1YIJF

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yijF00
3JAMM 3J7AR 1M1KH 1Q82H 3CCVF 1N8RH 1QVFF 1VQKF 3VMFB 3MCAB 3RA5A 1W3EX 1Q7YH 3LWOC 3I56F 3ON1A 2KG4A 4NUTA 1H7MA 3CC4F 2OZBA 1GO1A 5G4UC 2HVYD 1VQ6F 3CXCF 3CMAF 1YI2F 1K73H 1VQ5F 2QI2A 3E20B 1XBIA 3LWQC 3AGKA 5FJ4C 3OW2F 3CG6A 3O85A 3LWPC 1JJ2F 4X3LA 1RA4A 3CPQA 1VQMF 1VQPF 2VGNA 1W42A 1W2BF 3CCJF 3OBYA 5EWRA 1X7OA 3G6EF 3RA6A 3E1YA 1VQOF 2CZWA 4BY9D 2LBXA 3SIUA 5GAPK 2VGMA 1ZWZA 1YIJF 1SDSA 1VQLF 4C4WC 2JNBA 4LCKA 3NK6A 3WXMB 3LWVC 1S72F 1GZ0A 3CCEF 1VQ9F 2AIFA 3HAXD 3CCLF 1KD1H 3J80M 5GIPC 3IR9A 3CMEF 1NJIH 1K9MH 1M90H 3PAFA 2BO1A 1CN7A 3GYQA 1PXWA 3VI6A 2LBWA 3G4SF 1YJ9F 1GO0A 1VQ4F 1KC8H 2QEXF 3NMUC 1W41A 1RLGA 2WALA 3N4ZA 1VQ8F 3CCUF 1VQ7F 2OTJF 3CCRF 5FLXM 2KTUA 5G4VC 1T0KB 3V7QA 4TZZA 5DCVA 3LWRC 1YHQF 3CC7F 1Q81H 1K8AH 2QA4F 3CPWF 1IPAA 3JCMM 3NVKE 5IT9M 3CCSF 1X52A 5GIOC 3NK7A 1CK2A 1NMUB 3N4YA 5EO3A 2ALEA 1X7PA 1QVGF 1YJWF 2OTLF 3CC2F 4X3MA 3CCQF 3SIVA 5GINC 5GANK 2FC3A 2OHWA 4BW0B 3CCMF 2I6DA 3OBWA 1VQNF 3V7EA 2KTVA 1YJNF 3PLAC 3LFOA 3CD6F 3J81M 5A2QM 1YITF 1Q86H 3G71F 3FFMA 3I55F 1KQSF 1E7KA 3HJWC 1DT9A 3NVIB 1W40A
chains in the Genus database with same CATH superfamily
1COMA 3WGLA 5KMGA 4TUYB 4R40B 3JAMM 3J7AR 3F0EA 1Q82H 1RLUA 3HKDA 3HKCB 5BMVA 4B46A 4YJ3B 5HWEA 3S0HA 5JQGB 3LWOC 5JVDB 4O4IB 2N48A 3CC4F 2CHSA 3F0DA 2HVYD 3K0TA 3JALB 4C81A 5CA0B 3HKBB 2Z1UA 3AGKA 4X1YB 3CG6A 2RHLA 3O85A 2UYPA 2CW4A 3R0PA 3JATA 1ONIA 3CPQA 4X1YA 5J2TB 3KJJA 3CCJF 2RHOA 1VH8A 4F6RA 1U3LA 1NQ3A 1W5EA 4LNUA 5GONB 5GAPK 1ZWZA 3JARB 4G4WA 5ITZB 3RYCB 2NMUA 3VYUC 5HXUA 3JAKA 3RYCA 5HY4A 3HTNA 4NQ3A 1GZ0A 2W8BC 1VQ9F 3CCLF 3CYQA 4YJ2B 5GIPC 2K1SA 3MDOA 5MN6A 1CN7A 3GYQA 3VI6A 4RHAA 1YJ9F 2G9IA 3BYQA 3VYTC 5J2TA 1VQ4F 1GO0A 3I7TA 2HP3A 4I4TA 3N2KA 2OTMA 4G4YA 2R6R1 3UT5B 3QTYA 4M8IA 3MQWA 4I55A 4O2BA 5FLXM 5G4VC 3FD6A 3JALA 3WGKA 2ZVYA 3V7QA 4I50A 5MN5A 1CLIA 1Q81H 2UYNB 5J2UA 1K8AH 3CPWF 2DT4A 3TD4A 3NVKE 1NMUB 3ZO8A 5JQGA 2QTPA 1SA0A 3TD3A 1QVGF 4U39A 2OTLF 2P6YA 5GANK 