2UYKA

Crystal structure of e. coli tdcf with bound serine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
126
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords PROTEIN TDCF
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 126
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uykA00
1JD1A 3VCZA 2B33A 1UFYA 3I3FA 3MQWA 2CHTA 3GTZA 3M1XA 1QD9A 1QU9A 2CSLA 2UYJA 1QAHA 1X25A 2UYNA 3D01A 3ZP4A 2DYYA 2EWCA 3LYBA 3ZOPA 3ZO8A 1ONIA 1UI9A 2CW4A 1FNJA 1XHOA 1DBFA 3K0TA 2CWJA 2UYPA 3KJKA 5HP8A 3R0PA 1COMA 2IG8A 3ZP7A 2CHSA 3V4DA 3K12A 2UYNB 2OTMA 1FNKA 3M4SA 1ODEA 4NWOB 5HP7A 2UYKA 3I7TA 1XRGA 3L7QA 3LMEA 4ZK7A 1PF5A 1NQ3A 3KJJA 3QUWA 2CVLA 1J7HA
chains in the Genus database with same CATH superfamily
5C8YB 3TD4A 4O4JA 5HWEA 4TZZA 3RYIA 1X52A 3D01A 4C8EA 4ZHWA 2ZVZA 3D54A 1TVKA 3HKEA 1VQMF 1JN1A 5LOVA 3KJKA 3JAMM 1H7MA 2NMUA 3RE3A 3V7EA 1IPAA 3K14A 3C9RA 3NVKE 3MCQA 1JY8A 4BY9D 2HVYD 5GONA 3LWVC 1CLIA 4ZK7A 4O4HA 1FFXA 1NQ3A 1KNKA 1N8RH 5DCVA 1X7PA 3IR9A 3QUWA 4M8IA 3S06A 5ITZA 3CCQF 2HP0B 4EI8A 1T0AA 1VK3A 2GVIA 2H8EA 4DRXB 1Q81H 1QAHA 1GO0A 2DYYA 3WJQA 1JFFA 2KTVA 3TD5A 3WGJA 1VQLF 4R40B 2KTUA 4O2BA 3R0PA 4YJ3B 1Q7YH 2CHSA 3VTIC 5IYZA 3M84A 2HS4A 2LBWA 1YHQF 5IT9M 3F6MA 3HKBA 4FFBA 5EYPA 3SIUA 3WGKA 5KMGA 1VQ8F 4TV9A 5HXUA 5EIBD 1M1KH 3NVIB 2LBTA 3WGMA 4TV8A 2Q1YA 3ZOPA 3J81M 3BYQA 4EB6B 1QVFF 1U3PA 2ZF8A 5AVMA 5J2TB 2RHHA 1SDSA 1Q86H 3Q8HA 3K12A 5LP6A 3CG6A 3WGNA 3LWRC 1YJ9F 3CD6F 4B62A 5LXTA 5HY2A 3CCVF 1YJWF 4XCQA 5CA1B 1NJIH 4X1IB 4G4XA 4BT7A 2ZOVA 4X3MA 1GZ0A 4F6RB 3OBWA 5B8FA 1TUBA 5LA6A 3HKCA 3C9UA 4EI7A 4ZI7B 4O4JB 1VQPF 2L26A 1IV2A 1GO1A 4YJ2B 1OAPA 3D00A 3RYIB 3J80M 4B5CA 5KX5A 4BVQA 5A2QM 5JCOC 4C81A 1TVKB 3GYQA 1VQOF 5LOVB 5EZYB 5BMVA 2CVLA 2HRUA 1W42A 3N4YA 4O4IA 1JJ2F 1QD9A 2I6RA 5GONB 1VQNF 4O4HB 1FFXB 5ITZB 2ZAUA 3IEWA 2CZWA 1COMA 2YXZA 1U3LA 3CCJF 3CMAF 2Q1XA 1YI2F 1VH8A 1RLGA 1JFFB 2R6R1 2RHLA 3T80A 4I4TA 1CN7A 1XV2A 3N2KA 3G6EF 2K1SA 3CCEF 4O2BB 3S0HA 5J2UA 1DT9A 4RQOA 3SIVA 5GIPC 3I3FA 2VAWA 1W2BF 4BT6A 5CA0B 3F0FA 3DDNA 1K73H 3HKBB 4FFBB 5EAZA 5EYPB 1QVGF 5CB4A 