXDA 4Z51A 4MK4A 1JPJA 3PBKA 4P4UA 4BEVA 4DPLA 4ND5A 5D7NA 5J5VA 4CF5A 1YDFA 3ZDEA 2BR4A 4C0KA 2QTTA 3UV3A 4KWIA 1WDWB 2G5TA 5JJLA 1D0SA 4PFSA 1WR8A 1SHTX 3PD7A 3S4YA 1VQKF 1W75A 2CWJA 5FF9A 1R5OA 2E4XA 1F4NA 1FFYA 1P49A 1L6RA 2KHZA 4U39A 1CS0B 3FD9A 2HBZA 2R6JA 2YWCA 5KEIA 3PDIA 1FNSA 3CEHA 2B1IA 4DV7O 3MQWA 1T10A 2JB9A 2KWIA 3DKRA 4IMPA 2BTQA 2NU9A 2EFGA 4KHZA 5B6JA 4F6LA 1ZCJA 2P9HA 5HQ3A 4PZLA 5JQGF 5KOIA 2YINC 4ZYZA 3K70D 1JDUA 1GRJA 1RAEA 2F1RA 3HJAA 3FHTA 4ZVOA 1T6NA 2ATXA 3O2NA 1DNPA 2O54A 2OD2A 2PMFA 5SY4A 1EVIA 2V03A 2Q6IA 2X9LA 2J9FB 3GJ4A 4XDKA 3PQ8A 1O87A 2QTNA 5JU6A 3GPIA 1RZVA 2EG9A 3K0GA 3C3AA 3C74A 3HI6A 4H16A 4D3XA 5ARBA 1ZJYA 5D00A 1KJZA 2MINA 4PLGA 3OG9A 1SRQA 3ANTA 3FCXA 4MWZA 1LQUA 3L8MA 3OOYA 3JQ9A 5EXXA 1PFGA 4BVGA 1IG3A 2FZ5A 4W8HA 3E1YA 1EU1A 3BEDA 4MHSA 5JAHA 3HA5A 2HQ1A 4K8RB 4TYQA 4WKPA 3PDCA 4X94A 3W6PA 1JRLA 1I6KA 4GOKA 3IV9A 4DNOA 5JH7A 3G6WA 4GSLA 4G26A 5C1PA 2PZ8A 1PTJA 4YDQA 4I9QA 2FN8A 2ECQA 4HNRA 2XDYA 4LMPA 1QQ5A 2BE3A 1MP0A 3UCSC 1XFDA 2PUHA 3G7SA 3OLVA 4QGPA 2V59A 4L5CA 1AZSC 2H2HA 3IT3A 3VSDA 4PSUA 4TV8A 3PGXA 5BSGA 5C3MA 3CVWA 4UDXX 3T5DA 1AIPA 1OWNA 2FPGB 4CMGA 1TO1E 3BE8A 1QNMA 3GGCA 2WD8A 1XXHE 1ZCBA 2HRRA 5C5CA 5EHZA 1D8AA 2CXOA 2HG5C 1ZM9A 3QFTA 1JEQB 2J3DA 5IASA 4MS2A 4YCLA 4HNAA 1ZRHA 1UK6A 2EBOA 3NYIA 3WWZA 4CUZA 4YJGB 2EJTA 5JANA 3MXTA 4LHVA 3NDIA 2HADA 2JRLA 2PTHA 5CDFA 4UCRA 2XCIA 4OSPA 1P2GA 2B8TA 2GYVA 2HP3A 1G2PA 4J75A 4IIJB 1Q6IA 2R8PA 2VJBA 3IXQA 2AZMA 1F4MA 4XRRA 1V55B 4KR7A 1FSGA 4OK3A 1C9EA 3FYCA 2ZRIA 4ZEWA 4DIFA 1PR5A 5JNWA 1JHVA 1RC0A 4W5OA 2WICA 3NWJA 1H4VB 2I3DA 3BRSA 4YT5A 1J8MF 2CHVA 1E69A 5K3OA 2X0DA 2PZFA 3KQNA 1OCZC 1ZCFA 2MWMA 2KQUA 2KJQA 1USGA 4L4ZA 2I2BA 3HPQA 4BU0A 4TQUS 3E70C 5EXDA 3M5WA 3X2EA 4WA8A 4DCNA 4YRAA 1UM9A 2ZSAA 2C2GA 4BUJA 5G41A 2R8ZA 4MV9A 1LRJA 1ZESA 2OAGA 4QNRA 5JXWA 2Q8QA 4B3MB 2IOQA 3SOZA 3W77A 1XL4A 2P9GA 1CU1A 3EIEA 1S01A 3HJCA 3DXYA 2WUDA 3B82A 1W2BF 3UT5A 3A1FA 4FFMA 3KZNA 2WIGA 3QW2A 4B35A 4RD2A 2VK2A 2Y8EA 1F6WA 1KY2A 1QV6A 4DCTA 3U4QA 5AVSA 4OOEA 3X1WA 1EVEA 1VIMA 3QVLA 2ZUUA 2XITA 4U9IS 4BWFB 4JUAA 3HZRA 2F1OA 3MAAC 5AVZA 3U0OA 1WJZA 1WUJS 2HREA 2JGAA 2JIDA 5B3JA 3SD7A 2X0NA 3QE0A 3X2QB 4HDNB 1QFZA 1G8YA 4HX2A 4W9NC 1X1RA 1MGPA 1D1QA 3GA0A 5JI2E 4R2HA 2C2BA 2B37A 2BBWA 3MAGA 2FF5A 3C8UA 1UMCB 1V7PC 3EZ6A 4FZRA 2RQ6A 3ZU6A 4YXFA 3OX4A 1BMQA 3HA3A 3UGJA 4TKVA 2BHRA 2CK3D 2QRHA 3E61A 2IXTA 5CVEA 3RYFA 3ABTA 4ZD6A 2PO7A 2ZW9A 4J7ZA 3MRSA 4M0LA 2LCQA 3GPLA 2PUVA 4UBLA 5CBPB 1BCSA 3PGVA 4KE7A 3WYBA 3AG3B 2FR8A 3DLBA 1X8LA 1R10A 1F3OA 1DB3A 2AXNA 2I22A 1MRNA 1QIMA 1XAHA 4AY2A 1IQ0A 2OVBA 5FR2A 5C35A 1OWPA 1NP3A 2JJ2G 3ZRWA 2V9ZA 2G83A 1BCCH 3WP1B 1LDBA 4B4VA 1EP1B 3U56A 4KI0A 4X71A 3FMIA 1OA0A 2QZSA 2ZYIA 4P82A 2QY6A 4BKPA 5K1XA 2UXCO 3UK2A 4N5NA 3DH0A 2R6ZA 4K6GA 1G3RA 1VDMA 4W5NA 1ATIA 1OHHD 1E8MA 1L7PA 4Z7JA 3W4JA 4CQLB 1KJYA 2B30A 1VFPA 1WCIA 1ZU4A 3JYOA 3FPHA 1KO1A 1G8KA 4IDHA 4I5DA 4Q4AB 3C5WP 5JYDA 2C7OA 2J0QA 5KMGA 1SY7A 2IP4A 4DV1B 4L4UA 3HR7A 1BZYA 3CYQA 1ECBA 3WVNA 3JSNA 1MABG 2J07A 4MUIA 2WPDA 5CB4A 5EIWA 2W71A 5PGMA 2Y1KA 5TS3A 1D2GA 4F5WA 2OHOA 3I9KA 4QGAA 4URYR 3DL4A 2JLAA 1FFSA 2RHWA 3IP3A 4Q7KA 5HF6A 3CY6A 1R0RE 4G0QA 1X7PA 2YR0A 2YRXA 2VNSA 4NE2A 1LPBB 3IPXA 3V6MA 4BX9A 2W48A 4X90A 1QYXA 2AQ8A 3OTOO 1HSZA 1X38A 5H6RA 2QUBA 3EXHA 4C7BA 3IEXA 3M6XA 4QHYA 2ID4A 3RVQA 5T5QA 4PSKA 5TQJA 5ESRA 3TVTA 2QGNA 1A1SA 1IFXA 1EM6A 1FP7A 1Z2EA 3OF2A 4B3IA 4HYEA 4ZAXA 4IIGA 4J7KA 3DEYX 3EDYA 4ZHWA 1XAIA 3PQ4A 5C80A 3LA8A 3UHAA 3FB4A 3ZWBA 1L1QA 1R9NA 3F9IA 1SAYA 3HWRA 2MT9A 1QGUA 1X25A 5IT9A 3ZIDA 2PX8A 4TSRA 3S06A 1UWCA 3FGNA 3IUJA 3GP3A 3TLJA 4IDFA 4R8SA 1P72A 4EGFA 3AERA 3DXFA 1QYCA 1DAKA 1KU0A 4GC9A 