1YIJF

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yijF00
1GZ0A 3E1YA 1VQNF 3CCJF 3CCSF 3LWOC 3OW2F 3NK7A 1KQSF 2LBWA 5GINC 2KG4A 3CC4F 5EWRA 2KTVA 1X7PA 1Q82H 1W40A 3ON1A 1Q7YH 3OBWA 2VGMA 1PXWA 3NVKE 3CC2F 3NK6A 2WALA 1Q86H 1YJNF 1N8RH 3NVIB 3PAFA 3J81M 3HAXD 1NJIH 3CCEF 3V7QA 3J7AR 1RLGA 4X3LA 3SIUA 2ALEA 1T0KB 3LWVC 3FFMA 3HJWC 2BO1A 1W42A 1YITF 2CZWA 1VQ9F 1VQMF 3RA6A 2QI2A 1E7KA 3JAMM 3MCAB 2QA4F 3LFOA 1YJWF 3G71F 5FJ4C 3VMFB 5G4VC 1KC8H 2OZBA 4BW0B 3AGKA 1YJ9F 1GO1A 3I55F 1W2BF 5DCVA 3CXCF 3G4SF 1QVFF 2LBXA 1VQ7F 1X52A 2OHWA 5A2QM 4C4WC 3JCMM 3CCUF 3CMEF 1VQ6F 1M1KH 4BY9D 5IT9M 3CD6F 1CN7A 2FC3A 1JJ2F 1K8AH 3GYQA 5GIOC 1S72F 1VQKF 1Q81H 1VQ8F 1XBIA 2HVYD 5GIPC 2JNBA 1VQPF 2AIFA 3CCRF 1K73H 1H7MA 1K9MH 5GAPK 3O85A 3CCQF 3V7EA 3E20B 5G4UC 2OTLF 3G6EF 2I6DA 1M90H 3SIVA 1QVGF 4TZZA 3NMUC 1DT9A 1VQ5F 2VGNA 1SDSA 1VQLF 3CPQA 1YHQF 1CK2A 3N4YA 1KD1H 3CG6A 3VI6A 5GANK 1VQOF 3CCVF 3CCMF 3CC7F 3N4ZA 4LCKA 1RA4A 3PLAC 4X3MA 1NMUB 1X7OA 3IR9A 1ZWZA 3I56F 1IPAA 3LWQC 3CPWF 3J80M 1VQ4F 5EO3A 3LWRC 3CCLF 1YIJF 2QEXF 1YI2F 3WXMB 2KTUA 1W41A 4NUTA 3RA5A 5FLXM 2OTJF 1GO0A 3CMAF 3OBYA 1W3EX 3LWPC
chains in the Genus database with same CATH superfamily
1VQNF 4I55B 3CCJF 1KQSF 3NK7A 4U3JB 1XRGA 4ZHQA 1JY8A 2F9ZC 3CC4F 3MCQA 3RYHB 1X7PA 1IV1A 5EAZA 2Q1XA 2HP3A 4PWTA 4YJ2A 4O4HA 3S0HA 2MQEA 4O4LA 3KE1A 1XV2A 1Q8RA 2WALA 3C8LA 1FFXB 4NQ3A 1RQ7A 4BVTA 1N8RH 5JCOA 1CLIA 3P10A 4B45A 3HAXD 3V3TA 5J2TB 1NJIH 3JAKA 3N2KA 5JVDA 4O4IB 5C8YB 4X3LA 5JH7A 3RYCA 3SIUA 5EB1B 1R1MA 3FFMA 1TUBB 1FNJA 2CZWA 5CA1A 3RYCB 3WGMA 1JFFB 2HRYA 5HY2A 4X1YB 3JAMM 1E7KA 3F0EA 3MCAB 4TUYB 5CB4B 2QA4F 4R40B 1IV2A 3VMFB 5HXZA 1KC8H 4O2AA 4BW0B 4M8IA 2ZVYA 4EB6B 1W2BF 2ZOVA 3CXCF 2HP0A 2LBXA 5LA6A 4C4WC 1TVKB 3FPIA 3F0FA 5EYPB 1VQ6F 3ZP4A 5HY1A 3CD6F 3IEWA 2IQQA 4BT3A 1JJ2F 1XHOA 1DBFA 3C9TA 1RLUA 4C8EA 3UT5A 3BYQA 5GIPC 2JNBA 2Z1TA 3CCRF 3V7EA 2Z1UA 5GONA 4X1KB 2OTLF 3QTYA 3G6EF 2I6DA 4TV9A 2P6YA 3NMUC 2RB9A 1W5BA 4X1KA 3IMPA 1YHQF 3K0TA 1CK2A 3N2KB 5C8YA 3S0YA 