5EIBD

Crystal structure of cpap pn2-3 c-terminal loop-helix in complex with darpin-tubulin
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
430
structure length
430
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Molecular basis for CPAP-tubulin interaction in controlling centriolar and ciliary length
pubmed doi rcsb
source organism Synthetic construct
total genus 175
structure length 430
sequence length 430
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
D PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5eibD03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5eibD02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5eibD01
3JASB 1FSZA 3WGNA 3VOAA 3HKEA 4X1IB 3RYIA 5CB4A 1OFUA 1JFFB 4EI7A 1TVKA 5JCOA 5LP6A 4YJ3A 3WGJA 3V3TA 5IJ0A 3CB2A 3UT5A 5JH7A 5MN5A 3N2GA 4X20A 4ZHQA 4EB6A 3R4VA 4F6RB 3HKCB 2BTQA 5KMGB 5EIBC 3WGKA 4O2AB 3ZBPA 5JCOC 3JAWA 5LP6C 3VO9A 4ZI7A 3E22B 2R6R1 1SA0A 1Z5WA 2BTOA 4O4HB 4TUYA 4TV9A 4TV8B 3N2KB 3HKBA 5CA0A 5JQGA 1W5EA 5IJ9A 2XKBA 3M8KA 4O4IA 4O4LB 4O2BB 5J2TB 5GONA 5C8YA 1FFXA 4FFBB 4O4JA 5LOVA 5JVDA 3RYHB 4DRXB 4XCQA 4I4TB 3JALA 3HKDB 3RYFB 4X1IA 1RQ7A 2VAMA 5LYJB 4IIJA 2Q1YA 1W59A 3RYCB 4IHJB 2VAPA 4YJ2B 3JAKB 2RHHA 4EI9A 4M8IA 2VAWA 2RHOA 3ZBQA 4HNAB 5EYPB 5KX5A 5ITZB 4WBNA 5IYZB 5MN4A 4LNUB 4ZOLB 4U3JB 3E22A 4X1KA 3JATA 4O4HA 3WGMA 5J2UB 5LA6B 1TVKB 1W581 5M7EA 3VPAA 5EZYB 5FNVB 5CA1B 4I55A 3UT5B 4KWEA 1Z5VA 3N2GB 4X20B 4ZHQB 5BMVB 3C8LA 4FFBA 3JASA 4X1YB 3RYHA 4DRXA 3JAWB 2RHLA 4I4TA 4EI8A 1SA0B 1JFFA 4TV9B 5LXTB 3HKDA 1RQ2A 3RYFA 4HNAA 1W5AA 5MN6A 4O4IB 2RHJA 3VOBA 1TUBB 5LYJA 2Q1XA 5GONB 4F6RA 3HKCA 3RYCA 4I50B 3JARB 5KMGA 4O2AA 4YJ2A 1FFXB 3RB8A 4DXDA 4B46A 5EYPA 5ITZA 3HKEB 3JALB 4U3JA 4ZOLA 3RYIB 4TV8A 5CB4B 3VO8A 3N2KA 5LP6B 4YJ3B 4O4LA 4O2BA 5LA6A 5IJ0B 5J2UA 5J2TA 5JH7B 4IIJB 4EB6B 5EZYA 5FNVA 5CA1A 2BTQB 3WGLA 1RLUA 4B45A 1W5FA 5EIBD 5BMVA 5KX5B 4ZI7B 4X1YA 4WBNB 1W5BA 4TUYB 5JQGB 3HKBB 5CA0B 4X1KB 3JATB 5IJ9B 5LXTA 4U39A 4IHJA 2VXYA 5C8YB 1TUBA 4I55B 2R751 5LOVB 3JAKA 4O4JB 2GVIA 5JVDB 3ZIDA 4I50A 3JARA 4E6EA 5IYZA 3M89A 2XKAA 4LNUA
chains in the Genus database with same CATH superfamily
1VCMA 3RUEA 1AKEA 4IIEA 4MARA 4AI8A 2WNIA 1YB1A 5GPBA 3KL2A 4JZGA 2AFVA 4LH6A 5CH8A 1RZRA 2XLCA 2QP9X 5IH7A 4I9NA 2WK1A 2ZR7A 3VAZA 4LMAA 4HN4B 5EKTA 4HX5A 3HCCA 3E35A 4D9IA 4PDVA 2J07A 2DWQA 421PA 1TUEB 4WBNA 1L9XA 3U3KA 1FSGA 3D3WA 1MFZA 1ZCJA 1E20A 3QVWA 5JAMA 3PXEA 5TQ0B 4YRLA 1ELOA 3GJ0A 3APOA 4QFDA 3TQCA 3EHEA 5BORA 1NR5A 2GWHA 3WPWA 4W8GA 1X9IA 1FS4A 2V0GA 1JDTA 3DFMA 4OQ4A 3SHQA 1VF5B 1Q0QA 1Y5IA 3C3MA 2ZZKA 4DA6A 4YACA 3ECAA 2GB4A 4KW7A 5IJ9B 1XXHB 2O2YA 2OFOA 4E22A 4L9RA 3KYDA 3RJ9A 2YMQA 2P8SA 3ZBPA 5C1PA 4ZI7A 1JD1A 1ADJA 3PEYA 4RHXA 5IEBA 1FTYA 3KR2A 7MHTA 3R3VA 3CS3A 2M6LA 3CWBH 5LZ5A 5AHOA 4C06A 3COVA 3OLYA 3L9WA 4MR8A 2RI6A 3ST7A 4KE9A 3K6SA 1G38A 1CZLA 1CBUA 2OM6A 2JEUA 3OCYA 1ZR4A 1ECCA 2MDTA 1DOHA 4QU0A 3RVJA 1T0JB 1K33A 4JL8A 2PUGA 1IHYA 3TKLA 2JK0A 3IKMB 3WLTA 2XQGA 2Z8YM 1F38A 1O0BA 1YQDA 2PBFA 3OQ6A 3DKVA 3AGPA 2XNHA 2J5XA 4N8EA 3TZCA 4NZ9A 1R10A 3RSQA 1JN0A 4Z6KA 2OO3A 1SXJE 3VQTA 3MJSA 2VT3A 3CIOA 3HWX1 4B3JA 3HO6A 4OMFG 1OE0A 2ATIA 3DFZA 3LT5A 4D56A 2NV2B 3Q7TA 4ZANA 5CCEA 3MYYA 4UBNA 1HTWA 3LGSA 2ZTLA 1Z88A 1J1ZA 1GZ6A 1UPAA 2HB6A 4KVGA 2NG1A 3FD5A 2COKA 4G0WA 4G8JA 3V4FA 2FPXA 2YJ6A 2W8BB 