4JLPA 3SR3A 2GVNA 1VSQA 3CLTD 3THSA 5AW1A 1E2QA 2DWOA 3NV7A 1D07A 4D9EA 4C5BA 4DY4A 3GJ6A 2GVIA 1ONOA 1TYZA 1PV0A 1QB8A 2AYZA 3IQGX 5AVXA 4CGZA 4OLBA 2DYRC 2CDNA 1LX6A 1GNRA 2AKEA 1MO2A 1IBKB 2LDBA 1L4KA 1IN4A 2XB4A 1K8XB 3GEHA 1F06A 1DAPA 3L8CA 4FFPA 1TE2A 4G2NA 3OFSA 2J5XA 4G4JA 4X6YA 1R8SA 4AYXA 1EIZA 2XUHA 2IS6A 3HDGA 2J6HA 1QTIA 3QV2A 5HEKA 3EAGA 1YB5A 4LCUC 5HXZA 3O4GA 5GGXA 2PSHA 4FUTA 2BFWA 4YRQA 2OTLV 4MCIA 4URXR 2CMKA 4K6MA 3VNSA 2IS4A 3MGBA 4WVLA 1H2EA 3IEQA 1YQXA 3DG9A 2QJFA 3R5SA 4NBVA 2EFEB 4DLKA 4W5TA 4O1IA 1WMAA 4AJ9A 1SXIA 4J03A 3GMTA 3PUJA 4UTZA 3BICA 5GQSA 3HM9A 3LBIA 3ZGLA 5L3SB 4HPWA 3UMRA 5ALNA 4JZGA 1YFKA 2CFRA 5CNJA 3F5TA 1J7HA 1DCFA 3BAZA 4RIIA 1ODCA 2QPLA 3CKKA 1L4BA 2B3TA 4NMWA 2K2QB 2AE2A 2V7VA 4L07A 2Q3LA 4IDBA 3MFQA 5E6SA 4AKSA 2BHNA 3M99B 3GJTA 4LJ8A 5ALEA 1ENOA 5B5EZ 1Y81A 4I50A 5D7BA 1SEVA 2NYUA 1N0UA 3QI2A 2WALA 3ZG6A 2VSOA 4HOYA 3VQXA 1G4HA 2JAOA 3RABA 1G20B 3AFOA 3INYA 1UMKA 2FA9A 2GI4A 3IILA 3PCRB 4G8CA 4AJOA 2RAPA 2GCPA 2C2AA 2PJDA 2MSCB 2W2VA 3L0OA 3LBAA 5JJEB 1XXLA 5B30A 4AMGA 4A6EA 1NDUA 2OB2A 1YMUA 4OLHA 4UHFA 5JSZA 3DOIA 4A5UB 2VUIB 3PYXA 3SCZA 2O5RA 4KFRA 4EHNA 1HYGA 3E48A 5ERYA 3WDLA 1ONIA 3PVCA 1ISMA 3E8MA 5K3EA 4IBOA 1DF4A 5TVGA 2IPOA 1NOIA 1LI5A 3PX2A 3LWZA 2IKQA 4ALIA 2OCXA 1YFZA 2BEKA 1KD1W 2HSJA 2WM9B 2Q4BA 4NBUA 4P7FA 4TRRA 5I7VA 5JJCA 4YPOA 1RA4A 1E79A 2W2KA 3I2KA 4D57A 1A98A 1ZU5A 1JPNA 1DBWA 3L7DA 4RPGA 3A05A 1THZA 2YWJA 2VPXA 2ZB4A 3T2MA 2CUGA 4Q48A 2GLZA 1KD1H 3OMNB 2FSPA 2H5IA 1DEAA 2ZE5A 3FYHA 1J24A 1FLDA 1LV8A 3AHIA 5IWCA 5EZQA 1ECFA 4XD2A 5K0LA 4YRSA 3UFXA 3O4JA 3VC7A 4DLBA 2A5FA 3E5NA 4P3KA 1Q7YW 4JELA 1T5OA 4RWEA 1D5NA 2ODMA 2CSUA 3F1KA 4ZI7F 2CBGA 2G70A 2VJMA 3G5UA 3EZXA 5GPBA 1HDXA 2IHJA 1YWGO 2MSEB 1IATA 1BMDA 2P9BA 5M29A 1SZXA 3JZIA 2H7VA 3HADA 1O97D 2GBGA 3MCWA 1SG6A 4ES6A 1KOGA 3FTFA 3M4ZA 3SC4A 3FOCA 3ZDXB 1DIGA 3IMPA 2CLMB 1SOUA 3E9MA 2ETXA 3L8YA 2XA9A 4OQYA 1NI4B 1U2RA 1PL0A 1AKEA 1ZUHA 3AWIA 3KZCA 3EUWA 3PTZA 3FMGA 5LBUA 3TXYA 1IHYA 4GKKO 2AV6A 4ETIA 5L40A 1CR2A 2HSDA 3N74A 4WNCA 3G7UA 3BQNB 1S0UA 2VF4X 2PBRA 4WK0B 3AEUA 4KLRA 3PHHA 3FBAA 1XZGA 2GETA 2O2IA 4FGZA 2FJUA 2PGDA 4UM9D 4EW6A 4I36A 3WGYA 1LRKA 4TROA 5AK0A 2ZKIA 2DTXA 5ADVA 5CCXA 4GLOA 2GNPA 1W5SA 3VR6D 3OMIB 4O4HA 3M4XA 4PNHA 2UZ1A 2OCKA 5GONF 2BOBC 2HP0B 2C0PA 2Z8ZA 1FU8A 3NASA 2ZK7A 3GLTA 2IDZA 5F1YA 1FUUA 1N57A 5FRDA 3EIHA 1DVRA 1QCDA 1OB2A 2NP7A 1ISIA 4YMIA 3O8DA 4L74A 2VJMB 2ZI6A 4BAYA 1ISJA 2Q0SA 1IV4A 3E2PA 3RD5A 3V8PA 5KWSA 3KR2A 3FRHA 2WV7A 5AVWA 1SC3A 2BOVA 3CUUA 2JCYA 5JH7B 3E8HA 1ZGZA 4JV5O 1UC9A 3EVFA 1AHHA 3RKRA 1PR3A 2ZDIC 3GUYA 3DBHB 2KX7A 3R5KA 4MR8A 2IH3C 5CH3A 2Q3HA 1U1DA 3JQFA 1K68A 5KOJA 3GJXC 3JQGA 1X15A 4PYKA 2NV0A 2WF5A 3SPIA 1D4OA 3G2LA 2XCLA 1YDXA 3IDZA 3EXG2 1GG9A 3WIDA 4R98A 3THRA 4CM3A 3LDEA 2OV1A 3KPYA 1Q0HA 1IHOA 1QYIA 3M33A 3OLCX 4B7CA 5J23A 4B73A 2H1OA 1OJLA 1C0LA 3PR1A 3RW9A 1U99A 1TFRA 1II8A 2LXNA 3GMIA 1LQ2A 2IVZA 1DPGA 4JXXA 5KAIZ 5CEEA 2COKA 2QRZA 2XCSB 1K7EB 2Z2XA 5TDHA 3QE9Y 3EYWA 2O4CA 4ZQBA 1H2ZA 3ICPA 3H84A 4XFKA 1OHHG 3FD8A 2C2XA 4K2AA 2Q69A 2R87A 2O6HA 4L2IA 1FP2A 1XRLA 2D2EA 4UHDA 3LT5A 4UCSA 1ORHA 1VQKV 2OV3A 2QE7D 1X94A 4RD4A 1UJCA 4AECA 5BR1A 3P5SA 1Y4SA 2JEOA 5IVHA 2X6CA 1E63A 3CMCO 1WY5A 3IVRA 4N65A 1FVOA 2KG4A 1JLMA 1GPBA 3FOBA 3JZMA 1MRZA 2H1FA 2UVDA 2PYZA 4GI5A 2VDOB 3HJBA 5CDHA 1SVNA 1GAWA 4OJNA 2WWTA 1FQWA 2J48A 5AI5A 3WGQA 1WZUA 2CNKA 2QAGB 4RC9A 3K0HA 4XVUA 3KUXA 4QPJA 3B1KA 5U4XA 1KY3A 3QRWA 5AHOA 1QKKA 3VZQA 3DGEA 2Q2VA 5EJFA 1S72V 1BD3A 1BNCA 3TDNA 4A0SA 3H2YA 4JJ6A 4NL4H 2B4YA 5CMUA 1VHTA 4XW2A 1MO5A 3TLEA 5B3LA 5HFJA 4B6GA 3MUOA 4ZOAA 3L6DA 1E99A 5K4AA 3D8CA 4DR7O 1RU3A 3IOEA 4BNDA 3GDWA 3H97A 3ZTYA 4K3AA 