2FC3A 4BW0B 3TD5A 4ZHQA 3OBWA 2FGYA 2Z1FA 4PWTA 5LA6A 1VQNF 3VTIC 4DRXA 2KTVA 4G4XA 5LXTB 2AMTA 1TUBB 4O4LB 1U40A 3PLAC 2I6RA 4ZOLB 3G71F 1DBFA 4BT4A 2UYJA 3KIZA 4BT7A 3WGMA 4G4VA 2LCAA 1QD9A 5EIBC 2R751 3CCVF 1QVFF 2Q1XA 4O4HA 3VMFB 5IJ9B 3KHNA 4O4JB 3F6MA 1T0AA 3JARA 1TUBA 4O4LA 5LYJA 3RYFB 3LDTA 1FSZA 5G4UC 4C8GA 4C8EA 2GLZA 3WJQA 1VQ6F 1K73H 1X25A 4ZHQB 4EB6B 1XHOA 3OW2F 4NWOB 1TVKB 4X20B 4RQOA 1JJ2F 2HS4A 4X3LA 5C8YB 5IJ9A 3FD5A 3IMPA 2PMPA 1W2BF 5EIBD 5JCOA 5KX5B 3G6EF 3RA6A 1VQOF 4BVQA 3GHZA 2UYKA 4HNAA 4TV8A 3SIUA 4HNAB 1OAPA 5EYPB 1SDSA 4FFBA 4LCKA 1KNJA 3WXMB 4G4ZA 1S72F 4BT6A 1W5AA 4TV9B 4EB6A 5KMGB 1KNKA 3S0WA 1UFYA 5HP8A 5JH7B 3CMEF 3WGJA 3PAFA 1PXWA 5LYJB 5FNVB 1KC8H 2Q1YA 2QEXF 4XCQA 3LMEA 3WPWA 4KWEA 3ERNA 1RQ7A 2GVIA 4EI7A 1GX1A 2ZAUA 3JASA 1JFFA 3V4DA 2OTJF 3D54A 2UYNA 2DYYA 2KTUA 2Z1EA 5CB4B 4EI8A 1VHAA 1T0KB 3VCZA 4TZZA 3MBMA 2GZLA 5LP6C 3LWRC 3CC7F 4O2BB 2QA4F 1IPAA 3ZP4A 2ZF8A 3CCSF 1X52A 5GIOC 5C8YA 1VK3A 1J7HA 5EO3A 2ALEA 1H48A 2YYEA 3VYSC 3S02A 5GINC 3FBAA 5CA1A 1SA0B 1IV4A 3C9UA 2CHTA 5IJ0B 3K14A 4X1IB 4BT2A 3LFOA 4I50B 3CD6F 1ODEA 2HS0A 3S03A 3OONA 3IEQA 5EB1B 3KE1A 1M1KH 2HP0A 4ZI7A 2CWJA 1YGYA 3N2KB 4O2AB 1Q7YH 5IYZA 2BTQB 3ON1A 4NUTA 5LXTA 5CA0A 4WBNB 1XV2A 1W55A 3HKEA 2MQEA 3CXCF 3CMAF 1YI2F 1VQ5F 2H8EA 2QI2A 3E20B 5J2UB 5HXZA 3WJRA 3RE3A 3LWPC 3FPIA 4O4HB 1IV2A 1RA4A 3LYBA 1VQMF 1VQPF 2VGNA 1W57A 2CVLA 5EWRA 4TUYA 5JVDA 2RB9A 3ZOPA 4ZK7A 2CSLA 4BY9D 2RHHA 2VGMA 3D01A 1YIJF 3M84A 3U0OA 1QAHA 3C9RA 3HWUA 1VQLF 2JNBA 2HRYA 3JAWB 5LA6B 3LWVC 3K12A 5JCOC 1H47A 3C8LA 2VAMA 4U3JA 5AVMA 4BT5A 5EZYA 3CCEF 2PHNA 2AIFA 3ESJA 3HKBA 1KD1H 3D00A 5HY2A 2F9ZC 1M90H 2IQQA 4O4IA 2BO1A 5GONA 1YQNA 3G4SF 2LBWA 4LNUB 1JFFB 5IJ0A 1PF5A 3HKCA 2HQSC 1W41A 4YJ3A 1RLGA 2WALA 3N4ZA 4I55B 1W581 2IAFA 1VQ8F 3CCUF 1FFXA 3CCRF 2BTOA 5HY0A 4C8IA 3HKEB 1VQVA 5DCVA 5LP6B 1W59A 3QUWA 4O2AA 5IT9M 3DC2A 1XRGA 5MN4A 1CK2A 3N4YA 4O4JA 5IYZB 3JATB 1X7PA 2V9YA 1YJWF 4X3MA 2HP0B 3CCQF 2RHJA 3F0GA 4FFBB 4ZI7B 4E6EA 2OHWA 2I6DA 3K2XA 4ZOLA 