4YCBA 1AU9A 1BMFA 1UBMS 3U1VA 4FE4A 4H17A 2OO5A 1T5DX 1K66A 5JVDA 3DBLB 4BJ5A 5DBGA 4XCQA 4CM8B 3TZHA 4DCGA 4PPQA 4OH7A 4KRXA 3LDHA 5BWNA 4ND8B 2N1BA 1IB0A 1XBTA 5K8VA 3OIYA 2YJGA 3NJ4A 2FFQA 4KR9A 1M83A 1KP3A 3EOZA 2XZPA 1YVUA 4D46A 3PLAE 1JZSA 3K8OE 3V1KA 3A2MA 3ZQJA 1R9GA 4YJ2F 4JLMA 4JUDX 3COSA 4MPJA 2HIAA 3X3HA 1N0HA 1U2GA 1RA4A 4BVSA 5FNVA 1OREA 4L7QA 1DO8A 1HZJA 2G04A 4X1YA 3W2HA 5B1BC 1TT5B 2DC1A 1ZUNB 2XF8A 4L3VA 3W3AD 1UAGA 1V1MB 1W7AA 4B3CA 3RTBA 1SZCA 3UA3A 2G7ZA 4IG4A 4IIHA 1QG4A 4CEHA 3LQFA 3B13B 2W6ZA 5BR4A 1F6DA 3F7YC 5L7WA 1SC1A 5JWRA 4A6EA 1FU4A 1P1HA 4MPDA 4QU5A 5CXSA 1FP7A 2AZXA 2WPDG 2I91A 4DLNA 2GFIA 5HM8A 1IZ9A 3TSYA 4YLYA 4LSZA 1JP7A 1T8WA 4BLWA 2BJHA 1GMGA 3MJEA 3AUFA 3E3LA 3CISA 3EBLA 1NLMA 4QYTA 3IUBA 1TU3A 3UUEA 3GT4A 2QU8A 1U3WA 3ZHCA 2XX3A 4EIWA 5G40A 2QJ1A 2Z98A 1MDFA 1YR9A 4HBNA 2WF8A 1ISPA 5B3AA 2FN3A 5HG0A 2WTAA 3AERA 1M7GA 1MD9A 4QXAA 1RU3A 2ZYDA 4TXNA 3QE4A 4JP8A 4X3OA 2XASA 3SYMA 1D09A 5TPWA 1PL4A 3Q3VA 4XYLA 4J9UE 3ZWVA 2VDWA 3GLTA 4EUKA 1M74A 3VOAA 4I9GA 1I4OA 2P2CA 1U4SA 3CSUA 1R0RE 5G02A 5GWXA 4CNQA 3QUAA 3O4FA 3RGWS 2HA6A 3KJJA 1II0A 4F7DA 4MMXB 1OI4A 1M76A 1WDWB 4IDOA 2IUUA 3RFCA 2P4EA 1W41A 2AQIA 3ESCA 4B85A 4M55A 3I42A 1YIAA 4CLEA 1L2TA 1LPBB 4BWAA 3Q3GE 3CX7A 2Q1UA 2DECA 1KNQA 4PHZA 3R0PA 4ZA2A 1NIPA 3DLHA 1KE1A 3MZ0A 4WLVA 3WGYA 1Z5PA 2PLWA 2G38A 1JR3A 5G0UA 3FWYA 1GQ2A 1VKNA 2BR3A 2YQ4A 3QKRB 3PXGA 4F5WA 3DE7X 3IMEA 3NYIA 1GA1A 2WZQA 1C3XA 1U3LA 4J0GA 4DM3A 1O97D 4IIXA 4IGKA 4IGAA 1O6CA 2HWWA 3T1HB 1U5BA 2PBZA 2IW3A 1Q8RA 4ZQEA 1GTZA 3KK0A 1O94D 2DPXA 1GNLA 2WW8A 2ZRFA 5I51A 3G6EV 4HADA 4KL8S 4YRRA 1IHDA 3T9EA 4B76A 3DZBA 1SVKA 4EI9A 3LG2A 5F35A 3WQQA 1GN6A 3A8TA 5C46F 2ZGVA 4NG5A 5CLIA 2H2AA 5AJHA 2YYEA 1YMQA 1WSWA 4UM7A 4RBNA 4CG1A 3MLBA 1I1HA 1F7VA 4MTOA 1Q84A 3FMFA 4M0DA 1LBQA 1Z37A 3UGQA 1R4NB 3ENWA 2WLNA 1XMPA 1CJKC 1RP1A 2FW1A 1IH8A 4L4ZA 8OHMA 3C70A 4D9GA 3GEPA 3F3MA 1QNLA 2IU3A 3KCXA 2IC5A 3HP1A 2JGDA 1UWLA 2B5OA 2H1VA 1MC1A 3ZJUA 2UZ3A 5SYNA 3F8SA 4DNQA 4EO7A 3KBOA 3LXUX 4FLMA 1O87A 4DCCA 2V6GA 4CUZA 2XNDG 4OFXA 1XJCA 2VP4A 4XQEA 4BLTA 1M93A 4E2ZA 4HAMA 2QP4A 3B53X 4GZ6A 3I92A 3K94A 2JIOA 1HNXB 2PYLA 1QH8B 4KE6A 2X4LA 4LKOA 4J0EA 3MM4A 2EJ7A 1UXOA 3WWZA 5A4JA 3O8OB 5GJVC 1WZCA 2FHSA 4N01A 4CGZA 4GR5A 1XV5A 5GGYA 1BEEA 5F12A 2A88A 2EWVA 2GF2A 1II8A 1TVEA 3OUZA 3OFVA 3V6MA 4BUJA 2RHJA 2XHEA 3U3XA 1DC8A 3IUSA 3PQCA 1ONBA 1HFEL 2IYFA 2C5HA 1M1UA 2Q0XA 3EF3A 4KBGA 1AQIA 3GHHA 4FCCA 4A8JB 4ER3A 3ZDBA 5FTMA 1ZS9A 3BMNB 2F66C 4BECA 2VYNA 4TLEA 2Y77A 2BBWA 3TSCA 1S5LZ 2PGNA 1UL1X 3F6EX 3PWSA 1EB8A 1CX9B 1VI2A 3AG5A 1ZGCA 1UM9A 1EINA 4FPPA 5DTRA 2ZVPX 4K8ZA 5EL0A 4RD0A 2G9IA 2GFQA 3MUNA 4JV5B 4CV1A 3ZNOA 1XZQA 1MQAA 2J0EA 1JQ3A 1KETA 1EWRA 1GTL1 4EENA 2CHEA 3JXEA 1U9JA 2PS3A 3SD7A 4B3GA 4D80A 5KOJB 3CZ9A 1R6UA 4DZZA 1Y76B 2ECFA 1C1XB 3DC7A 3SIVA 4UW9A 1YE5A 8GPBA 1MMFB 1Z33A 3PR3A 1HM5A 1J6UA 3JRNA 5LB4A 4FYKA 3KG2A 2WVHA 3GO4A 1WD5A 3OX1A 2IDKA 3ZBHA 1C3OA 1KJYA 3RC7A 1ZGZA 4C7UA 4MW2A 5CFOA 1D6SA 1RLJA 4XCXA 3KZKA 4IFEA 4C0WA 3ZS9A 3ASVA 2ST1A 2AJCA 1IBRA 2ZJYA 1OLSA 1IM5A 1U1IA 4DR2B 3FOFC 3SC2A 4U7DA 4NUTA 1DIOB 4NAHA 4QRHA 4HNVA 3TLEA 3G8BA 3G6EF 3LCJA 1QH1B 4UVAA 5LP6A 4YFYA 3QZUA 4ZO6A 4GI1A 4X71A 3TZLA 1SC6A 1IU9A 1Z5WA 2V7QG 2Z2ZA 3AEUB 3UBTA 1KECA 4QL3A 3FRJA 1EJ2A 1VP7A 5HVNA 2LXNA 1MC8A 2GJKA 2QTOA 5C5IA 1LRKA 