5AR1A 2AQKA 1K3TA 2FPRA 2AW3A 3AJ8A 4QPJC 4OATA 3D2CA 5LQSA 4DB2A 1X7HA 2WM8A 5F51A 1GKLA 4AUKA 1VKZA 4RPIA 4EVQA 3L01A 4E5UA 1L3CA 2NQ2C 4HAWA 1YJAA 4GM0A 1GV1A 4LECA 1N8NA 1SXJC 1H2XA 4QEDA 1Q86W 3R9IA 2GV9A 3ZK8A 2ONJA 1P0IA 4FSDA 3AFHA 4ZQIA 2NU6A 1DHTA 3K5OA 4R4JA 4TV9A 1PJ4A 1ZOIA 1TRKA 1NV8A 1VHJA 4UDNA 1Z6PA 3NBMA 4YBZA 3H83A 1EUDA 3KQPA 3V9AA 3W78A 4CJXA 4CUKA 4NI5A 3MCAA 3MIZA 4JLJA 3SX0A 1NBME 2O0KA 2H4YA 2RHMA 3U7GA 2VJNA 4OTZA 1C8KA 2GEFA 2HWUA 3FNFA 4F9TA 3QTTA 2BMEA 2EKDA 3F67A 3AVVA 1JJAA 1WPQA 2VSNA 3ZQ4A 4Q6BA 4CMKA 4DARA 3W1VA 4OFZA 4ZAVA 1DGQA 5FOVA 3LYHA 3MUEA 3STZC 2NVUA 2HPAA 1A9YA 4MWCA 3KDAA 1SF9A 5EHIA 4NCIA 4YREA 1BROA 5EBLC 3DE5X 1ZBDA 1IVYA 1NPTO 1RXUA 2VXOA 4HAUA 3KSMA 1E6WA 1TF7A 4EYOA 2C5BA 4EUFA 4TMTA 1DHRA 2BOCC 1IHDA 2QTVB 2BYTA 3EMBA 4MGIR 4HMOA 5FORA 2VSQA 3R77A 1DX6A 4UV8A 2G77B 4KRXA 1KKCA 5KYWB 2O8VA 3UQ8A 4RDIA 1MAVA 3MB8A 1T0KB 3CH7A 4B8WA 3CRVA 2H8PC 2C3YA 4IILA 4E5PA 2LCAA 3ETJA 3IDOA 4FPPA 3CRW1 1YC5A 3KKYA 3BXGA 2G71A 4NQ3A 2A5YB 1SVKA 3I9NA 3Q41A 4ROSA 4ZU1X 3SFVA 3QELA 1KGDA 4M54A 4FM9A 3DLHA 3WBKA 1XYVA 3M7IA 1KC3A 2CXRA 1THMA 4FD2A 1CY8A 3RSSA 4EZEA 1HQKA 1I13A 1FE8A 2AJCA 2ZBVA 4MEBA 1W47A 2I87A 5AK3A 1BGVA 3NC0C 5BNZA 1NE7A 3HYTA 1Y63A 4HRVA 1KRWA 2X0KA 3RSLA 4ZHYB 1JT2A 5CB4B 3IA7A 3LKBA 3F2IA 3MHPA 4HAIA 4I19A 1VPDA 1O95A 1XDSA 5G0SA 2HA7A 3JQBA 3A8TA 3QVXA 3WYGA 4O2AA 5ITSA 1YR3A 3VKHA 4Q9JA 3NRBA 1NY6A 4TS3A 2AOWA 4UVHA 1GTOA 4RHFA 4YLGA 5HFLA 1QHNA 5EBWC 1ZXXA 2BGRA 1T5EA 2DAPA 2P3LA 2HP8A 1CVLA 3I2YX 4MW7A 4JEMA 5AI0A 1H2NA 3W90A 1MU0A 5HY0A 3W5CA 2JVDA 1U1FA 2APJA 2XF2A 3VR1A 3QEBZ 1LLFA 3GZNA 3H6HA 2ORIA 1CFZA 3AEZA 3OIUA 4WY5A 3U7IA 2LV8A 4DQXA 1U1GA 2CUNA 1AZLA 1JAHA 3OM9A 5ALRA 4PQEA 1SXGA 4TT3A 5AT1A 4A6PA 1YS2X 2G28A 4HQKA 4MCHA 3K35A 1T6XA 2BL4A 4JMPA 1OTXA 4O08A 3K09A 5EA2A 3PXGA 3ZMTA 1GTG1 2QRMA 2WUFA 3B2EA 3ILHA 2ISCA 4LK3A 1OJHA 1IDOA 1N6KA 2QMQA 3G6KA 4R2JA 2CCJA 3T7IA 4PA9A 2AD1A 1H5NA 2VH2A 4NLLA 4DRZA 2FMIA 4I1RA 1W41A 4OMDA 1RYZA 4OU4A 3ZRVA 2C5AA 3E7DA 3DXRB 2UXDO 3QPUA 5C46F 2BM8A 4X65B 4BLPA 2VP6A 1Y1LA 4PU0A 3FUWA 2XYQA 3RODA 5KQLA 3GAMA 5BPHA 5JO9A 5JMOA 2R8RA 3RIXA 3K0DA 1VYUA 1EVKA 3AJRA 4QYTA 3RAGA 2PBZA 3TR5A 4WLEA 4DRXB 4CVNA 4JKIA 3QEMB 1ZVMA 4CR7A 4OQNA 2OXRA 4BHTA 1X1SA 2JJ2A 3LC7O 4Q82A 3OI7A 1HNZO 1COWA 2RGUA 3WGUA 4TTVA 5KJ1A 6REQA 4XCVA 1KO4A 3CVOA 4MXDA 4NBKA 5LIPA 4QU5A 3ROMA 5CB8A 4HUQA 1H6CA 4YK7A 1JQ0A 1TW3A 2ZS7A 3ML1A 3OZIA 3P71T 4CU2A 4L1KA 2J7PD 4MWDA 5DNAA 4QUKA 1KKUA 1BQ3A 4A92A 3KYCB 4M1SA 1JDZA 3REGA 1ZZGA 5K0FA 3SGLA 1QH1A 2LP7A 3ZV4A 3ANYB 2O52A 1Y34E 4Z9XA 3V7YA 3HKDB 1DTSA 5ERXA 3OQOA 2HDHA 2YZMA 4UM8B 3SBDA 1E60A 1MPXA 3KDSE 4GOXA 5FUMA 1CTQA 1N1GA 3BTUA 4P2ZA 3IBTA 3V3KA 1XSEA 3PNPA 1XZBA 2ZBGA 2BKXA 5B6IA 2OCAA 1KEEB 3GNLA 5B58T 4DUGD 3HHEA 3P0RA 4Q3DA 1U4NA 3DMTA 1AG9A 3EARA 4Z9YA 4ADSG 4F3YA 3UY4A 2XKJE 5FNVB 1JHQA 2O0MA 5YASA 2Z3WA 2ZSDA 4BTLA 1JNXX 3OETA 3L07A 4YCDA 1R3IC 1DDIA 1C7RA 1ACLA 4X66O 1NLFA 3LKDA 3P0HA 2ZRFA 3BH6A 5KTKA 3A7EA 1W36D 2IPMA 1X86B 2Z04A 3MF4A 5HIIA 1J0EA 3GROA 1P17A 3IR7A 2PFSA 4ZYTA 2OMKA 5HIKA 2R8OA 2VQFO 2AZDA 5K7SA 2WWFA 1NVTA 4TXMA 5F2EA 4Q3AA 2YKGA 1GM9A 4TQDA 1EG7A 3UT5B 1T4CA 2HU7A 2NUPA 4U7WA 3GAZA 3P2YA 4UUNA 4EVRA 2KPOA 5JJ5A 4TMVA 2JIMA 3WL5A 5DIFA 1V1RA 4MA5A 3ZVKA 3CSXA 3FTEA 2HB6A 1ZL8A 2WF9A 4EMSA 2LWIA 3HJRA 3R3ZA 3UF0A 4COOA 3K6SB 1JLRA 3CGWA 4G85A 3G8YA 3PHIA 4RL4A 1EDDA 4ZI7B 1HV8A 5B4UA 5CHEA 1YDEA 4ILKA 3HEMA 2PGGA 4YI5A 3ZK7A 4DT1B 4DNFA 2IH2A 3J81N 1ZOPA 2AN4A 3RWBA 3QNUA 4LTNA 2PSEA 2XGMA 2WIFA 3LFTA 4LJ9A 4TVKA 2VWJA 1JIUA 1NTMH 4L3WA 3A6LA 3MN1A 4TMXA 2FEWB 4LAFA 4AG6A 1RPOA 2VVTA 2RHCA 1IBLB 3ZS8A 3T1TA 3TOVA 2DLNA 3KELA 1NW7A 4IMRA 5EWLB 