4BVSA 1YJNF 1QU9A 3J81M 2H6LA 1YITF 4DRXB 3FFMA 1E7KA 2AIZP 5EAZA 5JH7A 4B62A 5LOVA 3NVIB 4F6RB 3ZP7A 4ZHYB 3CC2F 4TV9A 5EZYB 4U3JB 3WPXA 1N8RH 3WGNA 1VQKF 3M4SA 3S06A 3MCAB 3RA5A 4B5CA 4IHJB 3S0YA 3ELCA 1W3EX 5EYPA 1R1MA 3I56F 2Z1TA 3RYFA 3RYHB 3RYIA 2KG4A 4ZHVA 3KJKA 1H7MA 3CYPB 3P0ZA 2OZBA 1GO1A 3VOAA 5CB4A 3L7QA 1U43A 1UI9A 4X1KB 1XBIA 3LWQC 4X1IA 3JASB 5FJ4C 3N2GA 1IV1A 2VAWA 5BMVB 3P10A 4X20A 3HKDB 2HRUA 3IKEA 1W42A 4IIJB 3OBYA 1X7OA 3E1YA 1FNJA 2CZWA 4B45A 3QHDA 4BVRA 1Z5VA 3F0FA 2LBXA 4IHJA 3VIUA 3IEWA 3EORA 3E22A 1W5BA 3B6NA 3JVHA 4C4WC 3JAKB 3NK6A 4ZHWA 2L26A 3VOBA 2YXZA 1OFUA 2BTUA 3I3FA 1JN1A 3HAXD 2H8CA 1Z5WA 1SZQA 3DDNA 4TV8B 3J80M 4BT3A 3IR9A 3Q8HA 1NJIH 2HS3A 1K9MH 5FNVA 3E22B 3NMUC 4C82A 5KX5A 1FNKA 3VO8A 4G88A 1W5FA 2VXYA 2VAPA 3JAWA 1JY8A 1VQ7F 2KGWA 5CA1B 1U3PA 1FFXB 2ZVZA 3V3TA 2UZHA 2B33A 3N2GB 2LBTA 3MCQA 4DXDA 5HY1A 1JD1A 1YHQF 5B8FA 4X1KA 5HP7A 3GTZA 4IIJA 3M1XA 3C9SA 3JCMM 3P4EA 3NK7A 3IKFA 2Z01A 3RYHA 3RYIB 3CB2A 3SIVA 3UT5A 5EB0A 5ITZA 3CCMF 1Q8RA 3C9TA 3T80A 3V7EA 4BVTA 4I4TB 3WJPA 1TVKA 2HX0A 4WBNA 1RQ2A 5A2QM 5LOVB 1Q86H 1IV3A 5LP6A 4EI9A 2ZODA 2EWCA 1KQSF 3I55F 3HJWC 1DT9A 4YJ2A 2IG8A 4ERHA 2ZOVA 1W40A
chains in the Genus database with same CATH topology
3JAMM 3J7AR 1M1KH 1Q82H 3CCVF 1N8RH 1QVFF 1VQKF 3VMFB 3MCAB 3RA5A 1W3EX 5HWEA 1Q7YH 3LWOC 3I56F 3ON1A 2KG4A 4NUTA 1H7MA 3CC4F 2OZBA 1GO1A 5G4UC 2HVYD 2GLZA 1VQ6F 3CXCF 3CMAF 1YI2F 1K73H 1VQ5F 2QI2A 3E20B 1XBIA 3LWQC 3AGKA 5HXZA 5FJ4C 3OW2F 3CG6A 3O85A 3LWPC 1JJ2F 4X3LA 1RA4A 3CPQA 1VQMF 1VQPF 2VGNA 1W42A 1W2BF 3CCJF 3OBYA 5EWRA 1X7OA 3G6EF 3RA6A 3E1YA 1VQOF 4BVQA 2CZWA 4BY9D 4BVRA 2LBXA 3SIUA 5GAPK 2VGMA 1ZWZA 1YIJF 1SDSA 1VQLF 4C4WC 2JNBA 4LCKA 3NK6A 3WXMB 3LWVC 5HXUA 5HY4A 1S72F 4NQ3A 1GZ0A 3CCEF 1VQ9F 2AIFA 3HAXD 3CCLF 1KD1H 3D00A 3J80M 5HY2A 3IR9A 5GIPC 3CMEF 1NJIH 2F9ZC 1K9MH 1M90H 3PAFA 2BO1A 1CN7A 3GYQA 1PXWA 3VI6A 2LBWA 3G4SF 1YJ9F 1GO0A 1VQ4F 1KC8H 2QEXF 3NMUC 4XCQA 1W41A 1RLGA 2WALA 3N4ZA 4EI7A 1VQ8F 3CCUF 1VQ7F 2OTJF 3CCRF 3V3TA 5HY0A 