1XBLA 1U2RA 5B3JC 1Q7CA 1Z4OA 4YK7A 4MUBA 3C24A 1NJIH 1NQWA 2O05A 3N6XA 3SP1A 4CEIB 2YFYA 5JSQA 3SPXA 1IC6A 3KYIB 2A06H 2EJRA 1BJRE 4S1PA 5MFPA 4M0UA 3VR4A 4IOJA 1SXIA 4HDQB 5BSVA 3ODPA 1NP6A 2ZW9A 4XAQA 4HZ3A 5J2UA 2O8CA 4F2PA 3C6ZA 1Z4JA 4WZ6A 3SC3A 2EATA 2COUA 3W0LB 2GVIA 1BGWA 2C2MA 4BLQA 3NWOA 2Q7GA 3B8NA 1F0YA 2HF9A 3QBJA 2W98A 4IJKA 2Q2QA 1OYVA 3ANYB 1ML4A 1D8TA 1V55C 3I1FA 4GZLA 3B78A 1YL6A 5TMPA 3B6MA 2R66A 3ENZA 2Q8VA 1X7YB 1V6SA 3D3NA 4TKMA 4UCQA 2PV0A 3AKDA 3ABKC 4M8NE 3LIIA 4ND3A 3VPSA 1EUCA 3FG9A 2F95B 5B7QA 1S8NA 1YU9A 2ZVQX 2BE3A 4J7ZA 2P5SA 4UCVA 4R1MA 3W05A 1KBOA 1W5BA 4CMHA 4DV2O 1F2UB 2ONKA 2YOFA 2Q28A 2AC4A 3QNEA 1CU1A 3O38A 1EUDB 2AYZA 2FGKA 1F8XA 4RD4A 4FMCB 2JATA 5B1IA 2VTEA 1FXKB 1NX6A 3VX4A 4UCXA 3F5FA 4WCVA 4YIHA 2WSIA 5A0TA 1E1QA 1N3BA 2BOBC 2RGXA 1VCOA 5I9LA 1OU0A 2QAGB 3HRHA 1O9BA 1ZVMA 2FJ0A 1HT0A 4GX2A 1GD1O 2HREA 2RMKA 3PR2B 4ZXPA 3WK4A 1ZIOA 1T8RA 2A57A 3UEOA 1KZGB 3RIXA 2WOJA 3F6SA 1MDBA 5EZ6B 1KKUA 3E18A 2RHDA 2X41A 4GXTA 2VIIA 4FYIA 2VLIA 2F55A 2XADA 4UATA 3GJYA 4X65O 3JQ8A 4K2HA 2VHQA 3GTZA 4X64O 5EJGA 4RHUA 3HXLA 1KMIZ 4TS9A 3A3PA 5FQNA 1XCJA 2R1TB 1NC3A 3KQPA 4IUBS 4K9QA 4JJIA 4UUBA 2Z0MA 2XQIA 1TUEA 2PSHA 3FB1A 3BYZA 1H2KA 1FD9A 2C9BA 2NAPA 3MTAA 3H9QA 3OZRA 2BGRA 4H35A 2B8NA 1ZI9A 3VSDA 1TCUA 1A1SA 4ESHA 5C8YA 2VSOA 4HDSB 5JAZA 3ZRVA 4RK5A 1ZI8A 4WLNA 3KD3A 4RLHA 5JZOA 1TXGA 2I65A 1OI3A 1XXHA 1CK4A 4MS1B 1WQ3A 4YJGA 3BJIC 2H4HA 3UHFA 4BQFA 3IC5A 2ZVDA 5LCXA 4M86A 3M5CA 2GJSA 3R3YA 4GI3A 1EGVB 3T1NA 2UVQA 2BTEA 2C7VA 2YS7A 3SZRA 4ITUA 2HSWA 4RK1A 3Q6NA 2XCQA 4BY9D 4AJJA 3E5HA 3I5UA 3P9CA 3TR6A 4L72A 3DXRA 4N47A 2ADOA 5ISMA 3DVLA 3C9TA 5FWYB 1VKHA 3MTDA 2AB0A 2HRYA 3DV0B 2PX4A 3SC4A 2QRLA 3TCUA 4JI4O 2GHIA 2QVYX 3RUDA 3ITKA 3TD9A 4FC7A 5IXJA 1YHNA 1T4DA 1KAMA 4J76A 4RU1A 3C3PA 2VDQB 4K9MA 2WPDD 3ZGOA 3IV6A 3M83A 1XI1A 4CQNA 1LQ2A 4DRYA 3QMPA 2ZVYA 2UXDO 1R3KC 4ABTA 2YL2A 4FOOA 2XD9A 3FBAA 1WB7A 3F6MA 1AP5A 5JWHA 1N1DA 1GTSA 1PR6A 2W8BA 3OOHA 3EVBA 2SECE 4AY2A 2NO1A 3TD5A 5K0NA 3G2KA 4F3NA 1WPRA 1ZM3A 5DHUA 3HA2A 2OWEA 2H1SA 2FK8A 1UT5A 4CM8A 1AI7A 1NLFA 1OVMA 2RI0A 3G2HA 3KHKA 2DTEA 4ZWNA 5DHSA 4ADSG 2I6TA 4FW8A 3LX8A 3Q3EA 3BK2A 4DREA 4MYCA 2BR4A 4TMTA 3RSSA 5ETJA 3EN0A 3KWJA 1OXSC 1VQ9V 4HX2A 1OX6A 3HTXA 1XNJA 3GD7A 1US8B 2I7XA 5L3DA 4Q9IA 2JGNA 4ARZB 2BO1A 4D02A 4BJHB 1D1PA 2JIRA 5MN4A 1NUAA 1ZUNA 3E2EA 4BATA 1RZUA 4NZPA 3CSXA 1V1MA 1NZDA 1UC9A 5AXBA 4DYVA 4RACA 4ZQIA 3S1SA 3AVOA 4L16A 3B3JA 5A06A 1RRKA 4ZV4A 2O2HA 2EC5A 3FJOA 4YDHB 2REQB 1GPDG 4UHEA 3K0TA 1MOSA 3LXMA 3ER6A 1ID1A 4EAAA 1EXDA 5D3QA 4DOMA 4NDAA 4WW0A 3ZYZA 4IDFA 2XB9A 3FFXA 2O9JA 1R8QA 3AF2A 3H5IA 3D7MA 2IQ5A 3VR5D 1E99A 3P2MA 1E94E 3AHGA 4N5NA 4NMXB 1NVDA 4CBVA 3SVLA 2PKQO 2QQGA 1SQQH 1KKDA 1DJOA 5HJ5A 2FDRA 5CK4A 2Q1TA 1ZL2A 4PLTA 3ITNA 1UFQA 2H4XA 1WU7A 1KMNA 2DKFA 1R0YA 3R09A 1H2NA 5JJBA 2V1DA 3S55A 5LHHA 1ABFA 1M34E 1IBKO 3IKFA 2EEZA 4AB1A 3R6WA 1RHRA 2ISQA 1NXOA 2EKQA 5JD4A 1VCNA 1EKXA 3N2GB 4IIBA 2ZJ7A 2X2EA 5I45A 1R0XA 4OY3A 2B69A 2Q4DA 3SX4A 1OX4B 3PC6A 5EHZA 1Z7GA 3WWOA 2CXRA 1FXWF 1PZFA 1JHAA 4LTMA 3ROFA 1FLNA 2EKDA 1WABA 4Q7LA 1R6TA 3UXMA 5LMUB 3C85A 3L0BA 5BMVA 3B8EA 3JCMM 5D8DA 1RKQA 5IT0A 1KOFA 3RU2A 3KYCA 5FPKA 2X9LA 3B85A 2YHBA 3P4UA 2ET6A 4CR7A 4H31A 3OD4A 4W5QA 3B1YA 1ZC4A 3ZHUA 3VO9A 3TLJA 1PHRA 2XNDD 1DO2A 5G1PA 4JI0O 2NVUB 5ECGC 5AVMA 1NOIA 