2J3MA 3K4HA 4BKOA 2VAMA 5JOQA 1ELOA 3KDPA 4OA5A 1XDBA 2X8AA 1H1LA 2VPIA 4P4SB 2F43A 4YCJA 4YMWA 2WJYA 4MTFA 4H4CA 2X58A 1IBKO 4HDAA 1OCEA 1JJ2F 4HQNA 4XPIA 1UOEA 3NIWA 5T7BA 3VPCA 5ER9A 5IXJA 5M7EA 2Q6AA 3IC5A 4TS1A 1RPJA 1YS9A 2HC9A 2ZEJA 1H6DA 4ER5A 1V54B 1UOPA 1GGVA 1R3UA 4KP4A 3ESCA 3NAMA 1WTAA 5D3MA 3DE2X 4BNTA 3ZDBA 5KBYA 5AW9A 1MFZA 5DULA 2X6BA 3R3SA 3O4VA 4LF8O 2G7MC 5FBKA 4EW1A 5JV5A 1HR0B 1MCZA 4DA0A 3Q85A 1SUBA 4NCHA 3UMMA 2PMBA 2FR8C 2ZB8A 3QVOA 4JAAA 1NMEA 1UP4A 3H1HH 1VKHA 3AILA 1DOZA 1ZMOA 1K0UA 2GN2A 3IBSA 2IYPA 1KVSA 2VAWA 4WESA 1E9EA 4J0QA 3JCMM 1PXWA 4IV8A 2VYCA 4L8GA 5JS6A 4C3OB 2JZCA 4RY0A 4PYOA 3B1WA 4Z3KA 4II7A 1KORA 3LUTB 1C1DB 1E9VA 1YH3A 1G5QA 1EX1A 2A1TS 4J0GA 4Y2QA 4KITB 2CV2A 3L8GA 2Z09A 2UVPB 1GU0A 2W83A 2VNKA 4R1UA 4XB1A 2Z1DA 5IYZF 3ENNA 1RWNA 3F6PA 4X6LA 2DPXA 1X3SA 4PC6A 3DDNA 1GZ5A 3F49S 3B89A 5ALLA 1XTTA 5BXQC 2QVCA 4K0KB 1I5EA 1YCGA 4YAFA 4U2GA 1FTSA 4EBBA 4ETMA 1EWYA 4JEIA 1YUBA 2D3OW 4YP6A 4RELA 2R9IA 1VA5A 1GL6A 1ORTA 3SXJA 1Z5VA 1Q5PA 1SUIA 3I55V 3LPNA 1PQ4A 1N2CA 3WRYC 4HWKA 4JBLA 4E6EA 1Z47A 2YHSA 3KV1A 1DQRA 4FOSA 3E22A 1ZEJA 5CX1A 2PHZA 1VE1A 5DGCA 3WRVA 4S1NA 3HI4A 4ZI3A 1QPZA 1ZK0A 5I7UA 1OUMA 1ULHA 2FPSA 2NSLA 1RW4A 3DL0A 3E9QA 5FLXM 2Y69B 2C2WA 3BRCA 2JK0A 3O3OB 1QE3A 3OE7A 4MQMA 5IW8A 3I6ZA 2FOIA 3OT4A 5IK2A 4I4TA 4CS2A 4NYJQ 1DMSA 3K7EA 3QU2A 1EE2A 1C5KA 3IULA 3UXMA 4HT3B 2XB6A 1HE2A 3HLKA 3Q9UA 4RFSB 1Y9ZA 2C57A 4KGDA 5A5FA 3DUWA 5ADUS 3V46A 4Y2YA 4JJAA 3PUXA 1COZA 2NUAA 2EULA 2B5UA 1HT2E 1P7WA 2HDOA 5JSHA 1YD7A 5HVNA 4NONA 1MNAA 5FWXA 2GBIA 3JYCA 3I9MA 3FFQA 1BDIA 1SU8A 4CE6A 1F48A 2ATEA 1GPH1 1O97C 4WNAA 4K7JA 5IZCC 3GMDA 1B1AA 1K4DC 3MVEA 3ND5A 2JGUA 4LOLA 4MUNA 1X7YA 3DEFA 3F4KA 4U3JA 3TQIA 4IZOA 3QVGA 1BHAA 3A9VA 1V4BA 1N9GB 3JVEA 3EW9A 1ZUIA 2PJZA 4HV4A 2PD3A 1I6MA 2QV7A 5BT9A 5U1PA 3F74A 3PHGA 5FEMA 5K8JB 1BH2A 2HK9A 4GYKA 3JWJA 3KNZA 4FIDA 4KYVA 3ASNC 4Y6OA 1WHSB 1RWOA 2JLBA 2QXUA 3WB1A 4LFAO 3BWVA 1DBFA 1I1HA 2IYOA 1NZFA 2IEIA 3TRKA 2C97A 2XVXA 3MA0A 4X3LA 2ZIWB 2AGAA 4L3VA 3BRWA 3Q8WA 4JYAB 3VHQA 3WJ1A 1E3SA 5GTHZ 3ONWA 1F5NA 1F12A 2G88A 3MB5A 4XSHA 2H7XA 1ADBA 5CIYA 3D7SA 1GNQA 3QFRA 1JKIA 4LF9O 4MRPA 5BORA 2BKVA 3GRCA 3BRQA 1CUIA 1AF4A 2EFJA 1T9BA 1ZAKA 4JQCA 3KXDA 4P4TA 4Z4IA 2IX9A 1EGHA 1KJ9A 1PN3A 1UBUS 4RJJA 4D2IA 2JG3A 1JQ3A 4YUZA 4OJQA 5B3SC 2EZTA 1AR4A 5LKAA 1NQXA 2BLLA 4RTJA 3HXOA 1GARA 4C5AA 3ZD7A 2FGYA 3VPHA 1WLYA 1OH5A 5CFNA 2CYBA 3LZCA 4B3MO 4CI0B 4DCJA 2V7TA 4DJ5X 3MTAA 3LUJA 3IIEA 1QFXA 3D7KA 4IEEA 1W8DA 1VM6A 1X7XA 2YBEA 1HA3A 5EFZA 3PSAA 3REQA 5BVHB 5GIPE 1QAHA 7YASA 2OXEA 2DF8A 3ZCSA 4G4IA 2DWDC 3NDPA 3RQIA 1J2EA 4QU8A 2DLDA 1J06A 1K8RA 1RM3A 1VIBA 4NXNB 1H8HA 4Q4AA 3KKLA 3RREA 4H77A 3HB1A 2J41A 2PR7A 1W0JG 2G09A 2P06A 2DYKA 3CF4A 4F3TA 3GFSA 4U0KA 4PYMA 1IV3A 1JL3A 3KUUA 3JZAA 1JX6A 4YCSA 1ZM7A 4ZN6A 2FSVA 1MG1A 1PT6A 1SOWA 2QKYA 4WADA 1T8RA 2YY6A 1E2JA 4RU1A 3ZJTA 1U9YA 5JDCC 4FT4A 1NSYA 1O89A 4E2FA 2RBKA 2DU8A 5FBLB 2ZRAA 1K3EA 1L5SA 3VKUA 1KEEA 2Q9LA 4EFBA 1HDRA 3K06A 1HFKA 4EFDA 2VHZA 3IALA 4IUYA 3H9JA 2FG5A 1IPEA 3I9V1 3M84A 2NO1A 3LG2A 4XFJA 3VDRA 4IOKA 1W36B 1JQLB 1BDMA 4H15A 4RFSA 4B82A 1OXKB 4EHLA 4NZYA 5F3DA 1OPRA 1V35A 4ON9A 1H4QA 2RGXA 1ZD2P 3BTOA 4IKEA 2XADA 1ZQ9A 3H87A 1BKSB 2X1VA 4DQVA 1RFYA 1QQTA 2FB5A 2ZSFA 1ZH4A 4QA9A 1TUBA 2I0FA 3V4VB 2QG4A 1MW9X 2ETNA 3REQB 4AQDA 2ZT5A 1T35A 2HLNA 4ND7A 2JVJA 3KHTA 3QZUA 1IY0A 4OYHA 4B3SB 3LDUA 2QX8A 3K08A 3AERB 3SJAC 1TA9A 2VDQB 4M21A 4P9NA 4B0PA 3N2IA 1FW6A 3GP5A 4LH6A 3ABUA 4DV6B 4TYPA 1C3LA 1AP5A 1YRYE 3PWKA 4QTTB 3P4YA 4FFDA 5DH9A 5DGXA 4UFPA 1G8GA 1P7YA 3SDZA 3H2BA 1L6IA 5AK6A 1B8NA 3GG2A 2UYYA 4J90A 2BFPA 4P5EA 4DV1O 1UPBA 1R6NA 3BMXA 4G0NA 1P80A 2D5CA 3GARA 