5FLXM 2KTUA 5G4VC 4EI8A 1T0KB 3V7QA 5HY1A 4TZZA 5DCVA 3LWRC 1YHQF 3CC7F 1Q81H 1K8AH 2QA4F 3CPWF 1IPAA 3JCMM 3NVKE 5IT9M 3CCSF 1X52A 5GIOC 3NK7A 1CK2A 1NMUB 3N4YA 5EO3A 2ALEA 1X7PA 1QVGF 1YJWF 2OTLF 3CC2F 4X3MA 3CCQF 3SIVA 5GINC 5GANK 2FC3A 2OHWA 4BW0B 3CCMF 2I6DA 3OBWA 2FGYA 1VQNF 3V7EA 4BVTA 2KTVA 4BVSA 1YJNF 3PLAC 3LFOA 3CD6F 3J81M 5A2QM 1YITF 1Q86H 4EI9A 3G71F 3FFMA 3I55F 1KQSF 1E7KA 3HJWC 1DT9A 3NVIB 1W40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM M;  3J7A R;  1M1K H;  1Q82 H;  3CCV F;  1N8R H;  1QVF F;  1VQK F;  3VMF B;  3MCA B;  3RA5 A;  1W3E X;  1Q7Y H;  3LWO C;  3I56 F;  3ON1 A;  2KG4 A;  4NUT A;  1H7M A;  3CC4 F;  2OZB A;  1GO1 A;  5G4U C;  2HVY D;  1VQ6 F;  3CXC F;  3CMA F;  1YI2 F;  1K73 H;  1VQ5 F;  2QI2 A;  3E20 B;  1XBI A;  3LWQ C;  3AGK A;  5FJ4 C;  3OW2 F;  3CG6 A;  3O85 A;  3LWP C;  1JJ2 F;  4X3L A;  1RA4 A;  3CPQ A;  1VQM F;  1VQP F;  2VGN A;  1W42 A;  1W2B F;  3CCJ F;  3OBY A;  5EWR A;  1X7O A;  3G6E F;  3RA6 A;  3E1Y A;  1VQO F;  2CZW A;  4BY9 D;  2LBX A;  3SIU A;  5GAP K;  2VGM A;  1ZWZ A;  1YIJ F;  1SDS A;  1VQL F;  4C4W C;  2JNB A;  4LCK A;  3NK6 A;  3WXM B;  3LWV C;  1S72 F;  1GZ0 A;  3CCE F;  1VQ9 F;  2AIF A;  3HAX D;  3CCL F;  1KD1 H;  3J80 M;  5GIP C;  3IR9 A;  3CME F;  1NJI H;  1K9M H;  1M90 H;  3PAF A;  2BO1 A;  1CN7 A;  3GYQ A;  1PXW A;  3VI6 A;  2LBW A;  3G4S F;  1YJ9 F;  1GO0 A;  1VQ4 F;  1KC8 H;  2QEX F;  3NMU C;  1W41 A;  1RLG A;  2WAL A;  3N4Z A;  1VQ8 F;  3CCU F;  1VQ7 F;  2OTJ F;  3CCR F;  5FLX M;  2KTU A;  5G4V C;  1T0K B;  3V7Q A;  4TZZ A;  5DCV A;  3LWR C;  1YHQ F;  3CC7 F;  1Q81 H;  1K8A H;  2QA4 F;  3CPW F;  1IPA A;  3JCM M;  3NVK E;  5IT9 M;  3CCS F;  1X52 A;  5GIO C;  3NK7 A;  1CK2 A;  1NMU B;  3N4Y A;  5EO3 A;  2ALE A;  1X7P A;  1QVG F;  1YJW F;  2OTL F;  3CC2 F;  4X3M A;  3CCQ F;  3SIV A;  5GIN C;  5GAN K;  2FC3 A;  2OHW A;  4BW0 B;  3CCM F;  2I6D A;  3OBW A;  1VQN F;  3V7E A;  2KTV A;  1YJN F;  3PLA C;  3LFO A;  3CD6 F;  3J81 M;  5A2Q M;  1YIT F;  1Q86 H;  3G71 F;  3FFM A;  3I55 F;  1KQS F;  1E7K A;  3HJW C;  1DT9 A;  3NVI B;  1W40 A; 