4PNPA 5HZKA 2AZ2A 1VHJA 4ENQA 3HKDB 2NSDA 4F5ZA 1CUWA 2RCNA 4LI3X 4ZDKA 3ZCUA 2X7RB 5JC1A 3UHAA 1E3EA 5HSGA 2V4UA 4LJ7A 5A2GA 4CFSA 1GYQA 5IAGA 1N2CB 3S03A 4EGSA 1GKUB 1NVXQ 5CVDA 2RG1A 3HCRA 1IY0A 2XB2A 3O6VA 3I76A 3O84A 4NZNA 1BROA 5C7LO 3K09A 3LXXA 1Q82H 2IJIA 1YGPA 3FWPA 2PGXA 2VC2B 1E63A 3SS7X 1M10A 4P83A 3UJNA 2JJ8A 3ZK7A 1YFZA 3QO5A 1T2DA 2ZIAA 4D42A 3X43A 3HMQA 1N6PA 2VNHA 4XSHA 4U9HS 1QAHA 4IVRA 1VXRA 1VQ9F 5IBRA 4BP1A 1Z8HA 2FUCA 2ZFUA 4MUFA 3NVKI 4QAJA 4RV4A 5FH9A 4MUMA 2DERA 1R8JA 1IWPB 2JRCA 4JLWA 4B7EA 4HNTA 3HVIA 4I0WB 3AQIA 1R4NA 3TL6A 4PV7A 2CJXA 2G5GX 4ZT4A 1MABG 2Q6VA 3OQVA 1PNQA 3CCBA 4X92A 3QELB 4QZVA 3ZGLA 3LQKA 3R4CA 4CTKA 2NZXA 5FWAA 4LXHA 5F3WB 2RKBA 4J91A 4EG0A 5LLTA 1OYYA 3DULA 2BM8A 1VZ2A 3KTAB 1S89A 2NSYA 1PIWA 1ZY2A 3WJ1A 3GH1A 1KEWA 1VQ8F 1JR9A 1UJBA 4CS3A 1QH8A 2OILA 4RETA 1K7SN 4JBHA 4EPTA 3LBIA 4ASUA 2SCUB 1W0KA 1R27A 2D2IA 1CHNA 3O8OA 4Q3AA 5LKRA 3DTUB 1U1EA 2VRWA 3HBNA 1EX1A 1FYJA 1YS1X 5TS3A 4NCJA 2WP0A 3BHJA 1NVVQ 4I3FA 1YTFD 4PCUA 4C4SA 4UTZA 3G3EA 4BJ1A 3FB5C 4NXMO 1AS3A 4RLFA 3D8NA 1MSDA 3TAUA 2SHKA 3GLGB 3LCUA 4YJ3F 5F1KA 1MRNA 2V7QD 1N25A 4WADA 4WFBV 4ECAA 3F71A 2R2AA 5A5GA 4H7EA 4UFOA 2DQ3A 2B83A 3SSAA 4WFFA 2JFOA 1RMQA 2G82A 1N9GB 3L93A 5TGDA 1ZX1A 1MG1A 1EP2B 4KZPA 4QYSA 4HEQA 2DH5A 1VG0B 1UQTA 4R81A 1W2GA 3C8UA 3AP1A 2CNWA 4HB2A 3TNDA 2WU0A 3L7AA 2NZ8A 1EVJA 5JLJA 2IY9A 2X8LA 2XXJA 4D3XA 2M6SA 3FPGA 2FQQA 3OMIB 1GAJA 5I7EA 2I6RA 1UKEA 1KKLA 1OTHA 1CQIB 3NLLA 4GPIB 2DFLA 5AM3A 1Y76A 4KKXB 2OCHA 4Q48A 2XTMA 1C1XA 2ZIOA 3PF8A 1H2WA 1NJ6A 3PS9A 3S5UA 4C7OB 1SCAA 3SHVA 1NMYA 4QC2A 2C5SA 4BX3A 1PFKA 2ZRGA 1O58A 1NXQA 3DNFA 4NF2A 1ZHOA 4BTLA 1L3IA 2P2GA 1MN6A 4B2YA 4L5BA 5K09A 1JJFA 1HDXA 4RY8A 3KD2A 5JW6A 2JJ1A 5KINB 1QH1A 1L5RA 4K05A 4TWJA 4P33A 5I4IA 5FHQA 1JOYA 1BX1A 1BX3A 3QVSA 3VH1A 4AQYB 4LF9B 3UO2A 2YXNA 1ICIA 1O3YA 2PKQP 3ETHA 4C0HA 2V7TA 3AC0A 2IW5A 1E98A 2NTEA 1U7DA 3M5PA 4ZO4A 3MINB 5HPYB 3ITEA 4RVOA 1DFGA 3VVBA 4BB6A 3QY0A 2O4UX 1D7OA 3I9NA 1LS6A 3PUYA 3LY9A 4Q12A 3TINA 4ZIBA 6Q21A 2ZF8A 1IEXA 4WFHA 2JFNA 4ETIA 1FIUA 2HA3A 4AS3A 1EE2A 1NQAO 2MTBA 2Z3VA 1P2BA 4DV7B 3R7NA 3FVTA 2R84A 5EO3A 2C98A 3KYJB 4HMPA 2GCOA 2MSEB 3RWOA 2ZRIA 3KKMA 2FX2A 2GFHA 3OMXA 5J4VA 3FSGA 1F2DA 1TB4A 1V8BA 4E2FA 1QTRA 2X6QA 1FP1D 1W57A 3PGA1 3KPWA 3CUTA 5ERGB 4MWEA 4E4EA 3F8TA 4D3YA 3FDJA 2QM7A 3WKAA 3G0BA 1I2AA 1SVIA 1I08A 1GL6A 3PQ2A 4KN5A 1E0KA 1QANA 5TB5A 3A2KA 2H08A 4R9UC 1X7YA 4PHTA 4ZALA 1G4UR 4EEKA 1V1RB 5K1PA 3CP1A 1C8VB 2OGSA 4DV0B 3LRXA 3MCTA 4AJKA 3FDFA 3OKPA 4N5IX 4BHTA 3VR2A 1KI7A 1WAZA 4F8JA 2HRRA 4PCAA 3H2JA 1D03A 1O97C 4JYMA 3J7TA 3NUGA 1JMVA 1G5RA 1NDHA 1EM8B 2XUOA 1NATA 1XTIA 1Q0SA 4ZOLB 3KV3O 4MYHA 3CBGA 2XD4A 2AYXA 1O94C 3E3AA 1YCDA 2KB1A 1F5SA 4KCGA 4ZU1X 4NTXA 3BRCA 5B37A 1VJCA 4M76B 4ACAA 1Q0RA 1EUDA 4BAYA 4BL5A 1SU6A 3BERA 3B1ZA 5AICA 1Y8RA 1AR5A 1GT91 1V35A 2BCCH 1FXKA 4CF6A 2VDUE 1JLLA 2NNWB 2Z5UA 1FA9A 4JU8A 3QIAA 4FKZA 3NBXX 1S8AA 1T24A 1GAXA 2XB4A 1OCRC 2BRUA 5DGHA 1XLUA 1YCFA 4I55B 4CQLB 4YJDA 1P7GA 1PG5A 3SQLA 1JB9A 2I3ZA 1MX9A 1KL7A 2OAEA 3NDPA 1E3WB 3WL4A 5CLHA 4X61A 4ZTBA 5JJNB 3LHDA 3SR4A 4NAVA 4TKUB 4QULA 3NTUA 3GDHA 1LBIA 2AXQA 2WG1A 4CHTA 1KQFA 2YYZA 4LHXA 4UB8Z 4LOJA 3CUKA 3FAKA 3ZWPA 4F8EA 2QKCA 3SQNA 1IZ8A 1P61B 1ISMA 4B6PA 4I1VA 4EMSA 5IU6A 2R1TA 3ESDA 2XWSA 1P33A 1KYTA 1XTBA 4NONA 4LHVA 1RFLA 4RVSA 