1YIJF

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yijF00
1JJ2F 3RA5A 3CCLF 4X3LA 1QVFF 3NVIB 1W3EX 3I55F 1Q82H 3MCAB 3LWRC 1RA4A 5EO3A 3CCJF 1IPAA 3GYQA 3CMEF 1Q81H 3I56F 2OTLF 1VQKF 3HJWC 2OHWA 1W40A 3V7QA 2KG4A 3CXCF 1VQ8F 1YJNF 3RA6A 3LWQC 2LBWA 3AGKA 1GO0A 3HAXD 3NK7A 3CCVF 5GIOC 3G6EF 3JAMM 3G4SF 3E1YA 1W41A 1KQSF 1VQ6F 1Q7YH 1YIJF 1S72F 3CC4F 5GIPC 1K73H 3PAFA 5GANK 1CK2A 3E20B 1YI2F 1YITF 3SIUA 1VQ5F 1VQOF 1M90H 1DT9A 1X7PA 5FLXM 3OBWA 5A2QM 2OZBA 1K8AH 5DCVA 1W2BF 3CCSF 3IR9A 2WALA 2QA4F 3CCQF 1VQ9F 3CG6A 2VGMA 1VQNF 3CCUF 3CPWF 3NVKE 1YHQF 4LCKA 3CMAF 3WXMB 1XBIA 4NUTA 3LWOC 1YJ9F 3CC7F 1NJIH 1QVGF 1PXWA 1T0KB 3JCMM 1RLGA 2I6DA 3VI6A 3PLAC 3CCRF 4TZZA 5GINC 3OBYA 1H7MA 1Q86H 1VQ7F 1SDSA 2OTJF 1K9MH 2BO1A 2VGNA 1YJWF 1M1KH 3N4ZA 1VQPF 1ZWZA 1GO1A 3FFMA 3VMFB 1KC8H 2FC3A 3LWPC 3CCEF 2HVYD 2KTVA 2KTUA 2AIFA 3J81M 2LBXA 1KD1H 1X52A 5IT9M 5G4UC 4C4WC 1X7OA 3LWVC 3CC2F 1VQ4F 3NK6A 3J80M 4X3MA 1E7KA 3LFOA 3N4YA 1NMUB 2QEXF 3J7AR 3SIVA 1CN7A 5GAPK 1VQMF 3CD6F 2CZWA 2JNBA 3ON1A 4BY9D 1VQLF 5EWRA 3G71F 3V7EA 5FJ4C 3NMUC 3CPQA 5G4VC 2QI2A 1W42A 1N8RH 3CCMF 1GZ0A 2ALEA 4BW0B 3O85A 3OW2F
chains in the Genus database with same CATH superfamily
2YXZA 3IMPA 3CCLF 4KWEA 4X3LA 5LOVA 3OONA 3NVIB 3VTIC 2AIZP 4ZI7B 3K0TA 3QHDA 2ZF8A 5BMVA 3E22B 3LWRC 4R40B 3M84A 4O2AA 2GVIA 4O4IB 1Q81H 3VYUC 3WJQA 3LYBA 5JCOC 2OTLF 2OHWA 2YYEA 3HKDB 1FFXA 5J2UA 2HS0A 1QAHA 3P0ZA 3RA6A 3CYPB 2HRYA 5IYZB 3N2GB 5HP8A 1SA0B 3HKBA 2HQSC 5GIOC 3G4SF 1YGYA 3VYTC 1VQ6F 5LP6A 1TVKA 4X1YB 3K2XA 1S72F 2UYNB 3CC4F 5GIPC 4U3JA 3PAFA 4TV8B 1CK2A 3B6NA 1VQ5F 1DT9A 5EIBC 1Z5WA 4BT6A 2CHSA 4NWOB 2FGYA 5EIBD 5DCVA 1U40A 5CB4B 4O4JA 1VQ9F 5JVDB 1J7HA 2VGMA 3JALA 4B46A 3NVKE 1YHQF 5EZYA 3CMAF 1YJ9F 5BMVB 3P10A 3RYHA 4I55A 2GLZA 5EYPA 2RHLA 3JCMM 1RLGA 1T0KB 3HKEA 2UZHA 4FFBA 5GINC 1H7MA 1Q86H 1VQ7F 3WGNA 5EB1B 2IG8A 3WJRA 1OFUA 3N4ZA 4HNAA 3FBAA 3LDTA 5FNVB 3S06A 3VMFB 1FNJA 3HKBB 3VIUA 3GHZA 3K14A 3I7TA 2HP0A 1TVKB 2KTVA 4B45A 2AIFA 2OTMA 2ZODA 5IT9M 2CHTA 3U0OA 