#chains in the Genus database with same CATH topology
 1COM A;  3WGL A;  5KMG A;  4TUY B;  4R40 B;  3JAM M;  3J7A R;  3F0E A;  1Q82 H;  1RLU A;  3HKD A;  3HKC B;  5BMV A;  4B46 A;  4YJ3 B;  5HWE A;  3S0H A;  5JQG B;  3LWO C;  5JVD B;  4O4I B;  2N48 A;  3CC4 F;  2CHS A;  3F0D A;  2HVY D;  3K0T A;  3JAL B;  4C81 A;  5CA0 B;  3HKB B;  2Z1U A;  3AGK A;  4X1Y B;  3CG6 A;  2RHL A;  3O85 A;  2UYP A;  2CW4 A;  3R0P A;  3JAT A;  1ONI A;  3CPQ A;  4X1Y A;  5J2T B;  3KJJ A;  3CCJ F;  2RHO A;  1VH8 A;  4F6R A;  1U3L A;  1NQ3 A;  1W5E A;  4LNU A;  5GON B;  5GAP K;  1ZWZ A;  3JAR B;  4G4W A;  5ITZ B;  3RYC B;  2NMU A;  3VYU C;  5HXU A;  3JAK A;  3RYC A;  5HY4 A;  3HTN A;  4NQ3 A;  1GZ0 A;  2W8B C;  1VQ9 F;  3CCL F;  3CYQ A;  4YJ2 B;  5GIP C;  2K1S A;  3MDO A;  5MN6 A;  1CN7 A;  3GYQ A;  3VI6 A;  4RHA A;  1YJ9 F;  2G9I A;  3BYQ A;  3VYT C;  5J2T A;  1VQ4 F;  1GO0 A;  3I7T A;  2HP3 A;  4I4T A;  3N2K A;  2OTM A;  4G4Y A;  2R6R 1;  3UT5 B;  3QTY A;  4M8I A;  3MQW A;  4I55 A;  4O2B A;  5FLX M;  5G4V C;  3FD6 A;  3JAL A;  3WGK A;  2ZVY A;  3V7Q A;  4I50 A;  5MN5 A;  1CLI A;  1Q81 H;  2UYN B;  5J2U A;  1K8A H;  3CPW F;  2DT4 A;  3TD4 A;  3NVK E;  1NMU B;  3ZO8 A;  5JQG A;  2QTP A;  1SA0 A;  3TD3 A;  1QVG F;  4U39 A;  2OTL F;  2P6Y A;  5GAN K;  2FC3 A;  4BW0 B;  3TD5 A;  4ZHQ A;  3OBW A;  2FGY A;  2Z1F A;  4PWT A;  5LA6 A;  1VQN F;  3VTI C;  4DRX A;  2KTV A;  4G4X A;  5LXT B;  2AMT A;  1TUB B;  4O4L B;  1U40 A;  3PLA C;  2I6R A;  4ZOL B;  3G71 F;  1DBF A;  4BT4 A;  2UYJ A;  3KIZ A;  4BT7 A;  3WGM A;  4G4V A;  2LCA A;  1QD9 A;  5EIB C;  2R75 1;  3CCV F;  1QVF F;  2Q1X A;  4O4H A;  3VMF B;  5IJ9 B;  3KHN A;  4O4J B;  3F6M A;  1T0A A;  3JAR A;  1TUB A;  4O4L A;  5LYJ A;  3RYF B;  3LDT A;  1FSZ A;  5G4U C;  4C8G A;  4C8E A;  2GLZ A;  3WJQ A;  1VQ6 F;  1K73 H;  1X25 A;  4ZHQ B;  4EB6 B;  1XHO A;  3OW2 F;  4NWO B;  1TVK B;  4X20 B;  4RQO A;  1JJ2 F;  2HS4 A;  4X3L A;  5C8Y B;  5IJ9 A;  