2QE6A 2GOYA 1H0SA 3CRNA 4L1KA 4CCWA 3RCBA 3V00A 5K2MA 3NC1C 1W19A 2X2FA 5MFZA 2O6HA 2PKWA 2QTNA 2DSNA 3E3OA 3DWEX 3SYOA 1UFOA 3W8NA 3G89A 1FS0G 4WOBA 4YP6A 3PFKA 3ZD6A 1R5NA 3OOEA 4QXQA 4QXMA 1AKNA 4MS1A 4N6OA 5CA0F 4J49A 1VB3A 3OZSA 1HDJA 2GHQA 3H3JA 5JJJB 4X3LA 3RK0A 3RS9A 5PNTA 1VQMV 3IBFA 2P79A 3ZJTA 5FLEX 3B8HA 2HEPA 5FBRB 4U2CA 5D5HA 3VI4B 5KHAA 1Q86H 2X6BA 2YJ4A 1H5QA 5L3VA 3KZVA 1YBFA 5IW8A 1IXSB 4KDRA 1NJ8A 4FZJA 5JSZB 1Q0HA 5FWYA 1ZAYA 4Q4AB 3QHAA 4KUHA 1G8SA 2BGIA 2VA9A 4ID9A 4XWKA 1AOXA 4YRFA 4YXFA 5LC1A 3OPYB 5KJCA 1I6LA 4IKPA 3FGZA 4Z4CA 4LS3A 1O8CA 3V8NA 1J49A 1FJHA 4IHKA 2AFHB 1J23A 2OQ2A 3J81A 2P27A 3SF8A 1NI5A 4RSRA 1JIIA 1J70A 5DYIA 1QUFA 4TKLA 4CKYA 4TV9F 5JNVA 2MYUA 16PKA 2WB2A 5EP1A 2QSAA 1YITV 4RA6B 1XK7A 1ZMTA 4DR3B 1H5UA 2RAVA 1E9RA 3HDVA 2F8TA 3P7MA 1IV3A 1AGXA 1SK9A 2QLMA 4LF7B 4EI8A 3JQ7A 1LZKA 4YJFB 3DXZA 3NOVA 1JDVA 2CUZA 2XZLA 2BMWA 3RUCA 3H9GA 2QN3A 3C1TA 1OILA 1T8TA 1GGFA 5BV2P 4IIFA 1J95A 1VYVA 4C21A 2O1WA 2Z43A 1VGQA 4LV5B 1US8A 4RZSA 3L6BA 3MWLA 4PAOA 4OHWA 4ARZA 3LA6A 4I50F 4C1BA 1QIJA 2WSLA 2R6FA 5LDGA 3LJKA 1ZYUA 2P3QA 3QI7A 1AA9A 4C05A 1RMTA 3Q2OA 1RI4A 1T5SA 4HVLA 3WG7C 2XITA 3U31A 3IURA 1JXAA 4OYYA 4ZI2A 3NIBA 4F85A 1LJUA 5CBHA 2H16A 3AR6A 3L4BC 2B8WA 3U1BA 1ABBA 1M6VA 3K4PA 3UYLA 2J4FA 3UJHA 5IDQA 4RKWA 5KHGA 2ID7A 3LYHA 1I5OA 3EK2A 2R62A 2GEFA 5CN0A 5B3LA 4JC4A 3E0QA 3G0IA 3WI7A 4LMRA 3JD3A 4HT3B 4MV6A 1GY8A 3HUEA 1JKIA 4QAQA 3FIUA 2R9AA 5DTIA 1L4UA 2N47A 3RFUA 1VHWA 1FZQA 1Z17A 1THMA 3WWEA 2I22A 1LLCA 1T43A 4YFVA 3BRWD 1Q1GA 4IIJB 1WQ1R 3PRYA 4RW0A 3WK9A 1V55B 1Z2NX 1HP8A 3ZXUB 4MOWA 3AGKA 1YZKA 2YXHA 3OQBA 4BBPA 1VQMF 1OZ0A 4MQ5A 2AXTZ 1MAAA 3N2GA 4F97A 4Z1VA 4DGQA 4MYDA 3ABKB 3S2IA 4CIYA 1E8DA 5IZCC 1OLXA 2V5UA 3WYCA 3PX2A 1P9OA 1SUSA 2XI4A 1BCRB 121PA 3VIUA 1FNNA 3BGDA 2PR2A 1ZNXA 1OSNA 2HX0A 3NP9A 2GPBA 3PL5A 4PLFA 5DI9A 5U9CA 2Y48A 2XA2A 1XMQO 4FLYA 4EHAA 3SLGA 1H2RS 1CNEA 3O85A 2WJHA 1NY5A 1IV1A 1QIGA 2XQJA 4ZJZA 4R1SA 1DRWA 1TTQB 2Q73A 1N7JA 4MS3A 2WFLA 1CP2A 4Y1EA 4A10A 5DV9A 5IHPA 3DAPA 2VDRB 1CQZA 2FSFA 4OQXA 1E32A 2JAWA 2RH5A 4UHKA 1YITF 4NBUA 2MIIA 1KU6A 1J9ZA 3DBVO 1OFUA 2RB5A 1JYFA 4MZDA 1VL8A 4JN6B 4W5RA 1O1YA 3WIDA 4UDOA 2HK6A 1N2CA 2NMVA 4F9EA 1HQDA 1S8OA 3BWXA 4FHEA 5ALSA 1CDOA 1OLUB 4JUIA 4NVPA 5C31A 4LDRA 4DVGA 1JQ0A 1X39A 3CVXA 4BBAA 1NQXA 4LK2A 4YCNA 4GH5A 1SWVA 3I34X 2O1XA 2HRQA 3P20A 3HRKA 1W1IA 1IAQA 2VXCA 3NKLA 1JJOA 4FWIB 2PGDA 3K9GA 4WNIA 1U0HC 5AQ1A 3CUYA 3TXAA 1W40A 2PD4A 3WMEA 4EYSA 2R1VA 1ZLXA 1N3IA 1Y81A 4Q4JB 2L42A 1ZN2A 2J9RA 3V9PA 3RVOA 1TYDE 1Q91A 2NV6A 4UPEA 2D7JA 4R50A 4NK4A 3I1YA 2ASEA 3B2QA 4R2MA 3DF7A 1H2BA 4IQ0A 4MB6A 2IOQA 3MPUA 2W2QA 1Q81W 1VXOA 3QELA 1EDDA 1U3FA 2X3YA 4WOPA 4MUYA 5EVCA 4MGKR 5AIAA 2QAIA 4BKPA 4MYUA 2LW7A 2OFWA 4WOKA 4REOA 1SH7A 1UP7A 1QFZA 2ZJ8A 4NX2A 3KTAA 3WYEA 2ZJBA 4AROA 1YJ9V 1QS0A 2RFLA 1FNBA 1DX9A 3D0QA 2I71A 3I12A 5DHTA 1JDNA 3BXEA 3I05A 1UI9A 2PKEA 2XCSB 4ZHVA 1RPAA 4KXMA 1ISRA 4JY7A 1XHOA 3V34A 3NV7A 5DSZA 4OO3A 2CVOA 2JI9A 1X94A 3BOSA 4PYQA 1SFRA 3FMGA 1JJBA 2HLPA 1X15A 1Z35A 2XUMA 2XTAA 3L4KA 2EIKB 1RAIA 1Y9AA 1NI4B 1TK3A 2HLHA 3BULA 2NVBA 3JPWA 3I2JA 3IAUA 3GLGA 4Y2RA 2ZIWB 4UOQA 2QSZA 1KEZA 3SFTA 1G8PA 2HIHA 4W5OA 3FX7A 4ZHQF 3I01A 4DMCA 3TRHA 1EP1B 5JD3A 1A72A 2BTOA 4BGEA 3PXXA 2JVDA 3RG2A 2O8BB 2WJ4A 4ZMSA 4X66O 2KBEA 4BWGA 1C29B 1U8AA 4WK2B 4P5DA 