4C4WC 1X7OA 1W55A 2H8EA 2UYPA 3Q8HA 4ZHQA 5KX5A 2LCAA 3RYFA 4X1KA 2QEXF 1Z5VA 2Z1TA 5J2TA 1CN7A 1VQMF 5EZYB 4I4TB 5HWEA 2JNBA 3ON1A 3RYIA 4BY9D 4YJ3B 3LMEA 2Z1UA 3S02A 2VAPA 1VQLF 5EWRA 2MQEA 4I55B 3C9SA 3HKCB 2VAMA 5G4VC 1W42A 3HKEB 1QU9A 3CCUF 4BW0B 2AMTA 3BYQA 3I3FA 3EORA 1W5EA 4BT7A 2VXYA 2K1SA 3I55F 4ZOLB 4TV9B 3UT5B 1Q82H 1JD1A 1ODEA 3CCJF 3MCQA 5EB0A 3WGKA 3C9RA 5IJ9B 3IKFA 4B62A 2VAWA 1H47A 1VQKF 3HJWC 5GONA 3S0HA 3VYSC 3CXCF 4C81A 2HP3A 1YJNF 4IHJA 1VH8A 5LYJB 2EWCA 3AGKA 4O4HA 4BT4A 3RE3A 3HAXD 2RHHA 3NK7A 3RYCA 3JATB 5HY1A 3G6EF 3DC2A 1W41A 4DRXA 5JH7A 1NQ3A 3FPIA 1ONIA 4BVTA 5J2TB 1YIJF 2F9ZC 3JAKA 5JQGA 1YITF 3SIUA 3RYIB 4X1IA 3S0YA 5HXZA 5FLXM 3T80A 4F6RA 5A2QM 2OZBA 1KNKA 3D00A 3JAWB 5LA6B 3TD3A 2KGWA 1W2BF 1CLIA 2CVLA 4G4WA 2RHOA 2QTPA 1OAPA 1VQVA 4O2BA 2B33A 2R6R1 2I6DA 1W581 3HWUA 5CA1A 2Z1EA 4TZZA 2OTJF 3OBYA 3TD5A 1IV3A 1VK3A 4X20A 3ERNA 2VGNA 1YJWF 1M1KH 1UI9A 2HRUA 1VQPF 2PMPA 5CA0A 1ZWZA 3N2KA 1XRGA 2CSLA 2FC3A 3RYCB 3CB2A 4G4XA 5ITZA 5JH7B 3CCEF 5LOVB 4C8IA 3ESJA 3IKEA 1IV2A 2BTUA 5LXTA 1U3PA 3VOBA 3MDOA 4O2AB 1XV2A 4WBNA 3QUWA 5C8YA 3N4YA 3IEWA 1FSZA 2BTOA 3SIVA 2V9YA 1FFXB 5J2UB 2CZWA 2R751 4M8IA 4C82A 3M4SA 3S03A 3F0EA 3NMUC 3C9TA 3CPQA 1W57A 5LP6B 3GTZA 1N8RH 3CCMF 1GZ0A 4U3JB 5IJ0A 3JVHA 2P6YA 1W3EX 3FD5A 4I50A 3JARA 3TD4A 1DBFA 1RA4A 4O4JB 4ZHVA 5ITZB 3I56F 2G9IA 3JALB 2HS4A 1JFFA 5LP6C 1W40A 3JASA 5AVMA 4DXDA 3RYHB 3WPXA 3ZP7A 2DYYA 5EYPB 3VOAA 4G88A 1JN1A 4U39A 1GO0A 4FFBB 5C8YB 1W5AA 4G4ZA 5JCOA 3JAMM 2H8CA 3E1YA 3S0WA 4HNAB 1K73H 5MN5A 4EI8A 3WGJA 4C8EA 2HS3A 2HP0B 1K8AH 2IAFA 3IEQA 2WALA 2QA4F 4O4IA 4YJ2A 5HXUA 4LNUA 1U3LA 2CWJA 3CG6A 4EB6A 3CPWF 3CYQA 4LCKA 1XBIA 4NUTA 3LWOC 4I50B 3HKDA 1NJIH 1KNJA 4ZHQB 5KX5B 1QVGF 1PXWA 3VCZA 1XHOA 3RYFB 3R0PA 4X1KB 3V3TA 3C8LA 3KHNA 5IYZA 3PLAC 3N2GA 4XCQA 2GZLA 1SDSA 1K9MH 4X1YA 3QTYA 3ZOPA 2PHNA 2UYNA 5B8FA 4TV8A 1YQNA 1COMA 1UFYA 3C9UA 1GO1A 3D01A 1KC8H 3LWPC 1SZQA 4BVRA 2HVYD 4EI7A 3K12A 3J81M 4G4YA 2H6LA 3F0FA 5JVDA 3KJKA 5G4UC 3MQWA 3CC2F 5KMGA 1VQ4F 