4TM7A 5F7XA 5JCXA 1IK6A 1Z4LA 4G41A 4GZRB 4EF4A 5C52B 5K6RA 4R2IA 3BKXA 3EN0A 3PHBE 4GM4A 1HGXA 1PT7A 3J7TA 4HGNA 3HAXD 3BDAA 4JJ4A 4MVJP 3WICA 5TARA 1SVWA 3V80A 4W7HA 2OBYA 2JBWA 1MH1A 4ZICA 1AY0A 3CJHA 1FU7A 1M1NA 3GBVA 2BSKB 4YAIA 5IHXA 1Q2UA 1SKYE 1YNOA 2WVGA 4PGHA 4I08A 1P1CA 1QAMA 4I46A 5FOSA 3DC2A 3U3XA 1L7EA 1OI2A 3PVZA 3ZBHA 5AICA 3JAMA 4MROA 1XRMA 4F85A 1XN1A 2KLBA 2F3RA 3E53A 1LPNA 2HVKC 3LKVA 4TMZA 3K04A 1WPGA 5T6BA 2OZLB 3HZZA 2NPFA 2VP3A 3AP2A 4Q3EA 3SKYA 3N2LA 3RS3A 5D3MB 5DGDA 2HJHA 4PZZA 1M6NA 4YP9A 221PA 1GHTA 3GFBA 2AN9A 2ZXWB 1LY1A 4FI3C 3U4AA 4M1EA 1E4EA 2AG5A 3GJRA 1B0ZA 2CUKA 4JP3A 1PO7A 4BLOA 3I3FA 2ZR3A 3O9VA 4MIYA 1CQJA 3CC7F 1RS0A 1VJDA 2C92A 5JO0A 2P2LA 1XQWA 3H5WA 1UM8A 2H51A 1P7PA 3DBOB 1US6A 4X20B 3JX9A 3ZBPA 1VEWA 4MWTA 3IJEB 4IOLA 4AMBA 2YZKA 5LBQA 5KNDA 2D2FA 1LPOA 1C4KA 4XWGA 4Y8VA 1ISSA 1KZHA 5IKPA 4X7PA 1XV2A 1PQUA 3W7XA 2HNBA 1GQSA 1UDRA 2W6OA 3TLZA 4PN7A 5FPKA 2QNRA 2XUZA 5CLLA 3LJKA 1YRBA 4GNKA 3NHAA 1TVCA 5JVDB 3J80M 4F2WA 1A2KC 2CXTA 3SQXA 4QE7A 1MA1A 4HAVA 1T43A 4MJLA 4QUJA 1FQKA 5H82A 3N5KA 3GLQA 5FHRA 5T6MA 5KSPA 1WB6A 2XMBA 5LNK1 4FGLA 1SB8A 2W6MA 2QR5A 4MINA 5EIEA 4LCBA 2OESA 4UXJA 3SPXA 1Y5RA 5KNBA 1Q3TA 1VQ8F 3S02A 1Z73A 2PL3A 3DNFA 4JGGA 1Q50A 1OCZB 3L18A 1RXSA 4AAYA 5ERGB 3HKEB 3WXMB 2PX5A 3JVVA 2PS9A 2Q99A 1N4AA 3GLKA 4BV3A 1WZIA 4EMUA 2ZM6O 3CW9A 4AJ1A 2HV8A 2YCLA 1BEZA 1ZWIC 3KBBA 4DS3A 5KTPA 3LWVC 4RZ3A 1EJBA 1PAUA 1IONA 2ZZNA 1KH3A 3H8JA 5DDIP 3BMQB 1FDSA 1VPTA 3RFFA 1C80A 2PDAA 1DELA 3H7AA 4J0JA 5G2OA 1GT6A 4DBLE 2AIZP 3UENA 3N7AA 1EK6A 3TD2A 1WEKA 1A0OA 4BEWA 4QPKA 4P35A 2AKAB 3I9JA 5KOYA 2J3HA 1U02A 1S8NA 2BISA 2AZ0A 2C00A 1XLTC 1YHQV 1NNUA 3R0VA 4HEA6 3U81A 2GH1A 1QH9A 2DFDA 4EYKA 1VF7A 4ZYVA 2BSKA 1K98A 3SX4A 4E5SA 4BNMA 5LQAA 2YCBA 1ZAYA 1P84F 3GFVA 3GF4A 2XAJA 1H2AS 3CZ9A 4RTLA 1DJQA 2KBEA 4X64B 2X5OA 3BMCB 3TK1A 5K0TA 1LSJA 5BSTA 4YRBA 2CHFA 2UAGA 1U65A 1SVUA 4N3BA 1OYVA 2C5FA 2EP8A 4EY5A 1K7CA 3JQAB 4URFA 4NHEA 4XJSA 2Y9MB 4AI6A 1OT3A 3FPLA 1Y7HA 2HPVA 4QREA 3V8BA 1ZRNA 3ORQA 3B09A 3NKLA 4MYTA 1O6CA 4QJ5A 4RPJA 4V0ME 2KE5A 1CJKC 1V6CA 1M1YA 3QKIA 3T6KA 1K34A 1MVNA 3LA6A 1TZ2A 4HQ6A 1BCRA 1QHHB 2Y1DA 4L4RA 3IUEA 1JXOA 4DQDA 4MPJA 4YRIA 3GLIB 2OT5A 1R2QA 4CTNA 2PUCA 1PQWA 4J16A 2AC7A 4LSZA 1OMOA 3KS9A 3VQTA 4ANFA 3VI6A 5DM6V 1U9ZA 1GM5A 3KEGA 2B20A 2I2DA 1G3QA 1UBLS 2ZRBA 3ENKA 5ADWA 1ZUWA 2C4MA 2ZOSA 4W99A 3UWPA 3ZCPA 3ORRA 5IMSA 2NZJA 2RK6A 4WCFB 4PLWA 1W85A 2Q6VA 3WV5A 4C0JA 4UEJA 1N32O 5CB0A 4G0UA 4X1KB 1AF7A 2REQB 1IZZA 3JD4A 1NQAO 2UUPA 1OX6A 4PSVA 1N2EA 1VOTA 2DT5A 4J16C 5CXSA 1VDZA 4HWRA 1TJ5A 3OP4A 5ICFA 4GP9A 3JYHA 4S35A 2EINB 2FPKA 3OJXA 3VO9A 5B3KA 2WYUA 4PIVA 3MG9A 4I4TF 4FMTA 5KHJA 4Q1AA 1YI2V 3N7UA 5SICE 2W42A 3WJPA 1QHEA 3BH0A 5DHUA 1IVNA 1NWCA 2Y2VA 3GZNB 4PLZA 4KH0A 1Z83A 3G88A 4IEIA 1CR1A 3HXPA 2GSWA 4QXMA 1L7DA 2W9XA 4A6XA 1I3CA 1NRXA 2BV3A 1SESA 5C1IA 2HJFC 2I3GA 2CHEA 4G4WA 5CYPA 3I73A 5K0EA 3OBIA 2YV3A 4Y18A 3BJRA 4X24A 4I7EA 3HACA 5GGYA 3TEFA 4MICA 4B80A 4Q93A 4EYQA 4LXHA 5AVQA 4UVGA 1KK0A 4JGIA 2WVJA 1W5AA 1VKJA 1RXCA 5ALUA 3A3OA 4O4LB 3K5MA 1FFTB 1N3IA 2YX1A 3LXRA 1Z4OA 4GVPA 4PFKA 1E92A 1G20E 2HSWA 3DDUA 4R1NA 4V03A 1TB4A 2FWIA 2J0VA 4F2HA 3B51X 1JJ2U 1T6BY 3RR2A 1O6BA 3LU1A 2GO7A 2ADFA 2WZDA 1GSAA 3LPCA 1I4EB 1GQRA 1T1GA 1FVXA 1VL2A 3DEAA 4WLFA 3FVQA 5HWSA 3RTBA 3A9UA 3ITKA 5I9NA 1KRXA 3LDFA 3GGOA 4RESA 4PE5B 4YP0A 5BWLA 4GR4A 4GLXA 1O1YA 2EAUA 1CEXA 5BW5A 4IWNA 4IHKA 1D4AA 4AI8A 2H4ZA 4PQRA 3FLMA 4UAVA 1CRWG 1SM4A 2IWRA 2KMLA 4Q9HA 5DCVA 3E4CA 2FFRA 2XXBA 4GQIA 1RLTA 2FETA 4JA2A 3AQIA 4RJLA 3J7AC 4B3BA 1UOQA 2FPOA 4IJKA 4L9SA 3EDCA 3FOWA 2IODA 1KJNA 5TGDA 1E2EA 10MHA 2HMYB 2JGMA 4QARA 1YZKA 5FFFA 5D5PA 1F0KA 