3K0TA 5KMGB 3V4DA 5EWRA 3TD3A 4TV8B 1E7KA 1VQ9F 1KNJA 4I55A 3RYHA 1IV3A 4E6EA 2F9ZC 3HAXD 3P0ZA 5GAPK 5EB1B 1K9MH 5HXZA 3VCZA 2B33A 5LP6B 3MQWA 2ZVYA 3I56F 3IKEA 3LDTA 2HP3A 5LXTB 2HS3A 5GINC 2EWCA 3LYBA 5GANK 4B45A 2CW4A 1W40A 1KD1H 5HP8A 4ZHQA 3PAFA 3WGLA 3VIUA 2AIFA 2AIZP 5EIBC 3UT5A 3CC2F 2VGNA 2RHJA 4ZOLA 2VXYA 1TUBB 5LA6B 3HKCB 4U3JA 4C4WC 4O2AA 3S0WA 2BTQB 1R1MA 3RYCA 4C82A 4X1YA 5KX5B 5JCOA 3P10A 3ZP4A 2UYNA 5BMVB 2Z01A 1U43A 5MN5A 4O4IB 4KWEA 3FFMA 3JCMM 4C8GA 2V9YA 1W41A 4BT3A 2W8BC 3CMEF 1NMUB 2UYKA 3LMEA 1W55A 3P4EA 1OFUA 2UYJA 2OZBA 4G4VA 2H8CA 3J7AR 1UFYA 5JVDA 2CSLA 4LNUA 4I4TB 4IHJB 3N2KB 3VOAA 2BTUA 3S03A 2P6YA 5J2UB 4WBNB 2Z1TA 4TUYA 1Q8RA 3PLAC 2IQQA 4PWTA 3QHDA 2OHWA 1YQNA 2VAMA 3HJWC 1ODEA 5CB4B 3HKEB 1XRGA 3F0DA 3WPXA 2G9IA 5MN6A 1SA0A 1W5BA 4YJ3A 2CHTA 3M1XA 2HS0A 5EB0A 4I55B 3KE1A 3IMPA 1X25A 4ZHYB 5G4VC 3E22A 3CYPB 3HWUA 3VOBA 1Z5VA 1M90H 5IJ9A 1VQ6F 2LCAA 5JQGA 3JALA 3JAKA 3B6NA 3JAWA 3OW2F 1FNKA 5LYJA 5EO3A 5HY4A 4HNAA 3MBMA 2QI2A 3VYSC 4X20A 3KJJA 2QA4F 2N48A 3UT5B 5JH7A 3MDOA 4ZOLB 5IYZB 4G4ZA 4U3JB 4O2AB 3CC4F 5IJ0A 3G4SF 3I55F 4BT2A 3RYCB 1H48A 3OONA 3VMFB 1VQVA 2HX0A 3EORA 3LFOA 4TV9B 1W5EA 4X1YB 2IG8A 3CXCF 4BVSA 4DXDA 1Q82H 3KIZA 2UYNB 2OTMA 2Z1EA 3GHZA 1Z5WA 1RQ2A 3JVHA 3G71F 3RA5A 3RA6A 3E20B 3S02A 3WPWA 4ZI7A 4X1KA 5G4UC 4YJ2A 1W3EX 3FD6A 1KQSF 1U40A 1YJNF 3N2GA 3OBYA 1XBIA 3VYTC 1VQ7F 1VQ5F 3ZO8A 1ONIA 1UI9A 5EZYA 2UZHA 3JARA 3ELCA 3JASA 4EI9A 3CPWF 2LBXA 3WJRA 5JVDB 2RHOA 3ZP7A 4LNUB 3RYFA 3C9SA 4B46A 1S72F 2KG4A 4IIJA 3HKDA 2GZLA 5FNVA 2MQEA 4U39A 3LWQC 3F0EA 4TUYB 4NUTA 1J7HA 1JD1A 3CCUF 3AGKA 1RA4A 5HY1A 2R751 2Z1UA 3CCLF 3CC7F 2ZODA 4O4LA 3JATA 2VGMA 1W59A 1XHOA 2DT4A 1DBFA 4I50A 1SA0B 1GX1A 1VHAA 3S0YA 2WALA 3CCMF 1YIJF 2BTOA 2FGYA 5C8YA 5CA0A 3N4ZA 3E22B 4C8IA 3K2XA 1VQKF 3L7QA 5IJ9B 5MN4A 5JQGB 3JALB 3JAKB 3JAWB 3E1YA 2I6DA 5LYJB 1QU9A 3FPIA 1W581 1CK2A 3NMUC 4HNAB 2OTJF 3U0OA 3IEQA 4X20B 2CWJA 2UYPA 1H47A 3ERNA 5JH7B 3HTNA 2YYEA 1IV1A 1SZQA 1ZWZA 2HP0A 3C9TA 5IJ0B 3M4SA 4DRXA 4ZHVA 5HP7A 4G4YA 3I7TA 3VO8A 2Z1FA 1PF5A 2HRYA 3O85A 3QTYA 1KC8H 4ERHA 3CB2A 