3NK6A 3J80M 3P4EA 4X3MA 2Z1FA 1E7KA 4YJ2B 5GONB 5MN4A 3J7AR 4LNUB 2NMUA 3KIZA 4EB6B 3L7QA 5GAPK 1QD9A 2RB9A 2DT4A 4IHJB 3KJJA 5HY4A 4O4HB 3VO8A 1W5BA 5FNVA 1PF5A 3G71F 4DRXB 4BT2A 2QI2A 4BVSA 2CW4A 3WGLA 2ALEA 3OW2F 1JJ2F 3JAKB 3RA5A 5JQGB 5HY0A 4ERHA 3MBMA 4X1IB 1QVFF 3F6MA 3KE1A 4ZHYB 4F6RB 2UYKA 3MCAB 2ZOVA 3DDNA 4TUYA 5EO3A 1IPAA 3GYQA 3CMEF 4EI9A 2Q1YA 1X25A 4C8GA 4BVQA 3V7QA 3WPWA 2KG4A 3V4DA 3WGMA 3WJPA 1IV1A 3FD6A 1VQ8F 4I4TA 4O2BB 3LWQC 4G4VA 2LBWA 5KMGB 4YJ3A 3ZP4A 5CA1B 4E6EA 1RLUA 3CCVF 3HKCA 1KQSF 4X20B 1JY8A 1Q7YH 1W59A 3F0DA 2UYJA 4O4LA 5GANK 2HX0A 3E20B 1YI2F 4BT5A 2W8BC 5CA0B 5CB4A 1VQOF 3N2KB 1FNKA 1M90H 1GX1A 1X7PA 3OBWA 4ZOLA 4TV9A 1R1MA 3UT5A 3CCSF 3IR9A 5IJ9A 3CCQF 2N48A 5EAZA 5LXTB 2ZAUA 2BTQB 1VQNF 3WXMB 4IIJA 1TUBA 3CC7F 4WBNB 5HP7A 4TUYB 2IQQA 1W5FA 3ELCA 5LYJA 2Z01A 3VI6A 2LBTA 1VHAA 4BT3A 4RHAA 3CCRF 2I6RA 3JATA 2Q1XA 2BO1A 3M1XA 4ZI7A 4ZK7A 3F0GA 3E22A 1RQ7A 4ZHWA 3FFMA 5HY2A 5IJ0B 3JAWA 5LA6A 1IV4A 2L26A 2KTUA 5MN6A 4O4LB 2LBXA 2ZVYA 3JARB 1X52A 1KD1H 2RHJA 4NQ3A 4PWTA 3LWVC 1H48A 1SA0A 2ZVZA 1U43A 1JFFB 3HTNA 3LFOA 1NMUB 3JASB 4RQOA 1RQ2A 3CD6F 4B5CA 4IIJB 3ZO8A 1TUBB 3D54A 5FJ4C 1Q8RA 1T0AA 3V7EA 3O85A
chains in the Genus database with same CATH topology
1JJ2F 3RA5A 5HY0A 3CCLF 4X3LA 1QVFF 3NVIB 1W3EX 3I55F 1Q82H 3MCAB 3LWRC 1RA4A 5EO3A 3CCJF 1IPAA 3GYQA 3CMEF 4EI9A 1Q81H 3I56F 4BVQA 2OTLF 1VQKF 3HJWC 2OHWA 1W40A 3V7QA 2KG4A 3CXCF 1VQ8F 1YJNF 3RA6A 3LWQC 2LBWA 3AGKA 1GO0A 3HAXD 3NK7A 3CCVF 5HY1A 5GIOC 3G6EF 3JAMM 3G4SF 3E1YA 1W41A 1KQSF 1VQ6F 1Q7YH 4BVTA 1YIJF 1S72F 2F9ZC 3CC4F 5GIPC 1K73H 3PAFA 5GANK 1CK2A 3E20B 1YI2F 1YITF 3SIUA 1VQ5F 1VQOF 4EI8A 1M90H 1DT9A 1X7PA 5HXZA 5FLXM 3OBWA 5A2QM 2OZBA 3D00A 2FGYA 1K8AH 5DCVA 1W2BF 3CCSF 3IR9A 2WALA 2QA4F 3CCQF 5HXUA 1VQ9F 3CG6A 2VGMA 1VQNF 3CCUF 3CPWF 3NVKE 1YHQF 4LCKA 3CMAF 3WXMB 1XBIA 4NUTA 3LWOC 1YJ9F 3CC7F 1NJIH 1QVGF 1PXWA 2GLZA 1T0KB 3JCMM 1RLGA 2I6DA 3V3TA 3VI6A 3PLAC 3CCRF 4TZZA 4XCQA 5GINC 3OBYA 1H7MA 1Q86H 1VQ7F 1SDSA 2OTJF 1K9MH 2BO1A 2VGNA 