1F6BA 4R9NA 4B7UA 1MHTA 4Y9RA 2NO4A 4IF6A 4F56A 4CEHB 4DHWA 2ACVA 5A03A 3KXIA 3D8TA 4B47A 4GEKA 3V8QA 4YAUA 2FF7A 4R0MA 2EBHX 3A0UA 1AR5A 3EPRA 3DAPA 1UJMA 4JA0A 5CW2A 5DN6G 5IS2A 1ESNA 1JQJC 1S3IA 1U2GA 2I2AA 1TYAE 3E7PA 2P6PA 4DCCA 1U80A 2YN4A 2LBTA 2Q4DA 3A6FA 2P5OA 1ZM2A 2J85A 1OX5A 1KYVA 3ICEA 4CTOA 2BMJA 1SIBE 4L4XA 1P9NA 2RG7A 1TMKA 1YZTA 3TUIC 2NZUG 1B06A 3LBHA 3N2EA 3QYAA 3JSAA 3L82B 1EESA 1WULS 1JG3A 5CT9A 2CNWD 3M4NA 5DHAA 5LXTB 4BO9A 3EY4A 1WXXA 4NAUA 2G3YA 2HWYA 2OC4A 4JJ8A 4WD3A 4Y7DA 3SLGA 4E4EA 3S03A 4UASA 4BGUA 1CUFA 4YPFA 2BKLA 1Z2GA 5A3QA 1LGYA 5FA8A 3ZUGA 2AW5A 2ZVZA 4L5IA 4F38A 4JP1A 5FPOA 1DKQA 4UBNA 3ZYZA 4CTJA 4A1OA 4EHHA 1MVLA 3KK0A 3FAVA 1K8YB 5DJ5A 4EA9A 4NFLA 1M0TA 2QWPB 1P18A 5C8ZA 1FFWA 2XNHA 4CIBA 2PAAA 2ZE7A 3AF1A 4EA7A 2LR0A 3SICE 2UUCO 3UNXA 3EZLA 2QRQA 3DTYA 3EXHB 2K4MA 3VR4H 2G38A 3ZHSA 2Y93A 4PRLA 1VSVA 1OYWA 2R47A 3JVIA 4O5AA 2ZRLA 5H02A 1P1FA 5KVQA 1R8QA 2JEZA 3LGXA 3NCTA 3TSCA 5EWRA 1MJGM 2C31A 5I7OA 4XDJA 4ZVLA 1H2MA 4CH5A 4O4LA 3CCEV 1DARA 2IM9A 4X3MA 2FVYA 2WZBA 3A28A 3DV9A 3NBYC 4NOLA 4BXOA 2GF0A 4GI2A 4MQ6A 4MUMA 3W1EA 3CVJA 4S0ZA 4UPVA 4DYLA 4N6GA 3H9VA 3ZMZA 2Z57A 4Y9UA 1I5OA 5ITZA 1PR1A 4ZHVA 1BMTA 3K3WA 2N42A 2V6MA 2YYYA 4KE9A 4ND6A 1N8KA 3C9RA 2O7RA 5ANRB 2LP4Y 4FNAA 1NQ3A 2GPNA 1IMJA 2WUVA 2QSYA 2F00A 3AUJB 3D8NA 4WOPA 5MF6A 1AZWA 5DBHX 1IPFA 1HPLA 4UDOA 4HLDA 4ZMSA 5TY0A 3QUQA 1PJ3A 3DYIA 2ZAMA 4HQ0A 2QY9A 1FUEA 2FUNB 2JIZG 1DX4A 2RHGB 2HS0A 3GW8A 4FR2A 3FD5A 4IR7A 4P7KA 1E9FA 3DMTC 4ZAWA 3ZWYA 5J9PC 2EL7A 1Q8RA 5DMXA 1H2BA 2YWGA 1XP8A 1QUEA 3NWPA 4TLAA 3PKZA 1D4FA 3VSEA 4HTFA 4JLWA 5A2GA 4M6WB 3PEYA 3OTWA 1YDGA 3G2HA 2FTKA 3T7AA 3LVQE 5EIFA 2I8AA 3BFPA 5F1KA 1FFCA 2MCFA 1RQ7A 3CV3A 2VTDA 3C4VA 3WIBA 1G291 4BFTA 4CXMA 3LWPC 4AQYO 2VC2B 4B4KA 1BHBA 3WNVA 4EO9A 3FCCA 1QFMA 4YHHO 1JEYB 3K8OE 2P2YA 1TYDE 2RD2A 1S2OA 3NVDA 3D3NA 3LW8A 1L5WA 1CUUA 5FJ4C 1NQUA 2H2AA 1I1NA 1VJRA 4ZDIA 3V8VA 1G4AE 1L4GA 2PT5A 4YIOA 1WW3A 2D7CA 4KDFA 4LDJA 1K75A 5JRJA 3UJDA 4YRFA 1W4ZA 3U1TA 4CV2A 4OY3A 3DOJA 5TT1A 1M4UA 1FUIA 1PZFA 1JKMA 3AU8A 3C6YA 3N2ZB 1YZ3A 4HN2A 3NUGA 3RS9A 4Y2HA 1ECGA 4JI8O 5HXUA 1C1XA 3HFGA 4MI9A 4PANA 3WLRA 4LHWA 1PUIA 1X7DA 3DEZA 1KVQA 1XVAA 3MS4A 1CIPA 3VKWA 4NDZA 4YT4A 5LP1A 4X89A 5FI3A 2ZZKA 5DEDA 1RMTA 3AEXA 3WDKA 4PSDA 4L02A 4QRIA 4D1YA 3BSWA 3DE3X 2HUPA 1FUKA 2EJRA 2GO1A 2EWMA 1L4UA 1O0BA 3E8FA 1NMZA 4DDUA 4M49A 1T9GS 3OF5A 1KNQA 4H7FA 1C4OA 3O1LA 4O0MA 1LC0A 1YR2A 2WTEA 3CCEF 4HH0A 4DR4O 2G8NA 5AP9A 3RRXA 5BRAA 3DCJA 2HAEA 1A04A 2DTDA 1B74A 3OU6A 2F48A 4C76A 4RE6A 1O5OA 5KKAA 3A7DA 1R4MA 5AVTA 3TECE 2I80A 1F23A 4OQEA 3AETB 4OJKA 4TLCA 3HUFA 1XAJA 4V0SA 5EP4A 4BZWA 4K3VA 4MUFA 4ZQEA 1BE3H 1FAFA 1IY1A 4YS6A 1QHTA 1NJIH 3N4YA 1Z6XA 1IJKA 3CF2A 3TZCA 3F90A 1JJFA 3PD1A 4MUEA 3A1UA 2G1AA 1R0LA 2CMFA 4JLSA 2GM9A 4EYEA 2HNKA 2WJAA 3QLVA 3WBJA 4LJKA 4REQA 2NXNA 3CC4V 3IE2A 3FBWA 3HK2A 2F62A 4GZ6A 2QX6A 4G88A 3CE6A 3OLZA 3TIVA 3G1WA 3H4IA 2F1MA 3ONFA 1EK1A 1ICIA 1K8AW 3E83A 4FFBA 1JDBB 2CLCX 3QVGB 4W1PA 4YC7A 5FWAA 3WLLA 4I9FA 4YO7A 1WDTA 4NAHA 1MD9A 4ASUA 1F4LA 1HTWA 1SHUX 3MJVA 1DLJA 4YUYA 1K8AH 1UADA 2JLQA 1EFLA 3O8BA 1MHPA 1ZJ6A 2Q41A 5DN9A 3ZC3A 2GZAA 1QF9A 1P2VA 3DAFA 3VHXA 2OLJA 5GM1A 3N28A 3H2SA 1WS6A 2ZAYA 2BUCA 4C7UA 1XE3A 3B7GA 4R9SA 4N0MA 1U3GA 5DSZA 3FXAA 1YJNF 1HRDA 1A8UA 2VDLB 3OU2A 2YHIA 1NI4A 3G79A 3L46A 2BH2A 1SC1A 4F84A 3GXOA 4YUVA 4B6JA 3QE3A 2UYCA 3LLVA 2EWCA 3RK0A 2XUPA 2FW1A 2L0XA 4M0CA 4UFOA 1NV9A 2JKVA 2ZJ6A 3D0RA 3DE6X 4JWTA 4NF2A 3KLPX 2FEKA 2PZKA 1PVVA 1GO0A 3NBZC 1YQTA 4J1TC 4M9SA 4RX1A 5JEEA 3LY5A 3L70H 5T67A 2OG2A 3CRZA 3V4DA 2WJZB 1E2BA 2JLCA 2ZYGA 1DQPA 3G8AA 3OC6A 4NYJR 1U7UA 3P0FA 2O57A 3SYLA 5CFQA 1Y82A 5L51A 1K7FB 