3FD5 A;  3IMP A;  2PMP A;  1W2B F;  5EIB D;  5JCO A;  5KX5 B;  3G6E F;  3RA6 A;  1VQO F;  4BVQ A;  3GHZ A;  2UYK A;  4HNA A;  4TV8 A;  3SIU A;  4HNA B;  1OAP A;  5EYP B;  1SDS A;  4FFB A;  4LCK A;  1KNJ A;  3WXM B;  4G4Z A;  1S72 F;  4BT6 A;  1W5A A;  4TV9 B;  4EB6 A;  5KMG B;  1KNK A;  3S0W A;  1UFY A;  5HP8 A;  5JH7 B;  3CME F;  3WGJ A;  3PAF A;  1PXW A;  5LYJ B;  5FNV B;  1KC8 H;  2Q1Y A;  2QEX F;  4XCQ A;  3LME A;  3WPW A;  4KWE A;  3ERN A;  1RQ7 A;  2GVI A;  4EI7 A;  1GX1 A;  2ZAU A;  3JAS A;  1JFF A;  3V4D A;  2OTJ F;  3D54 A;  2UYN A;  2DYY A;  2KTU A;  2Z1E A;  5CB4 B;  4EI8 A;  1VHA A;  1T0K B;  3VCZ A;  4TZZ A;  3MBM A;  2GZL A;  5LP6 C;  3LWR C;  3CC7 F;  4O2B B;  2QA4 F;  1IPA A;  3ZP4 A;  2ZF8 A;  3CCS F;  1X52 A;  5GIO C;  5C8Y A;  1VK3 A;  1J7H A;  5EO3 A;  2ALE A;  1H48 A;  2YYE A;  3VYS C;  3S02 A;  5GIN C;  3FBA A;  5CA1 A;  1SA0 B;  1IV4 A;  3C9U A;  2CHT A;  5IJ0 B;  3K14 A;  4X1I B;  4BT2 A;  3LFO A;  4I50 B;  3CD6 F;  1ODE A;  2HS0 A;  3S03 A;  3OON A;  3IEQ A;  5EB1 B;  3KE1 A;  1M1K H;  2HP0 A;  4ZI7 A;  2CWJ A;  1YGY A;  3N2K B;  4O2A B;  1Q7Y H;  5IYZ A;  2BTQ B;  3ON1 A;  4NUT A;  5LXT A;  5CA0 A;  4WBN B;  1XV2 A;  1W55 A;  3HKE A;  2MQE A;  3CXC F;  3CMA F;  1YI2 F;  1VQ5 F;  2H8E A;  2QI2 A;  3E20 B;  5J2U B;  5HXZ A;  3WJR A;  3RE3 A;  3LWP C;  3FPI A;  4O4H B;  1IV2 A;  1RA4 A;  3LYB A;  1VQM F;  1VQP F;  2VGN A;  1W57 A;  2CVL A;  5EWR A;  4TUY A;  5JVD A;  2RB9 A;  3ZOP A;  4ZK7 A;  2CSL A;  4BY9 D;  2RHH A;  2VGM A;  3D01 A;  1YIJ F;  3M84 A;  3U0O A;  1QAH A;  3C9R A;  3HWU A;  1VQL F;  2JNB A;  2HRY A;  3JAW B;  5LA6 B;  3LWV C;  3K12 A;  5JCO C;  1H47 A;  3C8L A;  2VAM A;  4U3J A;  5AVM A;  4BT5 A;  5EZY A;  3CCE F;  2PHN A;  2AIF A;  3ESJ A;  3HKB A;  1KD1 H;  3D00 A;  5HY2 A;  2F9Z C;  1M90 H;  2IQQ A;  4O4I A;  2BO1 A;  5GON A;  1YQN A;  3G4S F;  2LBW A;  4LNU B;  1JFF B;  5IJ0 A;  1PF5 A;  3HKC A;  2HQS C;  1W41 A;  4YJ3 A;  1RLG A;  2WAL A;  3N4Z A;  4I55 B;  1W58 1;  2IAF A;  1VQ8 F;  