4G4YA 3WPWA 5IJ9A 3VYSC 1VQVA 2VAPA 4O4JB 1ONIA 2HRUA 4LCKA 1YQNA 3I3FA 2BTOA 2Z1EA 1W55A 4X3MA 3ERNA 2FGYA 4EI8A 3CPWF 1OFUA 3LWRC 3KJKA 1JD1A 4X1IB 3T80A 2H8EA 3ELCA 4G4VA 4RQOA 2KTUA 5CA0A 2HP0B 2CVLA 3JARB 1SA0B 2OTJF 3CMAF 3OBYA 4I55A 2PMPA 1TVKA 4U3JA 4ZOLB 3VIUA 3K14A 5IJ9B 3CCSF 3WJPA 3WGLA 3S06A 4X20B 2KG4A 1SZQA 5EWRA 3CYQA 3ON1A 5KX5A 3ESJA 1Q7YH 3Q8HA 1COMA 2CHSA 2K1SA 3OBWA 3NVKE 3HKCA 3NK6A 5MN6A 5KMGB 1Q86H 3C9UA 3N2GB 3FD5A 3F0GA 2RHHA 4ZOLA 1U3LA 2IG8A 3HKDB 3JATB 5LXTA 1TUBA 2ALEA 5CA1B 2ZAUA 1YITF 1VQ9F 4IHJA 4DRXA 3TD4A 2ZF8A 4ZHVA 3M4SA 2RHLA 5FJ4C 4EB6A 5G4VC 2YYEA 2OZBA 2VAMA 3AGKA 3P4EA 3CB2A 5HP8A 5HY4A 3G4SF 1VQ7F 1X52A 2N48A 5HY0A 3CCUF 2QTPA 3CMEF 5LOVA 4I4TB 1PF5A 1CN7A 1QD9A 2IAFA 1K8AH 1QU9A 5LOVB 2BTQB 4BVRA 5GIOC 1S72F 1VQKF 4ZI7B 1KNJA 3C9SA 1K9MH 1JN1A 2YXZA 3MQWA 4B5CA 3JALA 1OAPA 4F6RA 4TZZA 3L7QA 5EIBD 1DT9A 2LCAA 3RYFB 3JAWB 5ITZB 2UYPA 3N4YA 1VHAA 5MN4A 1KD1H 3CG6A 4TV8A 1VQOF 3IKEA 4BT7A 2W8BC 3IKFA 3CC7F 3JVHA 4NWOB 2G9IA 3RYIA 4BT2A 1NMUB 4YJ3B 1X7OA 3JASA 3JALB 5HP7A 4X1IA 5EYPA 4BVSA 1RQ2A 2GLZA 1YIJF 2H8CA 3WXMB 3C9RA 5LXTB 1H48A 5J2UB 1W5EA 3RA5A 5B8FA 5FLXM 5MN5A 2ZODA 5EZYA 3LWPC 3ZP7A 2GVIA 2DT4A 3LWOC 3WGNA 2LBWA 5GINC 1W5AA 3D01A 4G4ZA 3LYBA 1UFYA 4LNUA 4YJ3A 2LBTA 2CWJA 1W40A 5IJ0B 4FFBB 3P0ZA 4EI9A 1FNKA 2PHNA 1VK3A 3GHZA 3CC2F 4C81A 3HKEB 3KHNA 4IIJB 3HTNA 1YJNF 2DYYA 2UYNA 3PAFA 3J81M 2L26A 3HKEA 1GX1A 4IIJA 5JCOC 3CCEF 2Z1FA 3V7QA 4BT5A 3J7AR 1RLGA 2UYNB 3RYFA 3JAWA 3U0OA 5ITZA 2AIZP 3LWVC 3HJWC 2BO1A 3R0PA 4YJ2B 1Z5VA 4C8IA 2QI2A 4X20A 4O2BB 5FNVB 4DXDA 5IYZB 3E22A 1Z5WA 3G71F 3RYIB 3WPXA 3RE3A 2RHOA 1GO1A 5DCVA 1SA0A 5IYZA 3JAKB 2H6LA 4U39A 4B62A 1W59A 2ZVZA 2R6R1 4C8GA 3KJJA 5A2QM 1U40A 4I4TA 3VOAA 5KMGA 3F0DA 5JQGA 4ZHWA 5AVMA 4BY9D 1KNKA 3JATA 3GYQA 2CSLA 3MDOA 1QAHA 4O2AB 3D00A 2HS4A 5BMVB 2OTMA 3HKCB 2HVYD 2HS0A 3B6NA 3M84A 1K73H 1U43A 5GAPK 3VO8A 3CCQF 3WJQA 1NQ3A 3K12A 3M1XA 3K2XA 5G4UC 2VAWA 3S02A 4XCQA 1VQ5F 2VGNA 1IV3A 4G88A 4HNAA 3CPQA 5HWEA 3CYPB 5LYJB 1SDSA 