3IKFA 1W57A 2OTLF 3RYHB 2QTPA 4G4WA 2IAFA 1FNJA 3CCRF 4X1KB 1X7OA 4NQ3A 2PHNA 3C8LA 4BT4A 2VAPA 3N2GB 1W5FA 3ON1A 3WJPA 3CPQA 2RB9A 3NK7A 1RQ7A 2JNBA 1YGYA 3FD5A 2QEXF 1YITF 3VYUC 3JARB 3JASB 4BT5A 4LCKA 4ZHQB 3CYQA 3CCSF 3WXMB 5HY0A 4EB6A 3RYFB 4BVRA 5FJ4C 1RLUA 2FC3A 2PMPA 4BW0B 3V3TA 5J2TA 3MCAB 3GTZA 3NK6A 4G88A 4IIJB 3HKDB 5FNVB 5LP6C 1PXWA 3DC2A 4RHAA 4BVTA 2H6LA 1K8AH 1FSZA 1T0KB 3ESJA 3FBAA 4X3LA 5FLXM 5CA1A 1IV4A 3VI6A 4X1IA 1VQ4F 2AMTA 4O4LB 3JATB 3V7QA 3F0GA 2ALEA 4IHJA 2KGWA 4NWOB 2BO1A 1W5AA 4F6RA 4I50B 5GIOC 3KHNA 4WBNA 3LWOC 2HQSC 2GLZA 3LWPC
chains in the Genus database with same CATH topology
1JD1A 3VCZA 2B33A 1UFYA 3I3FA 3MQWA 2CHTA 3GTZA 3M1XA 1QD9A 1QU9A 2CSLA 2UYJA 1QAHA 1X25A 2UYNA 3D01A 3ZP4A 2DYYA 2EWCA 3LYBA 3ZOPA 3ZO8A 1ONIA 1UI9A 2CW4A 1FNJA 1XHOA 1DBFA 3K0TA 2CWJA 2UYPA 3KJKA 5HP8A 3R0PA 1COMA 2IG8A 3ZP7A 2CHSA 3V4DA 3K12A 2UYNB 2OTMA 1FNKA 3M4SA 1ODEA 4NWOB 5HP7A 2UYKA 3I7TA 1XRGA 3L7QA 3LMEA 4ZK7A 1PF5A 1NQ3A 3KJJA 3QUWA 2CVLA 1J7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JD1 A;  3VCZ A;  2B33 A;  1UFY A;  3I3F A;  3MQW A;  2CHT A;  3GTZ A;  3M1X A;  1QD9 A;  1QU9 A;  2CSL A;  2UYJ A;  1QAH A;  1X25 A;  2UYN A;  3D01 A;  3ZP4 A;  2DYY A;  2EWC A;  3LYB A;  3ZOP A;  3ZO8 A;  1ONI A;  1UI9 A;  2CW4 A;  1FNJ A;  1XHO A;  1DBF A;  3K0T A;  2CWJ A;  2UYP A;  3KJK A;  5HP8 A;  3R0P A;  1COM A;  2IG8 A;  3ZP7 A;  2CHS A;  3V4D A;  3K12 A;  2UYN B;  2OTM A;  1FNK A;  3M4S A;  1ODE A;  4NWO B;  5HP7 A;  2UYK A;  3I7T A;  1XRG A;  3L7Q A;  3LME A;  4ZK7 A;  1PF5 A;  1NQ3 A;  3KJJ A;  3QUW A;  2CVL A;  1J7H A; 
#chains in the Genus database with same CATH topology
 5C8Y B;  3TD4 A;  4O4J A;  5HWE A;  4TZZ A;  3RYI A;  1X52 A;  3D01 A;  4C8E A;  4ZHW A;  2ZVZ A;  3D54 A;  1TVK A;  3HKE A;  1VQM F;  1JN1 A;  5LOV A;  3KJK A;  3JAM M;  1H7M A;  2NMU A;  3RE3 A;  3V7E A;  1IPA A;  3K14 A;  3C9R A;  3NVK E;  3MCQ A;  1JY8 A;  4BY9 D;  2HVY D;  5GON A;  3LWV C;  1CLI A;  4ZK7 A;  4O4H A;  1FFX A;  1NQ3 A;  1KNK A;  1N8R H;  5DCV A;  1X7P A;  3IR9 A;  3QUW A;  4M8I A;  3S06 