3CCU F;  1FFX A;  3CCR F;  2BTO A;  5HY0 A;  4C8I A;  3HKE B;  1VQV A;  5DCV A;  5LP6 B;  1W59 A;  3QUW A;  4O2A A;  5IT9 M;  3DC2 A;  1XRG A;  5MN4 A;  1CK2 A;  3N4Y A;  4O4J A;  5IYZ B;  3JAT B;  1X7P A;  2V9Y A;  1YJW F;  4X3M A;  2HP0 B;  3CCQ F;  2RHJ A;  3F0G A;  4FFB B;  4ZI7 B;  4E6E A;  2OHW A;  2I6D A;  3K2X A;  4ZOL A;  4BVS A;  1YJN F;  1QU9 A;  3J81 M;  2H6L A;  1YIT F;  4DRX B;  3FFM A;  1E7K A;  2AIZ P;  5EAZ A;  5JH7 A;  4B62 A;  5LOV A;  3NVI B;  4F6R B;  3ZP7 A;  4ZHY B;  3CC2 F;  4TV9 A;  5EZY B;  4U3J B;  3WPX A;  1N8R H;  3WGN A;  1VQK F;  3M4S A;  3S06 A;  3MCA B;  3RA5 A;  4B5C A;  4IHJ B;  3S0Y A;  3ELC A;  1W3E X;  5EYP A;  1R1M A;  3I56 F;  2Z1T A;  3RYF A;  3RYH B;  3RYI A;  2KG4 A;  4ZHV A;  3KJK A;  1H7M A;  3CYP B;  3P0Z A;  2OZB A;  1GO1 A;  3VOA A;  5CB4 A;  3L7Q A;  1U43 A;  1UI9 A;  4X1K B;  1XBI A;  3LWQ C;  4X1I A;  3JAS B;  5FJ4 C;  3N2G A;  1IV1 A;  2VAW A;  5BMV B;  3P10 A;  4X20 A;  3HKD B;  2HRU A;  3IKE A;  1W42 A;  4IIJ B;  3OBY A;  1X7O A;  3E1Y A;  1FNJ A;  2CZW A;  4B45 A;  3QHD A;  4BVR A;  1Z5V A;  3F0F A;  2LBX A;  4IHJ A;  3VIU A;  3IEW A;  3EOR A;  3E22 A;  1W5B A;  3B6N A;  3JVH A;  4C4W C;  3JAK B;  3NK6 A;  4ZHW A;  2L26 A;  3VOB A;  2YXZ A;  1OFU A;  2BTU A;  3I3F A;  1JN1 A;  3HAX D;  2H8C A;  1Z5W A;  1SZQ A;  3DDN A;  4TV8 B;  3J80 M;  4BT3 A;  3IR9 A;  3Q8H A;  1NJI H;  2HS3 A;  1K9M H;  5FNV A;  3E22 B;  3NMU C;  4C82 A;  5KX5 A;  1FNK A;  3VO8 A;  4G88 A;  1W5F A;  2VXY A;  2VAP A;  3JAW A;  1JY8 A;  1VQ7 F;  2KGW A;  5CA1 B;  1U3P A;  1FFX B;  2ZVZ A;  3V3T A;  2UZH A;  2B33 A;  3N2G B;  2LBT A;  3MCQ A;  4DXD A;  5HY1 A;  1JD1 A;  1YHQ F;  5B8F A;  4X1K A;  5HP7 A;  3GTZ A;  4IIJ A;  3M1X A;  3C9S A;  3JCM M;  3P4E A;  3NK7 A;  3IKF A;  2Z01 A;  3RYH A;  3RYI B;  3CB2 A;  3SIV A;  3UT5 A;  5EB0 A;  5ITZ A;  3CCM F;  1Q8R A;  3C9T A;  3T80 A;  3V7E A;  4BVT A;  4I4T B;  3WJP A;  1TVK A;  2HX0 A;  4WBN A;  1RQ2 A;  5A2Q M;  5LOV B;  1Q86 H;  1IV3 A;  5LP6 A;  4EI9 A;  2ZOD A;  2EWC A;  1KQS F;  3I55 F;  3HJW C;  1DT9 A;  4YJ2 A;  2IG8 A;  4ERH A;  2ZOV A;  1W40 A; 