5ALKA 4LJSA 1USVA 4JNKA 2VOEA 3B6IA 4ZGGA 3MD9A 2ZB2A 3EXIA 4MS1B 3QPBA 3RHFA 1WXFA 4M0PA 3QOFA 5ESWA 2QBYA 4C4PA 5A0TA 1ZH8A 1Z2CA 5EY5B 4ERNA 3L5OA 5FUWA 5SV2A 3B3GA 4M1OA 2O2SA 3ETLA 4ZEVA 4RENA 5EZSA 5IY5B 4U2BA 4ZTUB 121PA 1PJAA 3WL4A 2JLRA 1CEQA 4ESOA 4UBJA 1P0FA 4PZEA 3WKBA 5L3SA 1XD9A 1EJ2A 5JHHB 2CMDA 3EXFA 2JI9A 3KKPA 2OC9A 3C5EA 3D4LA 3OE1A 5E9QA 4AYWA 1VHQA 3H86A 3I01M 4Q9KA 5DWDA 2XT6A 3NH9A 4MR8B 4DIOA 3FNHA 4HEJA 1K4CC 2UUAB 2NXJA 1AK1A 3HUEA 3I83A 3OZSA 4UU0A 5EXTA 3TX2A 1BVHA 1FDTA 4EJSB 1P9RA 3E9RA 1LUWA 5A6SA 3OZ7A 4R9RA 5FPHA 4GGMX 2W70A 1UJ6A 2KSDA 1QWSA 2Y1XA 1U8XX 4KJXA 3U6BA 1I2AA 3TCUA 3OPNA 2LTAA 2QKCA 1OF1A 5CEJA 2QP4A 1GYPA 1BOOA 2YOHA 3LLMA 5BSWA 3GDHA 4IINA 4IO0A 5JPDA 1QGYA 4I0XA 2P2GA 1FNDA 3NH6A 2IU0A 2GCIA 5FQOA 4U02A 3F0GA 1IB0A 5EVJA 1NXPA 3WDMA 3N2KA 5IANA 5F1OA 1VKOA 5LPNA 4PYQA 3AG2B 4EPRA 1OXBB 1YZBA 3BT7A 1FTYA 4HNAB 4ARSA 4TTJA 1OROA 1F51A 1Y6QA 3CNNA 3QKWA 4UPEA 2FSVC 1SERA 3EVDA 4TRJA 1AE1A 1C81A 1Y4ZA 3ER8A 5B5SA 3QEJA 2CZCA 4DDTA 1NN3A 4IGKA 1G42A 4MRMB 4WINA 1BFKA 2CBZA 2EL9A 3FTNA 5EWLA 3JYPA 1LBTA 2WIJA 3I1IA 4BL5A 4D97A 1XNRB 3QFCA 3WK6A 3G71F 2XYPA 4I9HA 4O2BA 5B1AC 5CPBA 4GH5A 3VBBA 1XZPA 4E5DA 4O4LF 1OZAA 1B6TA 3WPXA 5LMUO 1KJIA 2BIFA 4G1CA 4JP8A 1TTPB 3ADOA 4KQWA 4WN9B 4CMEC 3PFFA 1K9MH 1XDZA 5KUKA 4FX2A 3LBFA 4HQLA 2WU1A 4JHXA 1BA3A 3SZRA 1M2OA 3O7WA 4OQXA 1IHUA 2GTPA 3K0TA 4QUAA 1T4GA 3NM6B 5C31A 3WNCA 3WWYA 1PWEA 4UVAA 5IAEA 4ZIRB 1GKYA 3IQEA 4MPRA 1WPBA 3VTIC 2QRJA 5KNBD 4MUKA 2OZBA 1TCCA 4CLOB 5A4IS 3HTNA 2V6IA 1D2EA 4CV3A 1J0XO 3QFFA 1R9GA 1Y5IA 3ECSA 5EJGA 1WD5A 4CS3A 1R88A 5ECYA 4F8JA 3W7WA 2EX1A 1KEUA 3AVTA 4D4HA 1XA4A 1SU7A 1LB1B 1LKZA 1NJ8A 3GVXA 3OH8A 4G9EA 1TYEB 2BM0A 3UJ3X 2OK8A 3BB4A 1XNHA 4FX5A 3ZMSA 3VV3A 2C5GA 3N27A 3EIXA 1AKTA 3U7QA 1SCKA 2EGUA 2ZPUA 4JOSA 5JSQA 2QI9F 2J0UB 3NB0A 4ENTA 1H85A 4UB6Z 1E9AA 3U1VA 1DGSA 2H07A 3NHBA 3GH1A 4CL3A 1EZZA 1H66A 3OE7D 2I62A 4GPD1 4W5QA 2AH5A 2TRSB 2WHPA 1N2JA 3OFVA 1U7DA 4WAUA 3RUEA 5BQOA 1NVVQ 1XKXA 2XMRA 3S0HA 2PGJA 3O0DA 4P80A 3VH1A 5FJJA 3UOAB 4BGVA 2O8DB 5DP1A 4BQEA 5C32A 2XGSA 3MWKA 4NATA 3VO2A 1YTLA 2Z8XA 2X8JB 3IUQA 1VQLF 1E66A 4UCFA 3RVMA 4EHAA 3FAZA 4NZOA 3ZH2A 1G5TA 2VYFA 3IT0A 1PHRA 4XZ3A 3F4BA 1VQLV 5EUMA 4EYGA 4MMZB 1E2LA 1F8GA 3WZ2A 3FNIA 4RF4A 4N5HX 4UBOA 1Z63A 4JASA 3H1IH 3ASUA 3WIVA 3CZ4A 2QTVA 1OFVA 2L82A 4KR0A 5EJEA 1ABFA 3DR3A 5LHGA 5E2AA 3T80A 3ZVRA 4WZAE 1UKVY 1G59A 3B6MA 3NTRA 4AJIA 2LIPA 4N0QA 5KJCA 1RAGA 3QUAA 4KQ6A 1WUIS 4KYIB 4MI1A 1CRZA 1RLMA 1Y48E 2CXXA 1KQNA 3Q3IA 4J6EA 1TW2A 1HDYA 3MTEA 4V2UA 1ZQ1A 3NBQA 1ZM3A 8OHMA 4AN4A 4BJ6A 1H3FA 2X42A 3L7KA 4I2NA 4CDRA 2W2OA 3HFJA 2C8JA 3H2GA 2CJXA 2XYGA 1AGXA 4RANA 1VQ5F 2AFHE 2PYLA 1YRHA 1I7FA 4LWZA 1XKQA 4TX1A 3I2GA 5KNCH 4QBHA 5EJ2A 2B94A 3O2QB 2V7QD 4R71A 1BWRA 1CK4A 2JBHA 4N8EA 4RIFA 1IH8A 1U3UA 2N9UA 3GD7A 2EHDA 3K0BA 1KSHA 3BIWA 3FPEA 2PGOA 3AXSA 1WO8A 2O0JA 4LYDA 5G3YA 2XKBA 4DLRA 5AJVB 1TVKA 5FL7D 1V7CA 2F59A 3OIYA 1YL7A 4NV0A 3RNLA 2OD9A 2VLBA 4F3CA 4DLAA 4E7OA 4EG3A 1BMFD 3KQWA 3O4IA 1VPLA 3IIJA 3MTJA 4KQKA 3T1OA 1ZKMA 3NVAA 4EG8A 2XT9A 2R25B 3VNRA 1NVWQ 3VHXB 3U37A 3F73A 1QQAA 4ZYUA 1QTRA 4FFVA 1AKQA 1BXGA 1UDAA 1OAAA 1XDGA 3EOBI 4I66A 1HFJA 4XIIA 3FR8A 3DFFA 4XJVA 1VQPV 5DVZA 1VL5A 3C4QA 5E4FA 3J81k 2J1LA 1Q74A 3KYBA 4NSNA 4AJNA 2PNFA 1HURA 4S1PA 3UCEA 2QG9A 3C43A 4FZVA 4EHDA 3ADBA 3SSMA 4N48A 1NVVR 3JZFA 3WS7A 1PHPA 3GRAA 5EGSA 2Y4UA 1Y8RA 1ZW1A 3S1AB 2YIJA 4C06A 5HP4A 4QQKA 3A4NA 3PGLA 4ISCA 4Y0AA 4ER6A 5H9CA 3L8ZA 4QO8A 1NKTA 2G9QA 1H22A 4M0DA 3UJ8A 4D9IA 3H4TA 1RBMA 1ZHHA 1WPXA 2B8JA 2I7TA 2NT4A 2WD9A 3MLAA 4NENB 4WFIA 2YXPX 4EUEA 2X15A 3M1LA 4EGSA 2ZT8A 1E6EA 1YTFD 3KSUA 2PZGA 2QAJA 5CNKA 5SYNA 5JBNA 