1YJWF 1M1KH 3N4ZA 1VQPF 1ZWZA 1GO1A 3FFMA 3VMFB 5HY2A 1KC8H 2FC3A 3LWPC 4BVRA 3CCEF 2HVYD 4EI7A 2KTVA 2KTUA 2AIFA 3J81M 2LBXA 1KD1H 1X52A 5IT9M 4NQ3A 5G4UC 4C4WC 1X7OA 3LWVC 3CC2F 1VQ4F 3NK6A 3J80M 4X3MA 1E7KA 3LFOA 3N4YA 1NMUB 2QEXF 3J7AR 3SIVA 1CN7A 5GAPK 1VQMF 3CD6F 2CZWA 5HY4A 5HWEA 2JNBA 3ON1A 4BY9D 1VQLF 5EWRA 3G71F 3V7EA 5FJ4C 3NMUC 3CPQA 5G4VC 2QI2A 4BVSA 1W42A 1N8RH 3CCMF 1GZ0A 2ALEA 4BW0B 3O85A 3OW2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 F;  3RA5 A;  3CCL F;  4X3L A;  1QVF F;  3NVI B;  1W3E X;  3I55 F;  1Q82 H;  3MCA B;  3LWR C;  1RA4 A;  5EO3 A;  3CCJ F;  1IPA A;  3GYQ A;  3CME F;  1Q81 H;  3I56 F;  2OTL F;  1VQK F;  3HJW C;  2OHW A;  1W40 A;  3V7Q A;  2KG4 A;  3CXC F;  1VQ8 F;  1YJN F;  3RA6 A;  3LWQ C;  2LBW A;  3AGK A;  1GO0 A;  3HAX D;  3NK7 A;  3CCV F;  5GIO C;  3G6E F;  3JAM M;  3G4S F;  3E1Y A;  1W41 A;  1KQS F;  1VQ6 F;  1Q7Y H;  1YIJ F;  1S72 F;  3CC4 F;  5GIP C;  1K73 H;  3PAF A;  5GAN K;  1CK2 A;  3E20 B;  1YI2 F;  1YIT F;  3SIU A;  1VQ5 F;  1VQO F;  1M90 H;  1DT9 A;  1X7P A;  5FLX M;  3OBW A;  5A2Q M;  2OZB A;  1K8A H;  5DCV A;  1W2B F;  3CCS F;  3IR9 A;  2WAL A;  2QA4 F;  3CCQ F;  1VQ9 F;  3CG6 A;  2VGM A;  1VQN F;  3CCU F;  3CPW F;  3NVK E;  1YHQ F;  4LCK A;  3CMA F;  3WXM B;  1XBI A;  4NUT A;  3LWO C;  1YJ9 F;  3CC7 F;  1NJI H;  1QVG F;  1PXW A;  1T0K B;  3JCM M;  1RLG A;  2I6D A;  3VI6 A;  3PLA C;  3CCR F;  4TZZ A;  5GIN C;  3OBY A;  1H7M A;  1Q86 H;  1VQ7 F;  1SDS A;  2OTJ F;  1K9M H;  2BO1 A;  2VGN A;  1YJW F;  1M1K H;  3N4Z A;  1VQP F;  1ZWZ A;  1GO1 A;  3FFM A;  3VMF B;  1KC8 H;  2FC3 A;  3LWP C;  3CCE F;  2HVY D;  2KTV A;  2KTU A;  2AIF A;  3J81 M;  2LBX A;  1KD1 H;  1X52 A;  5IT9 M;  5G4U C;  4C4W C;  1X7O A;  3LWV C;  3CC2 F;  1VQ4 F;  3NK6 A;  3J80 M;  4X3M A;  1E7K A;  3LFO A;  3N4Y A;  1NMU B;  2QEX F;  3J7A R;  3SIV A;  1CN7 A;  5GAP K;  1VQM F;  3CD6 F;  2CZW A;  2JNB A;  3ON1 A;  4BY9 D;  1VQL F;  5EWR A;  3G71 F;  3V7E A;  5FJ4 C;  3NMU C;  3CPQ A;  5G4V C;  2QI2 A;  1W42 A;  1N8R H;  3CCM F;  1GZ0 A;  2ALE A;  4BW0 B;  3O85 A;  3OW2 F; 