1UPCA 4JB3A 1CQIA 3QF7A 4GMGA 1Y7PA 1MNQA 4QM7A 2F3RA 3IEPA 1VJTA 1L1FA 2AHYA 2QW1A 4PWZA 5E2BA 2XAUA 2W6MA 1BZYA 1TKRA 3FYSA 4CDGA 4WEQA 3DBOB 3VPFA 1KO8A 5FA6A 5DH9A 1USWA 2Q5FA 1NBIA 4R7ZA 1COZA 4FFRA 1KZ1A 2PI4A 4LVNA 4L5IA 2O3TA 3HHEA 1ANKA 4N49A 2E4YA 3CJRA 5J9PC 1TA8A 3B1XA 5LR6A 4ENRA 1F6BA 2AOTB 1NG9A 5JJIA 3RE3A 2VJOA 4A4DA 1P1BA 4IV8A 1K5SA 4R71A 1XHLA 2N3ZA 5DIFA 1Y5RA 1WUHS 1UJWB 1LK5A 4WY5A 4NZMA 3MD0A 2GJ9A 4R5MA 2XTJA 1E59A 1DEOA 2H7CA 3BXGA 4R4JA 2FW0A 3ZCCA 4PHFA 2FCAA 3UFXB 2PKCA 2D5IA 3LW7A 1H2EA 3QTYA 5AW4A 2FY8A 1PL0A 3GGPA 1DG1G 5FCDA 1PT8A 2Z95A 5BOVA 3QEMA 3HXOA 3LX6A 1FFXB 3W9UA 3MTGA 4BVLA 4J7AA 2OUIA 1P7WA 4KFSA 2BIFA 1JS1X 1NA5A 3SJUA 1FUEA 2YIBA 1HTBA 4H15A 3RT7A 1YJ9F 1THTA 1PR4A 2YIMA 1XVIA 2Q99A 2O7QA 4WCFC 1Z15A 3IH5A 4QT4A 1LJ8A 1PR1A 4DN6A 1KYYA 1YAHA 4A92A 1BD3A 4RXTA 4ABMA 3WBJA 2ZDIC 4R8SA 4KUGA 5E7IA 4IOLA 4LJLA 3VNAA 4AF6A 4G0PA 2NXNA 3KOZA 1BEUB 1RYEA 3KE8A 2WE7A 3UGTA 1U43A 4UB6Z 3I62A 4PA4A 3G1TA 3KR1A 1RKXA 1SKYE 2CZCA 2ICAA 1O96B 3WRVA 4DEVA 4N7BA 2BC9A 3PFNA 1F4LA 3URKA 1V1RA 4RTMA 5AI5A 3AIIA 1HE4A 3RF6A 3I6IA 4NESA 3SICE 2JS7A 2L6LA 4PELA 4AURA 3ESYA 3WXMB 1D6MA 3B6ZA 2XWQA 3IEUA 2IS1A 4RH0A 2PYZA 4FWBA 5CJ2A 3EDOA 2OY0A 1ESCA 2QZ9A 1ZONA 2L18A 1UPXA 1C0LA 1GO2A 2GUWA 3LHFA 3HO8A 2FC3A 2O2GA 1OB5A 3CXCU 3RSGA 3IJRA 4JI6O 4CG0A 3VI3B 4L74A 4JBYA 1A5AB 1NW3A 3KJHA 3LUBA 1WTCA 2BFBB 1H3FA 4H59A 4I55A 3GIDA 2IYQA 4MV8A 4CV0A 2YHAA 4E1AA 4CMAA 2ZBUA 3RJZA 1CY8A 3T4EA 1E3WA 1U8UA 2Q8NA 3P4EA 5B5EZ 2AC2A 2RK3A 3C7KA 1UBRS 4TKUA 4KLCA 1E7MA 5AI9A 3SEZA 3OPQA 1G21E 4GHWA 2C00A 4HL6A 4EITA 3K5NA 1U28A 4PCVA 4QDKA 4QQKA 2YRWA 1FK8A 1WW2A 3KVOA 3RW9A 3O2NA 4G09A 1ECJA 1FFDA 4G0UA 4CL8A 4CVNA 3GOQA 4PN7A 5HCIA 1L7OA 821PA 1LDNA 1XEQA 3X2FA 2V4ZA 4ZKEA 5DM4A 3E22B 4GECA 2Z5LA 5F7XA 2WFAA 4JDPA 4TWRA 5EWRA 1JA1A 5KA5A 1THZA 4ZKDA 2HP0B 5GV8A 3LDFA 1I30A 1YCGA 2W83A 2PMPA 1IATA 2IA5A 3AI7A 4J3JA 4A5OA 4PIPA 3T4UA 4E5YA 2IY8A 3BHPA 2WKSA 3ROMA 1ZXLA 3DBHB 4EF6A 3THXA 2QZSA 2DFDA 1KZ6A 3KR9A 2ZWIA 2YDXA 4IJ6A 1PZXA 4FUQA 2CV2A 5JANA 2H2HA 2OCYC 4QBIA 1C8LA 1PAUA 3JALB 1N8SA 2AOUB 4OSPA 1H6CA 1DUIA 1MA1A 3C9UA 1J1IA 3AEYA 4LCKA 3FYDA 3U61B 2V03A 1W5SA 1XQVA 5ALTA 4XWGA 4NE2A 4QYMA 4EH1A 4F72A 1HLDA 3NB0A 5JTTA 5JH7A 1KAHA 4BKRA 4MTGA 1MIOB 3L49A 4BT6A 4ZVRA 3EQ7A 5JSZA 1PHPA 4FFDA 2DZDA 3RVRA 2CJWA 3ND9A 4Q4AA 1GPLA 1IBSA 3SKVA 2C5BA 4CCSA 3ZKWB 3VR0A 1VE6A 4A0FA 4B7XA 1F14A 1NUSA 1MZEA 3SJCC 3G23A 4WACA 4TSFA 2YYSA 4UBMA 5LQCA 1CS0B 3BHNA 3RBXA 2ZR3A 3J81M 4XIJA 2OL4A 2QTAA 3PUIA 2P4KA 2IKSA 4B3MB 4ZT3A 5C4GB 5FR2A 3W6PA 1K7YA 3IOMA 3O8LA 3KXKA 5EINA 2J48A 1C0IA 3I8OA 4ZCSA 5F9MA 4I1SA 1QDUA 3JQAD 4BKMA 2X0EA 2OCXA 4MUKA 4RA6A 3ZE2B 2F17A 1GPBA 3CQ9A 2OYRA 1TJPB 1CEXA 2NTNA 4DO2A 4YIPA 2F1KA 2XNCA 1NBOA 2H18A 4OUDA 2WLHA 3GEEA 4BQEA 3CEMA 3RODA 4FN4A 1KDYA 3AUSA 3D4PA 4Q3EA 2ILMA 3A9VA 3ENKA 1DKMA 4K9SA 1TJNA 1EP3B 2EKBA 5ENZA 4ENVA 4FILA 4RL6A 3EMDA 5FYDA 3Q7EA 4BMXA 2CY0A 4AD8A 1G42A 4IF6A 2F4VB 2HNBA 5JZVA 2G4CA 1Q0ZA 3EZYA 1MJGA 1E18A 1XEXB 2QX8A 1ZL0A 3D02A 4TZ6A 2Q3CA 1JDJA 3CW8X 5A02A 2A5GA 1SQ0A 2IDJA 5AKXA 1KGDA 5EKXA 4JL6A 1MJ5A 1PK9A 3PTLA 5DGDA 4LA4A 1GCAA 4CM6A 3LP8A 3NWBA 1FQJA 2IL1A 1ZWKA 3LNNA 3UYKA 1J8YF 3AK2A 2E4ZA 3QXHA 1FMLA 1EFTA 3K35A 4Y2VA 4XB6B 4QNMA 1N2SA 4EMTA 4R40A 3SYNA 2WIDA 3HCPA 2VQEO 2IDMA 4DSOA 1B7GO 5K99A 