A;  5ITZ A;  3CCQ F;  2HP0 B;  4EI8 A;  1T0A A;  1VK3 A;  2GVI A;  2H8E A;  4DRX B;  1Q81 H;  1QAH A;  1GO0 A;  2DYY A;  3WJQ A;  1JFF A;  2KTV A;  3TD5 A;  3WGJ A;  1VQL F;  4R40 B;  2KTU A;  4O2B A;  3R0P A;  4YJ3 B;  1Q7Y H;  2CHS A;  3VTI C;  5IYZ A;  3M84 A;  2HS4 A;  2LBW A;  1YHQ F;  5IT9 M;  3F6M A;  3HKB A;  4FFB A;  5EYP A;  3SIU A;  3WGK A;  5KMG A;  1VQ8 F;  4TV9 A;  5HXU A;  5EIB D;  1M1K H;  3NVI B;  2LBT A;  3WGM A;  4TV8 A;  2Q1Y A;  3ZOP A;  3J81 M;  3BYQ A;  4EB6 B;  1QVF F;  1U3P A;  2ZF8 A;  5AVM A;  5J2T B;  2RHH A;  1SDS A;  1Q86 H;  3Q8H A;  3K12 A;  5LP6 A;  3CG6 A;  3WGN A;  3LWR C;  1YJ9 F;  3CD6 F;  4B62 A;  5LXT A;  5HY2 A;  3CCV F;  1YJW F;  4XCQ A;  5CA1 B;  1NJI H;  4X1I B;  4G4X A;  4BT7 A;  2ZOV A;  4X3M A;  1GZ0 A;  4F6R B;  3OBW A;  5B8F A;  1TUB A;  5LA6 A;  3HKC A;  3C9U A;  4EI7 A;  4ZI7 B;  4O4J B;  1VQP F;  2L26 A;  1IV2 A;  1GO1 A;  4YJ2 B;  1OAP A;  3D00 A;  3RYI B;  3J80 M;  4B5C A;  5KX5 A;  4BVQ A;  5A2Q M;  5JCO C;  4C81 A;  1TVK B;  3GYQ A;  1VQO F;  5LOV B;  5EZY B;  5BMV A;  2CVL A;  2HRU A;  1W42 A;  3N4Y A;  4O4I A;  1JJ2 F;  1QD9 A;  2I6R A;  5GON B;  1VQN F;  4O4H B;  1FFX B;  5ITZ B;  2ZAU A;  3IEW A;  2CZW A;  1COM A;  2YXZ A;  1U3L A;  3CCJ F;  3CMA F;  2Q1X A;  1YI2 F;  1VH8 A;  1RLG A;  1JFF B;  2R6R 1;  2RHL A;  3T80 A;  4I4T A;  1CN7 A;  1XV2 A;  3N2K A;  3G6E F;  2K1S A;  3CCE F;  4O2B B;  3S0H A;  5J2U A;  1DT9 A;  4RQO A;  3SIV A;  5GIP C;  3I3F A;  2VAW A;  1W2B F;  4BT6 A;  5CA0 B;  3F0F A;  3DDN A;  1K73 H;  3HKB B;  4FFB B;  5EAZ A;  5EYP B;  1QVG F;  5CB4 A;  3K0T A;  5KMG B;  3V4D A;  5EWR A;  3TD3 A;  4TV8 B;  1E7K A;  1VQ9 F;  1KNJ A;  4I55 A;  3RYH A;  1IV3 A;  4E6E A;  2F9Z C;  3HAX D;  3P0Z A;  5GAP K;  5EB1 B;  1K9M H;  5HXZ A;  3VCZ A;  2B33 A;  5LP6 B;  3MQW A;  2ZVY A;  3I56 F;  3IKE A;  3LDT A;  2HP3 A;  5LXT B;  2HS3 A;  5GIN C;  2EWC A;  3LYB A;  5GAN K;  4B45 A;  2CW4 A;  1W40 A;  1KD1 H;  5HP8 A;  4ZHQ A;  3PAF A;  3WGL A;  3VIU A;  2AIF A;  2AIZ P;  5EIB C;  3UT5 A;  3CC2 F;  2VGN A;  2RHJ A;  4ZOL A;  2VXY A;  