#chains in the Genus database with same CATH topology
 2YXZ A;  3IMP A;  3CCL F;  4KWE A;  4X3L A;  5LOV A;  3OON A;  3NVI B;  3VTI C;  2AIZ P;  4ZI7 B;  3K0T A;  3QHD A;  2ZF8 A;  5BMV A;  3E22 B;  3LWR C;  4R40 B;  3M84 A;  4O2A A;  2GVI A;  4O4I B;  1Q81 H;  3VYU C;  3WJQ A;  3LYB A;  5JCO C;  2OTL F;  2OHW A;  2YYE A;  3HKD B;  1FFX A;  5J2U A;  2HS0 A;  1QAH A;  3P0Z A;  3RA6 A;  3CYP B;  2HRY A;  5IYZ B;  3N2G B;  5HP8 A;  1SA0 B;  3HKB A;  2HQS C;  5GIO C;  3G4S F;  1YGY A;  3VYT C;  1VQ6 F;  5LP6 A;  1TVK A;  4X1Y B;  3K2X A;  1S72 F;  2UYN B;  3CC4 F;  5GIP C;  4U3J A;  3PAF A;  4TV8 B;  1CK2 A;  3B6N A;  1VQ5 F;  1DT9 A;  5EIB C;  1Z5W A;  4BT6 A;  2CHS A;  4NWO B;  2FGY A;  5EIB D;  5DCV A;  1U40 A;  5CB4 B;  4O4J A;  1VQ9 F;  5JVD B;  1J7H A;  2VGM A;  3JAL A;  4B46 A;  3NVK E;  1YHQ F;  5EZY A;  3CMA F;  1YJ9 F;  5BMV B;  3P10 A;  3RYH A;  4I55 A;  2GLZ A;  5EYP A;  2RHL A;  3JCM M;  1RLG A;  1T0K B;  3HKE A;  2UZH A;  4FFB A;  5GIN C;  1H7M A;  1Q86 H;  1VQ7 F;  3WGN A;  5EB1 B;  2IG8 A;  3WJR A;  1OFU A;  3N4Z A;  4HNA A;  3FBA A;  3LDT A;  5FNV B;  3S06 A;  3VMF B;  1FNJ A;  3HKB B;  3VIU A;  3GHZ A;  3K14 A;  3I7T A;  2HP0 A;  1TVK B;  2KTV A;  4B45 A;  2AIF A;  2OTM A;  2ZOD A;  5IT9 M;  2CHT A;  3U0O A;  4C4W C;  1X7O A;  1W55 A;  2H8E A;  2UYP A;  3Q8H A;  4ZHQ A;  5KX5 A;  2LCA A;  3RYF A;  4X1K A;  2QEX F;  1Z5V A;  2Z1T A;  5J2T A;  1CN7 A;  1VQM F;  5EZY B;  4I4T B;  5HWE A;  2JNB A;  3ON1 A;  3RYI A;  4BY9 D;  4YJ3 B;  3LME A;  2Z1U A;  3S02 A;  2VAP A;  1VQL F;  5EWR A;  2MQE A;  4I55 B;  3C9S A;  3HKC B;  2VAM A;  5G4V C;  1W42 A;  3HKE B;  1QU9 A;  3CCU F;  4BW0 B;  2AMT A;  3BYQ A;  3I3F A;  3EOR A;  1W5E A;  4BT7 A;  2VXY A;  2K1S A;  3I55 F;  4ZOL B;  4TV9 B;  3UT5 B;  1Q82 H;  1JD1 A;  1ODE A;  3CCJ F;  3MCQ A;  5EB0 A;  3WGK A;  3C9R A;  5IJ9 B;  3IKF A;  4B62 A;  2VAW A;  1H47 A;  1VQK F;  3HJW C;  5GON A;  3S0H A;  3VYS C;  