4ZHQB 3UT5B 3FD6A 2CHTA 3GTZA 2HS3A 5GANK 2Q1YA 4I50B 5BMVA 3CCVF 3N4ZA 4O4HB 1RA4A 1VH8A 2GZLA 2Z01A 1ODEA 3IR9A 4O2BA 4TV9B 1ZWZA 1JFFA 4G4WA 1IPAA 5KX5B 3IEQA 2UYKA 3F6MA 5EO3A 4C82A 3J80M 3HKBA 1YI2F 5JVDB 5EZYB 4NUTA 1GO0A 2HQSC 1W3EX 3N2GA 1GZ0A 3E1YA 4O4JA 2I6RA 3OW2F 5FNVA 2NMUA 3FBAA 4KWEA 3E22B 4X1YA 4TUYA 5CB4A 2UYJA 4FFBA 2KTVA 1Q82H 2UZHA 2VGMA 1PXWA 5LP6C 2HX0A 3NVIB 1FFXA 3VOBA 4TV8B 2KGWA 3TD5A 5J2TA 3D54A 5J2UA 1H47A 4RHAA 3ZOPA 3DC2A 4HNAB 4B46A 2EWCA 1W581 1T0KB 1W42A 3DDNA 1VQMF 3VYTC 3RA6A 2CW4A 3LFOA 3VCZA 1YJWF 1UI9A 4G4XA 2B33A 1YJ9F 3I55F 4ZI7A 1X25A 1QVFF 3QHDA 5LYJA 4O4LB 2OHWA 4ZHYB 3EORA 3JCMM 5HXUA 2VXYA 1M1KH 3HWUA 5IT9M 4LNUB 2FC3A 4IHJB 2R751 5IJ0A 1J7HA 3WGJA 5JH7B 3TD3A 1Q81H 1VQ8F 1XBIA 1VQPF 2AIFA 4ERHA 4ZK7A 1H7MA 3LMEA 3WGKA 3O85A 3E20B 3I7TA 3VTIC 4BVQA 3JARA 3ZO8A 3SIVA 3JASB 1M90H 2V9YA 1QVGF 4O4IA 3MBMA 1W57A 1VQLF 5EIBC 5LA6B 4WBNB 5LP6B 4I50A 1W5FA 3VI6A 3HKDA 5EB0A 3CCMF 3KIZA 4WBNA 5LP6A 3VYUC 1YGYA 1U3PA 4E6EA 3QUWA 3PLAC 3V4DA 1IV4A 3RYHA 4EI7A 4F6RB 4DRXB 3I56F 3HKBB 3LDTA 5JQGB 4BT6A 3LWQC 1VQ4F 3CCLF 1FSZA 3S0WA 2RHJA 2QEXF 2BTUA 1W41A 3S03A 5GONB 4BT4A 1T0AA 3WJRA 5CA0B 3OONA 2AMTA
chains in the Genus database with same CATH topology
1GZ0A 3E1YA 1VQNF 3CCJF 3CCSF 3LWOC 3OW2F 3NK7A 1KQSF 2LBWA 5GINC 2KG4A 2F9ZC 3CC4F 5EWRA 2KTVA 1X7PA 1Q82H 1W40A 3ON1A 1Q7YH 4EI9A 3OBWA 2VGMA 1PXWA 3NVKE 3CC2F 3NK6A 2WALA 4NQ3A 4BVTA 1Q86H 1YJNF 1N8RH 3NVIB 3PAFA 3J81M 3V3TA 3HAXD 1NJIH 3CCEF 3V7QA 3J7AR 1RLGA 4X3LA 3SIUA 2ALEA 1T0KB 3LWVC 3FFMA 3HJWC 2BO1A 1W42A 1YITF 2CZWA 1VQ9F 1VQMF 3RA6A 2QI2A 5HY2A 1E7KA 3JAMM 3MCAB 2QA4F 3LFOA 1YJWF 3G71F 5FJ4C 3VMFB 5HXZA 5G4VC 1KC8H 2OZBA 4BW0B 3AGKA 1YJ9F 1GO1A 3I55F 1W2BF 5DCVA 3CXCF 5HY4A 3G4SF 1QVFF 2LBXA 1VQ7F 1X52A 2OHWA 5A2QM 4C4WC 3JCMM 5HY0A 3CCUF 5HXUA 3CMEF 1VQ6F 5HY1A 1M1KH 4BY9D 5IT9M 3CD6F 1CN7A 2FC3A 1JJ2F 1K8AH 3GYQA 4BVRA 5GIOC 1S72F 3D00A 1VQKF 1Q81H 1VQ8F 1XBIA 2HVYD 5GIPC 2JNBA 1VQPF 2AIFA 3CCRF 1K73H 1H7MA 1K9MH 5GAPK 3O85A 3CCQF 