#chains in the Genus database with same CATH homology
 3JAM M;  3J7A R;  1M1K H;  1Q82 H;  3CCV F;  1N8R H;  1QVF F;  1VQK F;  3VMF B;  3MCA B;  3RA5 A;  1W3E X;  5HWE A;  1Q7Y H;  3LWO C;  3I56 F;  3ON1 A;  2KG4 A;  4NUT A;  1H7M A;  3CC4 F;  2OZB A;  1GO1 A;  5G4U C;  2HVY D;  2GLZ A;  1VQ6 F;  3CXC F;  3CMA F;  1YI2 F;  1K73 H;  1VQ5 F;  2QI2 A;  3E20 B;  1XBI A;  3LWQ C;  3AGK A;  5HXZ A;  5FJ4 C;  3OW2 F;  3CG6 A;  3O85 A;  3LWP C;  1JJ2 F;  4X3L A;  1RA4 A;  3CPQ A;  1VQM F;  1VQP F;  2VGN A;  1W42 A;  1W2B F;  3CCJ F;  3OBY A;  5EWR A;  1X7O A;  3G6E F;  3RA6 A;  3E1Y A;  1VQO F;  4BVQ A;  2CZW A;  4BY9 D;  4BVR A;  2LBX A;  3SIU A;  5GAP K;  2VGM A;  1ZWZ A;  1YIJ F;  1SDS A;  1VQL F;  4C4W C;  2JNB A;  4LCK A;  3NK6 A;  3WXM B;  3LWV C;  5HXU A;  5HY4 A;  1S72 F;  4NQ3 A;  1GZ0 A;  3CCE F;  1VQ9 F;  2AIF A;  3HAX D;  3CCL F;  1KD1 H;  3D00 A;  3J80 M;  5HY2 A;  3IR9 A;  5GIP C;  3CME F;  1NJI H;  2F9Z C;  1K9M H;  1M90 H;  3PAF A;  2BO1 A;  1CN7 A;  3GYQ A;  1PXW A;  3VI6 A;  2LBW A;  3G4S F;  1YJ9 F;  1GO0 A;  1VQ4 F;  1KC8 H;  2QEX F;  3NMU C;  4XCQ A;  1W41 A;  1RLG A;  2WAL A;  3N4Z A;  4EI7 A;  1VQ8 F;  3CCU F;  1VQ7 F;  2OTJ F;  3CCR F;  3V3T A;  5HY0 A;  5FLX M;  2KTU A;  5G4V C;  4EI8 A;  1T0K B;  3V7Q A;  5HY1 A;  4TZZ A;  5DCV A;  3LWR C;  1YHQ F;  3CC7 F;  1Q81 H;  1K8A H;  2QA4 F;  3CPW F;  1IPA A;  3JCM M;  3NVK E;  5IT9 M;  3CCS F;  1X52 A;  5GIO C;  3NK7 A;  1CK2 A;  1NMU B;  3N4Y A;  5EO3 A;  2ALE A;  1X7P A;  1QVG F;  1YJW F;  2OTL F;  3CC2 F;  4X3M A;  3CCQ F;  3SIV A;  5GIN C;  5GAN K;  2FC3 A;  2OHW A;  4BW0 B;  3CCM F;  2I6D A;  3OBW A;  2FGY A;  1VQN F;  3V7E A;  4BVT A;  2KTV A;  4BVS A;  1YJN F;  3PLA C;  3LFO A;  3CD6 F;  3J81 M;  5A2Q M;  1YIT F;  1Q86 H;  4EI9 A;  3G71 F;  3FFM A;  3I55 F;  1KQS F;  1E7K A;  3HJW C;  1DT9 A;  3NVI B;  1W40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...