3IEKA 4ZJPA 3AVUA 1IBMB 4MUHA 2QZ4A 3II6X 1NTKH 4UQLA 1CEYA 2AXQA 4LGYA 5FV7A 4A3SA 1V54C 3DHEA 1E1QA 4XYEA 4TT8A 4WA7A 3BMNA 3PNMA 5NLLA 1WV1A 2LJ2A 1Y4AE 3IAFA 4Y1GA 4BRSA 3SJZA 4QAQA 1FSPA 2ZREA 4EDHA 1MC4A 2WR8A 3TRIA 1BGXT 2QIPA 2UU9O 2I6XA 3VVBA 2RGBA 1FTNA 2Q5OA 3THXA 3UATA 5K8LA 3PYMA 3FBTA 1OH7A 3HO1A 4D4KA 2IP1A 3MHTA 1LDNA 3TNDA 5AW3A 1RSOA 1DTEA 1MQ8B 3GGGA 1GM8A 3QFSA 3PG5A 2OSVA 5E0OA 3TUJC 2ZE6A 5B2FA 2P27A 3FOZA 4L8JA 2FPXA 4IGIA 4S2EA 3OIGA 4DUGA 1X0VA 2VXBA 3K9LA 4A0RA 1JFTA 3DVRX 4PNZA 2F8MA 2PVCA 3IHKA 2V7GA 3D01A 4DTIA 1ZXBA 1QVRA 1B23P 1JG6A 3UQYS 3SF8A 4TXLA 2VH5R 2IJJA 1Z7EA 2QMZA 3ITNA 5BV0A 3U0ZA 1IQUA 1QIIA 4YIKA 2CEKA 4KCGA 4MR7A 4OGWA 3MJRA 5L3EA 4S3MA 1RHQA 3R6WA 3K94A 4LYJA 1RYBA 5D1HA 3NNSA 4AKIA 2EIXA 1RTTA 2ZCVA 5KX5B 1XDWA 4HXYA 4XUGB 4DTCA 5CLJA 3M6LA 2EIJC 2AYYA 2PKEA 1G21A 2Y2UA 3L1JA 1XVUA 2XOKD 4LWOA 1AA6A 4PXAA 1E7WA 4W6ZA 2F9MA 3OW2F 3T99A 3EFEA 3H5TA 5GVSA 4GECA 4JOBA 5FLXA 3AEQA 2EDAA 1ZGGA 2Z56A 3L0CA 3R3UA 2BFEA 3TG2A 3L0SA 4C78A 3WWOA 3HP7A 1ECCA 3I53A 1IZ7A 5FAXA 3B3QA 1RZRD 1JPVA 1K6XA 4ZGBA 3W7UA 1TJYA 4QTZA 1L5FA 1E2DA 1D6MA 2ODNA 1BQEA 2IQIA 3QLUC 5DW0A 4BN5A 4EY8A 1V1MB 1RQNA 4GUNA 1FMTA 2CVZA 3IAHA 1DAOA 3L7BA 4KRYA 2QNBA 3TOZA 5K20A 1YO6A 1PP4A 4RABA 1JKJB 1YT5A 2OP0A 3WISA 4ABTA 4YUWA 4LDNA 2PIDA 3ON5A 1C2YA 1CLEA 2VSXA 3WKDA 4AB1A 5JJJB 3IMCA 3M70A 3PENA 1A5BB 4MSUA 4A0FA 1N5IA 3USZA 4QEKA 5TX7A 1S5HC 4JI3B 3ELCA 3TJTA 2VP5A 4DNPA 621PA 5IEJA 1WZ2A 4AURA 1CB7A 1YVDA 4X84A 5E6UB 1N4DA 3TSAA 2FUKA 4F72A 1F0NA 3CXRA 3QLUA 1J5XA 4PX5A 5JD4A 1R0BA 2WOJA 4MT8A 4B7KA 4N47A 1QVFF 1CS0A 1L5ZA 2WD7B 5TVKA 5DSTA 3SP1A 3SM3A 3ZWCA 4OI2A 1SPXA 3W2FA 3J7AU 3ADKA 3HYCA 4WI1A 4AX8A 1YA6A 3D4BA 3FPAA 3D7MA 2V1XA 1H8ED 4OGLA 2CY0A 3ID6C 3L75H 5LQKA 3NYRA 5FOXA 1KSFX 2OHXA 2Q46A 3WLIA 1JIQA 2IZZA 2C7RA 3H1EA 2PUFA 4FLYA 3W3AD 4KAXA 3FMOB 1XU9A 1R3DA 1HFEL 2G9NA 2LPMA 3NWEA 3IMGA 3SS8A 1YJXA 1EJ6A 3VR3D 3MJCA 4O4IA 2GEJA 3GUCA 1TECE 1TQ2A 1AV7A 1MT0A 2CDRA 4BNVA 2W2MA 4EG5A 4M7WA 1K2WA 1E1MA 2FYTA 2GA9A 1QAQA 5FB3A 2LFSA 1L5MA 2YH2A 2ZRHA 5GP1A 5B2ZA 4J76A 1KC1A 1JU3A 1JTFA 3SXUA 3T1VA 1BXGB 3ZY2A 3V9PA 4AJPA 3O85A 3MTGA 2C0QA 2VHTA 2DPGA 2W43A 3TZQA 1UIMA 4J94A 1I36A 2DPYA 3MINB 4E5YA 3HCRA 3O47A 4GKJO 3VJLA 1JMYA 1HL7A 1EVQA 3CR3C 2RGGA 3BJZA 4C14A 1CR6A 3J80N 5BSFA 4F3RA 2GF2A 1VQVA 4HGOA 2RKBA 3EEFA 3D8RA 1DBSA 4AC9A 4WFKA 3DMHA 2QJTA 3KXPA 1XJ0A 1DXOA 2VRBA 2RH8A 1SCIA 5EUCA 1RABA 4EX7A 1JA9A 1QIGA 5ITZB 1R00A 3EF0A 1AKVA 3PNSA 3AG7A 4ZA2A 2XPCA 4O2BF 4BX0A 4TVBA 3FGOA 2BEUA 2Q5LA 2G9IA 2V5UA 2PZSA 1J7KA 4EJ6A 1H8EG 1KOFA 2SKCA 2WJIA 4X64O 8AT1A 2P7IA 1QO0D 1CRPA 4MQBA 3AESB 3KBOA 4I3FA 1DS6A 2WMDA 5KDLA 3BSSA 4JQYA 2WWVD 1NYRA 4PLFA 2R85A 4OP2A 3KETA 4G5YA 3N2GB 1RXEA 1L1RA 3GQVA 3OZRA 3PQ7A 4BTVA 2J87A 2Y77A 4ASUG 5CPFA 1L5HA 3WYFA 4YV1A 3PNOA 1PW5A 1S4QA 4AMZA 4LC9A 1B8UA 4RA9A 1RNLA 3BF7A 2YYSA 3UOWA 4Q7MB 1ZTEA 5IDYA 2IV3A 4WDRA 4B8YA 2QP9X 1YCDA 3AXTA 3KOWA 4GHWA 1Y6ZA 2FB9A 2IPLA 4J0CA 4N54A 4HRYA 3D3QA 3CLRD 1PNQA 4CODB 3ZVMA 2P62A 5E6RA 2IEZA 3HJFA 1U0SY 1IOZA 4KH1A 2LQTA 5JNSA 1NSTA 1I94O 4BDSA 4WOBA 2FZEA 2J5RA 4BRWA 3AW8A 3DAOA 4L6AA 2GZDA 2QM3A 1PX0A 3F47A 4HLNA 3HR8A 4MNTA 2WLJA 5HRCA 2V7EA 2GHYA 2PXCA 2W6JG 5EMKA 1LV7A 5HOEA 5AXBA 2ZOVA 3IEPA 3OFJA 1EFKA 1VYHA 4MYCA 1KDTA 4LOHA 4TPKA 4XR9A 4Y6SA 5ILQA 4MP3A 1M6HA 1B16A 4KG7A 4V0LA 4ARBA 2CL7X 2DFTA 2P7HA 2VWKA 1BS1A 1EGAA 3GUHA 3OSUA 1UPXA 1ZK3A 4IL5A 4RIEA 3WJ2A 4BWYA 4EHFA 5LDDC 1Z0SA 1ULZA 4KXLA 3P20A 4JTDB 2HHJA 3OZCA 2AMLA 2BGKA 1GO3F 3KJHA 4DMUB 3T1CA 2D74A 1ZCAA 4IFTA 1HTTA 4GBGA 4UCTA 2E1RA 1M75A 3GHYA 3IOBA 2E2WA 5D85A 4DEVA 3CH4B 2XAGA 2DT8A 3LK6A 3HA2A 3P9KA 5TMEA 2IYWA 4LHSA 3KL2A