3V7EA 3E20B 5G4UC 4BVQA 2OTLF 3G6EF 2I6DA 1M90H 3SIVA 1QVGF 4TZZA 3NMUC 1DT9A 4XCQA 1VQ5F 2VGNA 1SDSA 5HWEA 1VQLF 3CPQA 1YHQF 1CK2A 3N4YA 1KD1H 3CG6A 3VI6A 5GANK 1VQOF 3CCVF 3CCMF 3CC7F 3N4ZA 4LCKA 1RA4A 3PLAC 4X3MA 1NMUB 4EI7A 1X7OA 3IR9A 1ZWZA 3I56F 2FGYA 1IPAA 3LWQC 4BVSA 4EI8A 3J80M 3CPWF 1VQ4F 5EO3A 3LWRC 3CCLF 2GLZA 1YIJF 2QEXF 1YI2F 3WXMB 2KTUA 1W41A 4NUTA 3RA5A 5FLXM 2OTJF 1GO0A 3CMAF 3OBYA 1W3EX 3LWPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZ0 A;  3E1Y A;  1VQN F;  3CCJ F;  3CCS F;  3LWO C;  3OW2 F;  3NK7 A;  1KQS F;  2LBW A;  5GIN C;  2KG4 A;  3CC4 F;  5EWR A;  2KTV A;  1X7P A;  1Q82 H;  1W40 A;  3ON1 A;  1Q7Y H;  3OBW A;  2VGM A;  1PXW A;  3NVK E;  3CC2 F;  3NK6 A;  2WAL A;  1Q86 H;  1YJN F;  1N8R H;  3NVI B;  3PAF A;  3J81 M;  3HAX D;  1NJI H;  3CCE F;  3V7Q A;  3J7A R;  1RLG A;  4X3L A;  3SIU A;  2ALE A;  1T0K B;  3LWV C;  3FFM A;  3HJW C;  2BO1 A;  1W42 A;  1YIT F;  2CZW A;  1VQ9 F;  1VQM F;  3RA6 A;  2QI2 A;  1E7K A;  3JAM M;  3MCA B;  2QA4 F;  3LFO A;  1YJW F;  3G71 F;  5FJ4 C;  3VMF B;  5G4V C;  1KC8 H;  2OZB A;  4BW0 B;  3AGK A;  1YJ9 F;  1GO1 A;  3I55 F;  1W2B F;  5DCV A;  3CXC F;  3G4S F;  1QVF F;  2LBX A;  1VQ7 F;  1X52 A;  2OHW A;  5A2Q M;  4C4W C;  3JCM M;  3CCU F;  3CME F;  1VQ6 F;  1M1K H;  4BY9 D;  5IT9 M;  3CD6 F;  1CN7 A;  2FC3 A;  1JJ2 F;  1K8A H;  3GYQ A;  5GIO C;  1S72 F;  1VQK F;  1Q81 H;  1VQ8 F;  1XBI A;  2HVY D;  5GIP C;  2JNB A;  1VQP F;  2AIF A;  3CCR F;  1K73 H;  1H7M A;  1K9M H;  5GAP K;  3O85 A;  3CCQ F;  3V7E A;  3E20 B;  5G4U C;  2OTL F;  3G6E F;  2I6D A;  1M90 H;  3SIV A;  1QVG F;  4TZZ A;  3NMU C;  1DT9 A;  1VQ5 F;  2VGN A;  1SDS A;  1VQL F;  3CPQ A;  1YHQ F;  1CK2 A;  3N4Y A;  1KD1 H;  3CG6 A;  3VI6 A;  5GAN K;  1VQO F;  3CCV F;  3CCM F;  3CC7 F;  3N4Z A;  4LCK A;  1RA4 A;  3PLA C;  4X3M A;  1NMU B;  1X7O A;  3IR9 A;  1ZWZ A;  3I56 F;  1IPA A;  3LWQ C;  3CPW F;  3J80 M;  1VQ4 F;  5EO3 A;  3LWR C;  3CCL F;  1YIJ F;  2QEX F;  1YI2 F;  3WXM B;  2KTU A;  1W41 A;  4NUT A;  3RA5 A;  5FLX M;  2OTJ F;  1GO0 A;  3CMA F;  3OBY A;  1W3E X;  3LWP C; 