1TUB B;  5LA6 B;  3HKC B;  4U3J A;  4C4W C;  4O2A A;  3S0W A;  2BTQ B;  1R1M A;  3RYC A;  4C82 A;  4X1Y A;  5KX5 B;  5JCO A;  3P10 A;  3ZP4 A;  2UYN A;  5BMV B;  2Z01 A;  1U43 A;  5MN5 A;  4O4I B;  4KWE A;  3FFM A;  3JCM M;  4C8G A;  2V9Y A;  1W41 A;  4BT3 A;  2W8B C;  3CME F;  1NMU B;  2UYK A;  3LME A;  1W55 A;  3P4E A;  1OFU A;  2UYJ A;  2OZB A;  4G4V A;  2H8C A;  3J7A R;  1UFY A;  5JVD A;  2CSL A;  4LNU A;  4I4T B;  4IHJ B;  3N2K B;  3VOA A;  2BTU A;  3S03 A;  2P6Y A;  5J2U B;  4WBN B;  2Z1T A;  4TUY A;  1Q8R A;  3PLA C;  2IQQ A;  4PWT A;  3QHD A;  2OHW A;  1YQN A;  2VAM A;  3HJW C;  1ODE A;  5CB4 B;  3HKE B;  1XRG A;  3F0D A;  3WPX A;  2G9I A;  5MN6 A;  1SA0 A;  1W5B A;  4YJ3 A;  2CHT A;  3M1X A;  2HS0 A;  5EB0 A;  4I55 B;  3KE1 A;  3IMP A;  1X25 A;  4ZHY B;  5G4V C;  3E22 A;  3CYP B;  3HWU A;  3VOB A;  1Z5V A;  1M90 H;  5IJ9 A;  1VQ6 F;  2LCA A;  5JQG A;  3JAL A;  3JAK A;  3B6N A;  3JAW A;  3OW2 F;  1FNK A;  5LYJ A;  5EO3 A;  5HY4 A;  4HNA A;  3MBM A;  2QI2 A;  3VYS C;  4X20 A;  3KJJ A;  2QA4 F;  2N48 A;  3UT5 B;  5JH7 A;  3MDO A;  4ZOL B;  5IYZ B;  4G4Z A;  4U3J B;  4O2A B;  3CC4 F;  5IJ0 A;  3G4S F;  3I55 F;  4BT2 A;  3RYC B;  1H48 A;  3OON A;  3VMF B;  1VQV A;  2HX0 A;  3EOR A;  3LFO A;  4TV9 B;  1W5E A;  4X1Y B;  2IG8 A;  3CXC F;  4BVS A;  4DXD A;  1Q82 H;  3KIZ A;  2UYN B;  2OTM A;  2Z1E A;  3GHZ A;  1Z5W A;  1RQ2 A;  3JVH A;  3G71 F;  3RA5 A;  3RA6 A;  3E20 B;  3S02 A;  3WPW A;  4ZI7 A;  4X1K A;  5G4U C;  4YJ2 A;  1W3E X;  3FD6 A;  1KQS F;  1U40 A;  1YJN F;  3N2G A;  3OBY A;  1XBI A;  3VYT C;  1VQ7 F;  1VQ5 F;  3ZO8 A;  1ONI A;  1UI9 A;  5EZY A;  2UZH A;  3JAR A;  3ELC A;  3JAS A;  4EI9 A;  3CPW F;  2LBX A;  3WJR A;  5JVD B;  2RHO A;  3ZP7 A;  4LNU B;  3RYF A;  3C9S A;  4B46 A;  1S72 F;  2KG4 A;  4IIJ A;  3HKD A;  2GZL A;  5FNV A;  2MQE A;  4U39 A;  3LWQ C;  3F0E A;  4TUY B;  4NUT A;  1J7H A;  1JD1 A;  3CCU F;  3AGK A;  1RA4 A;  5HY1 A;  2R75 1;  2Z1U A;  3CCL F;  3CC7 F;  2ZOD A;  4O4L A;  3JAT A;  2VGM A;  1W59 A;  1XHO A;  2DT4 A;  1DBF A;  4I50 A;  1SA0 B;  1GX1 A;  1VHA A;  3S0Y A;  