3CXC F;  4C81 A;  2HP3 A;  1YJN F;  4IHJ A;  1VH8 A;  5LYJ B;  2EWC A;  3AGK A;  4O4H A;  4BT4 A;  3RE3 A;  3HAX D;  2RHH A;  3NK7 A;  3RYC A;  3JAT B;  5HY1 A;  3G6E F;  3DC2 A;  1W41 A;  4DRX A;  5JH7 A;  1NQ3 A;  3FPI A;  1ONI A;  4BVT A;  5J2T B;  1YIJ F;  2F9Z C;  3JAK A;  5JQG A;  1YIT F;  3SIU A;  3RYI B;  4X1I A;  3S0Y A;  5HXZ A;  5FLX M;  3T80 A;  4F6R A;  5A2Q M;  2OZB A;  1KNK A;  3D00 A;  3JAW B;  5LA6 B;  3TD3 A;  2KGW A;  1W2B F;  1CLI A;  2CVL A;  4G4W A;  2RHO A;  2QTP A;  1OAP A;  1VQV A;  4O2B A;  2B33 A;  2R6R 1;  2I6D A;  1W58 1;  3HWU A;  5CA1 A;  2Z1E A;  4TZZ A;  2OTJ F;  3OBY A;  3TD5 A;  1IV3 A;  1VK3 A;  4X20 A;  3ERN A;  2VGN A;  1YJW F;  1M1K H;  1UI9 A;  2HRU A;  1VQP F;  2PMP A;  5CA0 A;  1ZWZ A;  3N2K A;  1XRG A;  2CSL A;  2FC3 A;  3RYC B;  3CB2 A;  4G4X A;  5ITZ A;  5JH7 B;  3CCE F;  5LOV B;  4C8I A;  3ESJ A;  3IKE A;  1IV2 A;  2BTU A;  5LXT A;  1U3P A;  3VOB A;  3MDO A;  4O2A B;  1XV2 A;  4WBN A;  3QUW A;  5C8Y A;  3N4Y A;  3IEW A;  1FSZ A;  2BTO A;  3SIV A;  2V9Y A;  1FFX B;  5J2U B;  2CZW A;  2R75 1;  4M8I A;  4C82 A;  3M4S A;  3S03 A;  3F0E A;  3NMU C;  3C9T A;  3CPQ A;  1W57 A;  5LP6 B;  3GTZ A;  1N8R H;  3CCM F;  1GZ0 A;  4U3J B;  5IJ0 A;  3JVH A;  2P6Y A;  1W3E X;  3FD5 A;  4I50 A;  3JAR A;  3TD4 A;  1DBF A;  1RA4 A;  4O4J B;  4ZHV A;  5ITZ B;  3I56 F;  2G9I A;  3JAL B;  2HS4 A;  1JFF A;  5LP6 C;  1W40 A;  3JAS A;  5AVM A;  4DXD A;  3RYH B;  3WPX A;  3ZP7 A;  2DYY A;  5EYP B;  3VOA A;  4G88 A;  1JN1 A;  4U39 A;  1GO0 A;  4FFB B;  5C8Y B;  1W5A A;  4G4Z A;  5JCO A;  3JAM M;  2H8C A;  3E1Y A;  3S0W A;  4HNA B;  1K73 H;  5MN5 A;  4EI8 A;  3WGJ A;  4C8E A;  2HS3 A;  2HP0 B;  1K8A H;  2IAF A;  3IEQ A;  2WAL A;  2QA4 F;  4O4I A;  4YJ2 A;  5HXU A;  4LNU A;  1U3L A;  2CWJ A;  3CG6 A;  4EB6 A;  3CPW F;  3CYQ A;  4LCK A;  1XBI A;  4NUT A;  3LWO C;  4I50 B;  3HKD A;  1NJI H;  1KNJ A;  4ZHQ B;  5KX5 B;  1QVG F;  1PXW A;  3VCZ A;  1XHO A;  3RYF B;  3R0P A;  4X1K B;  3V3T A;  3C8L A;  3KHN A;  5IYZ A;  