#chains in the Genus database with same CATH topology
 1VQN F;  4I55 B;  3CCJ F;  1KQS F;  3NK7 A;  4U3J B;  1XRG A;  4ZHQ A;  1JY8 A;  2F9Z C;  3CC4 F;  3MCQ A;  3RYH B;  1X7P A;  1IV1 A;  5EAZ A;  2Q1X A;  2HP3 A;  4PWT A;  4YJ2 A;  4O4H A;  3S0H A;  2MQE A;  4O4L A;  3KE1 A;  1XV2 A;  1Q8R A;  2WAL A;  3C8L A;  1FFX B;  4NQ3 A;  1RQ7 A;  4BVT A;  1N8R H;  5JCO A;  1CLI A;  3P10 A;  4B45 A;  3HAX D;  3V3T A;  5J2T B;  1NJI H;  3JAK A;  3N2K A;  5JVD A;  4O4I B;  5C8Y B;  4X3L A;  5JH7 A;  3RYC A;  3SIU A;  5EB1 B;  1R1M A;  3FFM A;  1TUB B;  1FNJ A;  2CZW A;  5CA1 A;  3RYC B;  3WGM A;  1JFF B;  2HRY A;  5HY2 A;  4X1Y B;  3JAM M;  1E7K A;  3F0E A;  3MCA B;  4TUY B;  5CB4 B;  2QA4 F;  4R40 B;  1IV2 A;  3VMF B;  5HXZ A;  1KC8 H;  4O2A A;  4BW0 B;  4M8I A;  2ZVY A;  4EB6 B;  1W2B F;  2ZOV A;  3CXC F;  2HP0 A;  2LBX A;  5LA6 A;  4C4W C;  1TVK B;  3FPI A;  3F0F A;  5EYP B;  1VQ6 F;  3ZP4 A;  5HY1 A;  3CD6 F;  3IEW A;  2IQQ A;  4BT3 A;  1JJ2 F;  1XHO A;  1DBF A;  3C9T A;  1RLU A;  4C8E A;  3UT5 A;  3BYQ A;  5GIP C;  2JNB A;  2Z1T A;  3CCR F;  3V7E A;  2Z1U A;  5GON A;  4X1K B;  2OTL F;  3QTY A;  3G6E F;  2I6D A;  4TV9 A;  2P6Y A;  3NMU C;  2RB9 A;  1W5B A;  4X1K A;  3IMP A;  1YHQ F;  3K0T A;  1CK2 A;  3N2K B;  5C8Y A;  3S0Y A;  4G4Y A;  3WPW A;  5IJ9 A;  3VYS C;  1VQV A;  2VAP A;  4O4J B;  1ONI A;  2HRU A;  4LCK A;  1YQN A;  3I3F A;  2BTO A;  2Z1E A;  1W55 A;  4X3M A;  3ERN A;  2FGY A;  4EI8 A;  3CPW F;  1OFU A;  3LWR C;  3KJK A;  1JD1 A;  4X1I B;  3T80 A;  2H8E A;  3ELC A;  4G4V A;  4RQO A;  2KTU A;  5CA0 A;  2HP0 B;  2CVL A;  3JAR B;  1SA0 B;  2OTJ F;  3CMA F;  3OBY A;  4I55 A;  2PMP A;  1TVK A;  4U3J A;  4ZOL B;  3VIU A;  3K14 A;  5IJ9 B;  3CCS F;  3WJP A;  3WGL A;  3S06 A;  4X20 B;  2KG4 A;  1SZQ A;  5EWR A;  3CYQ A;  3ON1 A;  5KX5 A;  3ESJ A;  1Q7Y H;  3Q8H A;  1COM A;  2CHS A;  2K1S A;  3OBW A;  3NVK E;  3HKC A;  3NK6 A;  5MN6 A;  5KMG B;  1Q86 H;  3C9U A;  