2WAL A;  3CCM F;  1YIJ F;  2BTO A;  2FGY A;  5C8Y A;  5CA0 A;  3N4Z A;  3E22 B;  4C8I A;  3K2X A;  1VQK F;  3L7Q A;  5IJ9 B;  5MN4 A;  5JQG B;  3JAL B;  3JAK B;  3JAW B;  3E1Y A;  2I6D A;  5LYJ B;  1QU9 A;  3FPI A;  1W58 1;  1CK2 A;  3NMU C;  4HNA B;  2OTJ F;  3U0O A;  3IEQ A;  4X20 B;  2CWJ A;  2UYP A;  1H47 A;  3ERN A;  5JH7 B;  3HTN A;  2YYE A;  1IV1 A;  1SZQ A;  1ZWZ A;  2HP0 A;  3C9T A;  5IJ0 B;  3M4S A;  4DRX A;  4ZHV A;  5HP7 A;  4G4Y A;  3I7T A;  3VO8 A;  2Z1F A;  1PF5 A;  2HRY A;  3O85 A;  3QTY A;  1KC8 H;  4ERH A;  3CB2 A;  3IKF A;  1W57 A;  2OTL F;  3RYH B;  2QTP A;  4G4W A;  2IAF A;  1FNJ A;  3CCR F;  4X1K B;  1X7O A;  4NQ3 A;  2PHN A;  3C8L A;  4BT4 A;  2VAP A;  3N2G B;  1W5F A;  3ON1 A;  3WJP A;  3CPQ A;  2RB9 A;  3NK7 A;  1RQ7 A;  2JNB A;  1YGY A;  3FD5 A;  2QEX F;  1YIT F;  3VYU C;  3JAR B;  3JAS B;  4BT5 A;  4LCK A;  4ZHQ B;  3CYQ A;  3CCS F;  3WXM B;  5HY0 A;  4EB6 A;  3RYF B;  4BVR A;  5FJ4 C;  1RLU A;  2FC3 A;  2PMP A;  4BW0 B;  3V3T A;  5J2T A;  3MCA B;  3GTZ A;  3NK6 A;  4G88 A;  4IIJ B;  3HKD B;  5FNV B;  5LP6 C;  1PXW A;  3DC2 A;  4RHA A;  4BVT A;  2H6L A;  1K8A H;  1FSZ A;  1T0K B;  3ESJ A;  3FBA A;  4X3L A;  5FLX M;  5CA1 A;  1IV4 A;  3VI6 A;  4X1I A;  1VQ4 F;  2AMT A;  4O4L B;  3JAT B;  3V7Q A;  3F0G A;  2ALE A;  4IHJ A;  2KGW A;  4NWO B;  2BO1 A;  1W5A A;  4F6R A;  4I50 B;  5GIO C;  3KHN A;  4WBN A;  3LWO C;  2HQS C;  2GLZ A;  3LWP C; 
#chains in the Genus database with same CATH homology
 1JD1 A;  3VCZ A;  2B33 A;  1UFY A;  3I3F A;  3MQW A;  2CHT A;  3GTZ A;  3M1X A;  1QD9 A;  1QU9 A;  2CSL A;  2UYJ A;  1QAH A;  1X25 A;  2UYN A;  3D01 A;  3ZP4 A;  2DYY A;  2EWC A;  3LYB A;  3ZOP A;  3ZO8 A;  1ONI A;  1UI9 A;  2CW4 A;  1FNJ A;  1XHO A;  1DBF A;  3K0T A;  2CWJ A;  2UYP A;  3KJK A;  5HP8 A;  3R0P A;  1COM A;  2IG8 A;  3ZP7 A;  2CHS A;  3V4D A;  3K12 A;  2UYN B;  2OTM A;  1FNK A;  3M4S A;  1ODE A;  4NWO B;  5HP7 A;  2UYK A;  3I7T A;  1XRG A;  3L7Q A;  3LME A;  4ZK7 A;  1PF5 A;  1NQ3 A;  3KJJ A;  3QUW A;  2CVL A;  1J7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...