3PLA C;  3N2G A;  4XCQ A;  2GZL A;  1SDS A;  1K9M H;  4X1Y A;  3QTY A;  3ZOP A;  2PHN A;  2UYN A;  5B8F A;  4TV8 A;  1YQN A;  1COM A;  1UFY A;  3C9U A;  1GO1 A;  3D01 A;  1KC8 H;  3LWP C;  1SZQ A;  4BVR A;  2HVY D;  4EI7 A;  3K12 A;  3J81 M;  4G4Y A;  2H6L A;  3F0F A;  5JVD A;  3KJK A;  5G4U C;  3MQW A;  3CC2 F;  5KMG A;  1VQ4 F;  3NK6 A;  3J80 M;  3P4E A;  4X3M A;  2Z1F A;  1E7K A;  4YJ2 B;  5GON B;  5MN4 A;  3J7A R;  4LNU B;  2NMU A;  3KIZ A;  4EB6 B;  3L7Q A;  5GAP K;  1QD9 A;  2RB9 A;  2DT4 A;  4IHJ B;  3KJJ A;  5HY4 A;  4O4H B;  3VO8 A;  1W5B A;  5FNV A;  1PF5 A;  3G71 F;  4DRX B;  4BT2 A;  2QI2 A;  4BVS A;  2CW4 A;  3WGL A;  2ALE A;  3OW2 F;  1JJ2 F;  3JAK B;  3RA5 A;  5JQG B;  5HY0 A;  4ERH A;  3MBM A;  4X1I B;  1QVF F;  3F6M A;  3KE1 A;  4ZHY B;  4F6R B;  2UYK A;  3MCA B;  2ZOV A;  3DDN A;  4TUY A;  5EO3 A;  1IPA A;  3GYQ A;  3CME F;  4EI9 A;  2Q1Y A;  1X25 A;  4C8G A;  4BVQ A;  3V7Q A;  3WPW A;  2KG4 A;  3V4D A;  3WGM A;  3WJP A;  1IV1 A;  3FD6 A;  1VQ8 F;  4I4T A;  4O2B B;  3LWQ C;  4G4V A;  2LBW A;  5KMG B;  4YJ3 A;  3ZP4 A;  5CA1 B;  4E6E A;  1RLU A;  3CCV F;  3HKC A;  1KQS F;  4X20 B;  1JY8 A;  1Q7Y H;  1W59 A;  3F0D A;  2UYJ A;  4O4L A;  5GAN K;  2HX0 A;  3E20 B;  1YI2 F;  4BT5 A;  2W8B C;  5CA0 B;  5CB4 A;  1VQO F;  3N2K B;  1FNK A;  1M90 H;  1GX1 A;  1X7P A;  3OBW A;  4ZOL A;  4TV9 A;  1R1M A;  3UT5 A;  3CCS F;  3IR9 A;  5IJ9 A;  3CCQ F;  2N48 A;  5EAZ A;  5LXT B;  2ZAU A;  2BTQ B;  1VQN F;  3WXM B;  4IIJ A;  1TUB A;  3CC7 F;  4WBN B;  5HP7 A;  4TUY B;  2IQQ A;  1W5F A;  3ELC A;  5LYJ A;  2Z01 A;  3VI6 A;  2LBT A;  1VHA A;  4BT3 A;  4RHA A;  3CCR F;  2I6R A;  3JAT A;  2Q1X A;  2BO1 A;  3M1X A;  4ZI7 A;  4ZK7 A;  3F0G A;  3E22 A;  1RQ7 A;  4ZHW A;  3FFM A;  5HY2 A;  5IJ0 B;  3JAW A;  5LA6 A;  1IV4 A;  2L26 A;  2KTU A;  5MN6 A;  4O4L B;  2LBX A;  2ZVY A;  3JAR B;  1X52 A;  1KD1 H;  2RHJ A;  4NQ3 A;  4PWT A;  3LWV C;  1H48 A;  1SA0 A;  2ZVZ A;  1U43 A;  1JFF B;  3HTN A;  3LFO A;  1NMU B;  3JAS B;  4RQO A;  1RQ2 A;  3CD6 F;  4B5C A;  4IIJ B;  3ZO8 A;  1TUB B;  3D54 A;  5FJ4 C;  1Q8R A;  1T0A A;  3V7E A;  3O85 A; 