3N2G B;  3FD5 A;  3F0G A;  2RHH A;  4ZOL A;  1U3L A;  2IG8 A;  3HKD B;  3JAT B;  5LXT A;  1TUB A;  2ALE A;  5CA1 B;  2ZAU A;  1YIT F;  1VQ9 F;  4IHJ A;  4DRX A;  3TD4 A;  2ZF8 A;  4ZHV A;  3M4S A;  2RHL A;  5FJ4 C;  4EB6 A;  5G4V C;  2YYE A;  2OZB A;  2VAM A;  3AGK A;  3P4E A;  3CB2 A;  5HP8 A;  5HY4 A;  3G4S F;  1VQ7 F;  1X52 A;  2N48 A;  5HY0 A;  3CCU F;  2QTP A;  3CME F;  5LOV A;  4I4T B;  1PF5 A;  1CN7 A;  1QD9 A;  2IAF A;  1K8A H;  1QU9 A;  5LOV B;  2BTQ B;  4BVR A;  5GIO C;  1S72 F;  1VQK F;  4ZI7 B;  1KNJ A;  3C9S A;  1K9M H;  1JN1 A;  2YXZ A;  3MQW A;  4B5C A;  3JAL A;  1OAP A;  4F6R A;  4TZZ A;  3L7Q A;  5EIB D;  1DT9 A;  2LCA A;  3RYF B;  3JAW B;  5ITZ B;  2UYP A;  3N4Y A;  1VHA A;  5MN4 A;  1KD1 H;  3CG6 A;  4TV8 A;  1VQO F;  3IKE A;  4BT7 A;  2W8B C;  3IKF A;  3CC7 F;  3JVH A;  4NWO B;  2G9I A;  3RYI A;  4BT2 A;  1NMU B;  4YJ3 B;  1X7O A;  3JAS A;  3JAL B;  5HP7 A;  4X1I A;  5EYP A;  4BVS A;  1RQ2 A;  2GLZ A;  1YIJ F;  2H8C A;  3WXM B;  3C9R A;  5LXT B;  1H48 A;  5J2U B;  1W5E A;  3RA5 A;  5B8F A;  5FLX M;  5MN5 A;  2ZOD A;  5EZY A;  3LWP C;  3ZP7 A;  2GVI A;  2DT4 A;  3LWO C;  3WGN A;  2LBW A;  5GIN C;  1W5A A;  3D01 A;  4G4Z A;  3LYB A;  1UFY A;  4LNU A;  4YJ3 A;  2LBT A;  2CWJ A;  1W40 A;  5IJ0 B;  4FFB B;  3P0Z A;  4EI9 A;  1FNK A;  2PHN A;  1VK3 A;  3GHZ A;  3CC2 F;  4C81 A;  3HKE B;  3KHN A;  4IIJ B;  3HTN A;  1YJN F;  2DYY A;  2UYN A;  3PAF A;  3J81 M;  2L26 A;  3HKE A;  1GX1 A;  4IIJ A;  5JCO C;  3CCE F;  2Z1F A;  3V7Q A;  4BT5 A;  3J7A R;  1RLG A;  2UYN B;  3RYF A;  3JAW A;  3U0O A;  5ITZ A;  2AIZ P;  3LWV C;  3HJW C;  2BO1 A;  3R0P A;  4YJ2 B;  1Z5V A;  4C8I A;  2QI2 A;  4X20 A;  4O2B B;  5FNV B;  4DXD A;  5IYZ B;  3E22 A;  1Z5W A;  3G71 F;  3RYI B;  3WPX A;  3RE3 A;  2RHO A;  1GO1 A;  5DCV A;  1SA0 A;  5IYZ A;  3JAK B;  2H6L A;  4U39 A;  4B62 A;  1W59 A;  2ZVZ A;  2R6R 1;  4C8G A;  3KJJ A;  5A2Q M;  1U40 A;  4I4T A;  3VOA A;  5KMG A;  3F0D A;  5JQG A;  4ZHW A;  5AVM A;  4BY9 D;  1KNK A;  3JAT A;  3GYQ A;  