4IIJA 2PZEA 1FRVA 2B1JA 3D6MA 4AY5A 3DJFA 4ARSA 1GVHA 1EZVH 4D99A 3STUA 3A0HZ 5FO1A 2XQVA 1AX9A 2NR5A 4M1ZA 1W42A 1IG0A 1QH0A 4GM4A 2E4AA 4Y2JA 4KWTA 2C4VA 3HO1A 2JLXA 4REMA 3IQEA 5J40A 5FL7A 4RVNA 5HY1A 2C9DA 4FNMA 5AESA 1XTRA 1ODFA 4CKWA 4CH3A 4I8IA 2DSTA 2DYSC 2ATKC 1TQ6A 3GVIA 4W1PA 1WMSA 2WU3A 1BCRA 4BNHA 1KNKA 3BAZA 4C89A 1P2TA 3C6YA 1ND5A 1FVOA 4FUTA 3U3OA 1G2OA 1LPSA 2BFFB 4UVEA 3AEZA 1VMEA 3EASA 1X42A 3I39X 2R6AA 3GN1A 4Q00A 4KOAA 3O8CA 2GXSA 4BO0A 3OD5A 1CVLA 4D8WA 3KUKA 2Y8EA 2N04A 1ZZGA 1Q20A 3MNFA 3W8FA 3ZVMA 1ZMXA 4F3CA 3SS8A 5LL6Y 1NN3A 4DIEA 2EZTA 1YQTA 1W0JA 1U99A 3B2NA 4FYWA 4GP9A 4G26A 3GLIA 1OCRB 1SHUX 3LPAA 4DR5B 4HQ0A 1C1HA 2A3QA 2JI8A 5CVVA 3KQYA 3RHZA 2BFEA 2XECA 4WLOA 4O4IB 1S5PA 2OORC 4D41A 4DMUB 4M8KA 1ADFA 3CVWA 2RK4A 3FUTA 1SBYA 5LA6F 3GVXA 4OMCA 5AG2A 1OLUA 4DANA 3R5FA 2PYDA 4C2BA 2X2PA 4F60A 4XSVA 5BQFA 3S0JA 3Q12A 3QEBZ 1S7GA 3KHSA 2HBYA 1P75A 2YIVX 1FQKA 2OE2A 2I6DA 3H0KA 1UDXA 3I2KA 4DW1A 5A2QA 4V2UA 3GP5A 4LP8A 3HYCA 2WWIA 1Q0UA 2JIZA 4F91B 5HKLA 1I1NA 3OWOA 1TRKA 3RK1A 5F33A 4HAVA 3TECE 5BN3B 1KD1W 4QDXA 3JYOA 2O2CA 4NICA 3STYA 3N7TA 1D2NA 4L8GA 4RWZA 1ZIYA 3LUCA 2WHYA 2EKZA 4MO2A 2DXIA 1V95A 4DW8A 1L5HB 2QENA 4AAYA 4QSMA 3DOUA 5B6JA 4BNXA 2GBCA 4TQDA 2H51A 2ZYUX 1ENZA 1TC2A 1GUFA 2YWCA 3M4YA 4BZPA 5KNDD 1BS1A 3O8QB 4PI0A 1ORRA 1A8PA 4Z5XA 1SHTX 4GI5A 1XP8A 1IUOA 5TQ0A 1OWPA 1P4HA 5CEEA 4S2EA 3IFSA 4ESOA 4FFPA 5CG2A 3TW4A 3G02A 5FR1A 4NH0A 1W8IA 5DI3B 3D64A 1QR2A 2Y0EA 4LJ5A 1RAAA 1BVHA 2HR1A 3DEJA 2CV1A 4HUTA 5IJ9A 2G25A 5FOWA 1OB2A 2YWJA 2W0MA 3A1WA 4WKNA 4LF4O 2WLLB 1NI4A 4J03A 1QGYA 1ZPDA 1V37A 2OCCB 1J07A 3F2IA 2AHOA 5K0EA 2GYWA 2B1RA 4O4HF 1SJ9A 4RVGA 2J0VA 1XX6A 3UAZA 1J2TA 1J7JA 1ZU4A 3ZW7A 3FDIA 2A1TS 1EK6A 3I01M 4F7WA 3W5SA 3VX3A 1M6NA 4FGWA 5IKXA 1J2YA 5BSMA 1PV0A 2R6GA 2ZCUA 4OYLA 2NSLA 1XVUA 3ESQA 1N32B 4NOJA 4BO9A 4JLPA 4GEKA 2I8LA 4JLNA 3JRXA 3OP1A 3LDCA 4Q3OA 3O4VA 3T8YA 5LQUA 2X1VA 1W73A 2FUG6 3GARA 3P26A 1HNWO 2PWBA 2UXBB 2I4NA 3HXMA 3UMBA 1BX0A 4PA9A 4GYYA 4DR4O 4BX2A 4ZQCB 4OHRA 2WJ6A 1OFUX 1QXSA 1YDWA 3QX9A 1WB5A 4O4LB 4DPMA 4B6JA 3BWCA 4BO4A 1R74A 3N4YA 2PL9A 4MVJA 4NHOA 1TRHA 2ZB7A 3JS5A 1NSTA 1NMZA 4DV6O 4ZXFA 3KLMX 4UASA 4ITRC 3FYHA 1HDEA 1PJAA 1H2GA 1FXUA 2AOTA 4Q3NA 4BW9A 2D5BA 3L84A 3DBLA 1DVRA 2WUVA 4IUDS 4NLLA 3P9KA 2GPYA 4G0OA 4ND8A 4L0MA 2RC5A 1I7FA 1JEEA 2JS3A 1DAHA 2AW3A 4NAUA 3NI2A 2I67A 3HYNA 3NATA 1ISJA 4CTNA 2O2ZA 2GPTA 2VGMA 3HVUA 2BGWA 2KPOA 2VWGA 2CXNA 4HY3A 1F51A 4MIEA 4ZFNA 3L7CA 5DX0A 4AC9A 1A2KC 3UFXA 4DA8A 3THOA 1XZ8A 5FNZA 1DRVA 4FYXA 4JH0A 1MNGA 1H66A 1RWQA 3JWIA 3HYTA 4BO1A 3TRKA 1TT5A 4GGPA 3NASA 3CLHA 4GCZA 2GS9A 3RVKA 1HR0B 1MR3F 1FFXA 2FGYA 1PE0A 3OJ0A 1PYGA 2CSXA 3H16A 4X6XA 2RHHA 5DBHX 3LLSA 5D2CA 4PNHA 4EGFA 4BYGA 2VDJA 4LZJA 4K9DA 2J3KA 4ZEMA 4TTAA 2AUMA 1B3RA 3GJQA 2QD2A 1VIAA 1CHDA 3PC3A 4RS4A 1BL8A 2IGBA 4LX0A 3KSMA 1NT2B 2YOHA 4E1VA 4Z2AA 4OHPA 3W2EA 2PS1A 3RNOA 1C3LA 2HO4A 1O96A 2QQ5A 1K8ZB 4C0KA 5EMKA 2ZK7A 2AZ0A 3DH0A 3PFCA 5HQJA 1AROP 2VQDA 4KXQA 3A26A 2HHAA 2P35A 1VQPV 2CE2X 2PSSA 1DJMA 4GKJO 1E7YA 4XIIA 1VFPA 1DIRA 3NHLA 5LYJB 1I4EB 3ZK8A 1FNDA 3FPAA 1KRWA 1DJNA 3FNRA 3WXMA 1IRXA 5IAKA 3D8BA 1B06A 1IUPA 1VMAA 3NAQA 1E8NA 1JSCA 4ABYA 1IB6A 4R2JA 4UDXX 1XNQB 1DE0A 5JJ5A 4RY9A 4D4LA 3BK1A 4R1TA 1AQUA 3VR6D 2YUTA 1WMBA 4EKGA 1LPMA 5GMOA 2QKYA 4K26A 5C8ZA 3DO6A 4NU5A 3DGFC 