#chains in the Genus database with same CATH homology
 1JJ2 F;  3RA5 A;  5HY0 A;  3CCL F;  4X3L A;  1QVF F;  3NVI B;  1W3E X;  3I55 F;  1Q82 H;  3MCA B;  3LWR C;  1RA4 A;  5EO3 A;  3CCJ F;  1IPA A;  3GYQ A;  3CME F;  4EI9 A;  1Q81 H;  3I56 F;  4BVQ A;  2OTL F;  1VQK F;  3HJW C;  2OHW A;  1W40 A;  3V7Q A;  2KG4 A;  3CXC F;  1VQ8 F;  1YJN F;  3RA6 A;  3LWQ C;  2LBW A;  3AGK A;  1GO0 A;  3HAX D;  3NK7 A;  3CCV F;  5HY1 A;  5GIO C;  3G6E F;  3JAM M;  3G4S F;  3E1Y A;  1W41 A;  1KQS F;  1VQ6 F;  1Q7Y H;  4BVT A;  1YIJ F;  1S72 F;  2F9Z C;  3CC4 F;  5GIP C;  1K73 H;  3PAF A;  5GAN K;  1CK2 A;  3E20 B;  1YI2 F;  1YIT F;  3SIU A;  1VQ5 F;  1VQO F;  4EI8 A;  1M90 H;  1DT9 A;  1X7P A;  5HXZ A;  5FLX M;  3OBW A;  5A2Q M;  2OZB A;  3D00 A;  2FGY A;  1K8A H;  5DCV A;  1W2B F;  3CCS F;  3IR9 A;  2WAL A;  2QA4 F;  3CCQ F;  5HXU A;  1VQ9 F;  3CG6 A;  2VGM A;  1VQN F;  3CCU F;  3CPW F;  3NVK E;  1YHQ F;  4LCK A;  3CMA F;  3WXM B;  1XBI A;  4NUT A;  3LWO C;  1YJ9 F;  3CC7 F;  1NJI H;  1QVG F;  1PXW A;  2GLZ A;  1T0K B;  3JCM M;  1RLG A;  2I6D A;  3V3T A;  3VI6 A;  3PLA C;  3CCR F;  4TZZ A;  4XCQ A;  5GIN C;  3OBY A;  1H7M A;  1Q86 H;  1VQ7 F;  1SDS A;  2OTJ F;  1K9M H;  2BO1 A;  2VGN A;  1YJW F;  1M1K H;  3N4Z A;  1VQP F;  1ZWZ A;  1GO1 A;  3FFM A;  3VMF B;  5HY2 A;  1KC8 H;  2FC3 A;  3LWP C;  4BVR A;  3CCE F;  2HVY D;  4EI7 A;  2KTV A;  2KTU A;  2AIF A;  3J81 M;  2LBX A;  1KD1 H;  1X52 A;  5IT9 M;  4NQ3 A;  5G4U C;  4C4W C;  1X7O A;  3LWV C;  3CC2 F;  1VQ4 F;  3NK6 A;  3J80 M;  4X3M A;  1E7K A;  3LFO A;  3N4Y A;  1NMU B;  2QEX F;  3J7A R;  3SIV A;  1CN7 A;  5GAP K;  1VQM F;  3CD6 F;  2CZW A;  5HY4 A;  5HWE A;  2JNB A;  3ON1 A;  4BY9 D;  1VQL F;  5EWR A;  3G71 F;  3V7E A;  5FJ4 C;  3NMU C;  3CPQ A;  5G4V C;  2QI2 A;  4BVS A;  1W42 A;  1N8R H;  3CCM F;  1GZ0 A;  2ALE A;  4BW0 B;  3O85 A;  3OW2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...