2CSL A;  3MDO A;  1QAH A;  4O2A B;  3D00 A;  2HS4 A;  5BMV B;  2OTM A;  3HKC B;  2HVY D;  2HS0 A;  3B6N A;  3M84 A;  1K73 H;  1U43 A;  5GAP K;  3VO8 A;  3CCQ F;  3WJQ A;  1NQ3 A;  3K12 A;  3M1X A;  3K2X A;  5G4U C;  2VAW A;  3S02 A;  4XCQ A;  1VQ5 F;  2VGN A;  1IV3 A;  4G88 A;  4HNA A;  3CPQ A;  5HWE A;  3CYP B;  5LYJ B;  1SDS A;  4ZHQ B;  3UT5 B;  3FD6 A;  2CHT A;  3GTZ A;  2HS3 A;  5GAN K;  2Q1Y A;  4I50 B;  5BMV A;  3CCV F;  3N4Z A;  4O4H B;  1RA4 A;  1VH8 A;  2GZL A;  2Z01 A;  1ODE A;  3IR9 A;  4O2B A;  4TV9 B;  1ZWZ A;  1JFF A;  4G4W A;  1IPA A;  5KX5 B;  3IEQ A;  2UYK A;  3F6M A;  5EO3 A;  4C82 A;  3J80 M;  3HKB A;  1YI2 F;  5JVD B;  5EZY B;  4NUT A;  1GO0 A;  2HQS C;  1W3E X;  3N2G A;  1GZ0 A;  3E1Y A;  4O4J A;  2I6R A;  3OW2 F;  5FNV A;  2NMU A;  3FBA A;  4KWE A;  3E22 B;  4X1Y A;  4TUY A;  5CB4 A;  2UYJ A;  4FFB A;  2KTV A;  1Q82 H;  2UZH A;  2VGM A;  1PXW A;  5LP6 C;  2HX0 A;  3NVI B;  1FFX A;  3VOB A;  4TV8 B;  2KGW A;  3TD5 A;  5J2T A;  3D54 A;  5J2U A;  1H47 A;  4RHA A;  3ZOP A;  3DC2 A;  4HNA B;  4B46 A;  2EWC A;  1W58 1;  1T0K B;  1W42 A;  3DDN A;  1VQM F;  3VYT C;  3RA6 A;  2CW4 A;  3LFO A;  3VCZ A;  1YJW F;  1UI9 A;  4G4X A;  2B33 A;  1YJ9 F;  3I55 F;  4ZI7 A;  1X25 A;  1QVF F;  3QHD A;  5LYJ A;  4O4L B;  2OHW A;  4ZHY B;  3EOR A;  3JCM M;  5HXU A;  2VXY A;  1M1K H;  3HWU A;  5IT9 M;  4LNU B;  2FC3 A;  4IHJ B;  2R75 1;  5IJ0 A;  1J7H A;  3WGJ A;  5JH7 B;  3TD3 A;  1Q81 H;  1VQ8 F;  1XBI A;  1VQP F;  2AIF A;  4ERH A;  4ZK7 A;  1H7M A;  3LME A;  3WGK A;  3O85 A;  3E20 B;  3I7T A;  3VTI C;  4BVQ A;  3JAR A;  3ZO8 A;  3SIV A;  3JAS B;  1M90 H;  2V9Y A;  1QVG F;  4O4I A;  3MBM A;  1W57 A;  1VQL F;  5EIB C;  5LA6 B;  4WBN B;  5LP6 B;  4I50 A;  1W5F A;  3VI6 A;  3HKD A;  5EB0 A;  3CCM F;  3KIZ A;  4WBN A;  5LP6 A;  3VYU C;  1YGY A;  1U3P A;  4E6E A;  3QUW A;  3PLA C;  3V4D A;  1IV4 A;  3RYH A;  4EI7 A;  4F6R B;  4DRX B;  3I56 F;  3HKB B;  3LDT A;  5JQG B;  4BT6 A;  3LWQ C;  1VQ4 F;  3CCL F;  1FSZ A;  3S0W A;  2RHJ A;  2QEX F;  2BTU A;  1W41 A;  3S03 A;  5GON B;  4BT4 A;  1T0A A;  3WJR A;  5CA0 B;  3OON A;  2AMT A; 
#chains in the Genus database with same CATH homology
 1GZ0 A;  3E1Y A;  1VQN F;  3CCJ F;  3CCS F;  3LWO C;  3OW2 F;  3NK7 A;  1KQS F;  2LBW A;  5GIN C;  2KG4 A;  2F9Z C;  3CC4 F;  5EWR A;  2KTV A;  1X7P A;  1Q82 H;  1W40 A;  3ON1 A;  1Q7Y H;  4EI9 A;  3OBW A;  2VGM A;  1PXW A;  3NVK E;  3CC2 F;  3NK6 A;  2WAL A;  4NQ3 A;  4BVT A;  1Q86 H;  1YJN F;  1N8R H;  3NVI B;  3PAF A;  3J81 M;  3V3T A;  3HAX D;  1NJI H;  3CCE F;  3V7Q A;  3J7A R;  1RLG A;  4X3L A;  3SIU A;  2ALE A;  1T0K B;  3LWV C;  3FFM A;  3HJW C;  2BO1 A;  1W42 A;  1YIT F;  2CZW A;  1VQ9 F;  1VQM F;  3RA6 A;  2QI2 A;  5HY2 A;  1E7K A;  3JAM M;  3MCA B;  2QA4 F;  3LFO A;  1YJW F;  3G71 F;  5FJ4 C;  3VMF B;  5HXZ A;  5G4V C;  1KC8 H;  2OZB A;  4BW0 B;  3AGK A;  1YJ9 F;  1GO1 A;  3I55 F;  1W2B F;  5DCV A;  3CXC F;  5HY4 A;  3G4S F;  1QVF F;  2LBX A;  1VQ7 F;  1X52 A;  2OHW A;  5A2Q M;  4C4W C;  3JCM M;  5HY0 A;  3CCU F;  5HXU A;  3CME F;  1VQ6 F;  5HY1 A;  1M1K H;  4BY9 D;  5IT9 M;  3CD6 F;  1CN7 A;  2FC3 A;  1JJ2 F;  1K8A H;  3GYQ A;  4BVR A;  5GIO C;  1S72 F;  3D00 A;  1VQK F;  1Q81 H;  1VQ8 F;  1XBI A;  2HVY D;  5GIP C;  2JNB A;  1VQP F;  2AIF A;  3CCR F;  1K73 H;  1H7M A;  1K9M H;  5GAP K;  3O85 A;  3CCQ F;  3V7E A;  3E20 B;  5G4U C;  4BVQ A;  2OTL F;  3G6E F;  2I6D A;  1M90 H;  3SIV A;  1QVG F;  4TZZ A;  3NMU C;  1DT9 A;  4XCQ A;  1VQ5 F;  2VGN A;  1SDS A;  5HWE A;  1VQL F;  3CPQ A;  1YHQ F;  1CK2 A;  3N4Y A;  1KD1 H;  3CG6 A;  3VI6 A;  5GAN K;  1VQO F;  3CCV F;  3CCM F;  3CC7 F;  3N4Z A;  4LCK A;  1RA4 A;  3PLA C;  4X3M A;  1NMU B;  4EI7 A;  1X7O A;  3IR9 A;  1ZWZ A;  3I56 F;  2FGY A;  1IPA A;  3LWQ C;  4BVS A;  4EI8 A;  3J80 M;  3CPW F;  1VQ4 F;  5EO3 A;  3LWR C;  3CCL F;  2GLZ A;  1YIJ F;  2QEX F;  1YI2 F;  3WXM B;  2KTU A;  1W41 A;  4NUT A;  3RA5 A;  5FLX M;  2OTJ F;  1GO0 A;  3CMA F;  3OBY A;  1W3E X;  3LWP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...