3GN2A 3UM9A 1JH9A 3OR7C 2BFBA 5B3KA 2ECPA 5H59A 3BFJA 2E89A 5CBKA 3FNHA 4UEQA 1GRNA 2QJFA 4LY6A 4D43A 3L8ZA 3GCDA 1AXGA 5EJ9A 3BDAA 2Q5HA 2ISCA 5F5XA 4MV1A 3WLQA 3LMEA 3IR6A 3I2YX 3QKRA 3FKQA 1LNZA 3EWSA 5CB0A 3GDFA 1E79G 4RTPA 4IJMA 3ZYCA 3TJMA 3IE1A 2DHCA 4I7ZB 1P62B 1I2BA 2XB8A 4BQNA 3EVKA 1WMEA 1DCMA 4L9AA 1BZKA 3GDWA 1F4VA 3T7JA 3EWAA 3ABTA 1MPXA 3DDHA 3F1LA 3T52A 3LZ6A 4HATA 3KB1A 3A7EA 4NENB 4R1PA 1Q3TA 3IV7A 1U9YA 4AXXA 5IEJA 3LF1A 4OD0A 2LO1A 4BPRA 2REOA 4JI1O 4G0VA 2HP0A 1RWNA 1YDEA 4G1FA 2P6YA 3KE9A 3KPYA 4L78A 3K14A 5F2OA 4D0LB 3DBHA 2WTBA 5CMLA 3DC5A 1D1SA 1Z82A 3QP9A 3Q2IA 2A78A 5E9AA 4ZYLA 3DDNA 5H1YA 2CJYA 2OO7A 2IHZA 1RVV1 5E2IA 3JALA 4R83A 1TCBA 4PG7A 1MHTA 1KRXA 3BEHA 5IANA 1A8HA 4Q39A 1Z5OA 3IIKA 4ZDWA 4QARA 2OCAA 3AIMA 3MDOA 2Q49A 2DEUA 4AKHA 3GLHE 4TLDA 4P54A 3EQ8A 1WUTA 4LZPA 4GL2A 2OHHA 4UBLA 9LDBA 4CMEA 5CFPA 2IYPA 1WMAA 3E9QA 4CLXA 1RAFA 2ZJ1A 3DPIA 2BEJA 1BJTA 4GR4A 1D4AA 3I0MA 3VPCA 3ZKWA 2EW1A 4X1KB 1U1GA 1FVXA 3INNA 2IH4A 3APQA 1VL6A 1J0XO 4CM4B 1ZDMA 5LM3A 1VQPF 5EXTA 1X70A 3L1KA 3KXIA 5F21A 2HBZA 1RWKA 2OGWA 4A8JA 3PNMA 4DEXA 3BMNA 3WLJA 2JFUA 2AJ8A 3EWNA 4WXRA 4CPDA 4B8WA 4EGQA 3KL4A 3X1XA 3M84A 3I4LA 1OXVA 3GJ6A 2VSFA 3RQSA 3W3AA 3IKTA 3ZMSA 5ESWA 1PVOA 2NP7A 1FDSA 4WNAB 2RKOA 4BFCA 4J0DA 1UZAA 4B44A 4MB0A 5KOJA 2FPGB 1CJSA 2IV2X 4HAZA 5AW0A 2ERXA 3FR8A 5GINC 4YWJA 1XD8A 2FEPA 3ZC3A 2HTEA 3TQQA 2P9ZA 2JH3A 4AO7A 2OP0A 2X0RA 5FBLB 1KQNA 2XZTA 2CFIA 4GL4A 1MTOA 5J9FA 3CYQA 2QUAA 3BD8A 1L7VC 3DMTC 4HOYA 2AMFA 2GD2A 5DB4A 3N0WA 3G5AA 3IB6A 4LKRA 4QHTA 1MJGM 2YNMA 5B1BB 4Z9XA 2XLBA 2RAUA 2WJIA 4K0KO 4DT1B 1CRLA 3HGTA 5I7HA 3ZBQA 1I94O 5K8LA 2VKQA 3FXAA 1X1CA 3AEUA 3C87A 2AD1A 5CFQA 2IU6A 2YRXA 2AMVA 4U9UA 5FAKA 2F9LA 3VKGA 4GI7A 4NXNO 1R15A 2PJUA 3PEUA 5HP4A 3TDNA 1OKKD 1EX9A 3CMAV 1RHMA 4QGBA 4GVLA 1YK0A 1DC3A 3EZ6A 3RYIB 1O5TA 4CEIA 5BXYA 4NBRA 4LRTB 3H2BA 1YFKA 3CR3C 1YZHA 4JENA 1OXKB 5DHFA 1GKKA 5ILQA 1YR7A 3OG9A 2V3VA 2HDOA 2ODWA 5JNRA 3TTYA 4HI0E 4Z9AA 4GQBA 4UVIA 3S28A 2HSEA 4R3WA 1JZTA 1NVKA 2FB5A 4LJ6A 3RDPA 4DR1B 3PGXA 2L82A 4K9OA 1XL6A 1E3TA 5CB4F 3ZZ1A 2GUGA 4WINA 1UOEA 1D4ZA 1XZKA 2RIPA 2CNNA 1KY4A 4LHWA 4RKYA 1VE5A 5IKPA 1XD9A 2BFFA 3WLNA 3QLEA 2NVOA 4EA7A 3SYKA 4EG7A 4F84A 3NWEA 4H2DA 1ZN9A 4DLBA 1CIJA 3D6NB 4N41A 2QROA 2P4VA 1I2DA 5BSHA 4IS3A 5ALPA 5LVAA 4WFKA 1JG3A 4X93A 3WLLA 2Q07A 3IESA 5KQPA 2WWHA 3HBMA 2FFJA 2QT9A 2FN8A 5KYXB 3MS4A 1HYGA 3KSDO 3I64A 5DXAA 4BT7A 1F2UA 1XZFA 4O4IA 1XE3A 2AJBA 3OQNA 3OVMA 3V1YA 5DCVA 4IFIA 1Q12A 2J32A 3HU3A 1XCLA 3P9IA 2PV7A 2Q3FA 3DZIA 3A0BZ 4MEJA 3LMKA 5A2QM 5DNEA 3C3WA 1JL3A 5T7BA 1E2UA 4EJ2A 5DWDA 2GM3A 2H2GA 2QAGA 1XCPA 3G6KA 1TC1A 3PDWA 5BYAA 5K0ZA 4PYMA 1WSAA 5TS2A 2XR1A 3ZRXA 5BYBA 3TSZA 1QQBA 2F93B 2C42A 3TN7A 2GA8A 4PPFA 1Z4LA 3WP0A 3G67A 4FOLA 5FEMA 2I2FA 2Y9PB 4CQJA 3NK6A 1J0BA 1K6MA 2UUBO 1L4MA 2VYFA 4PGAA 4YN3A 1V45E 1T8PA 3HSSA 3U7EB 4C2UA 4WD3A 1YTFB 2M2IA 4Y2UA 1HMYA 5D87A 4JF3A 5ABPA 3H1KH 5A0FA 3AJ9A 4JLOA 1NF3A 2N9UA 1SIOA 2OKCA 2XODA 1KC8H 5JXWA 3V4OA 1WNSA 1TD9A 4MV9A 2ZRHA 3I52A 3CMAF 3HJBA 4E15A 3NHYA 4QHYA 1HO3A 4L7VA 2YDYA 2BHTA 5KJFA 4ZK6A 4MTFA 4BQOA 2E18A 4W9RA 3MWDB 4HDSA 4DPKA 2W4MA 2IJHA 2DT5A 1DCKA 1J20A 1AGRA 4H4DA 4FIDA 3D01A 3FR7A 4UUOA 3N28A 3JD4A 4OAOA 1M2WA 1J90A 3R77A 4TXJA 1XO1A 2QW8A 5BR7A 1X1AA 2JAOA 2PD6A 1WWKA 1OYWA 1T3ZA 4YMTA 5ESXA 1UDWA 5SZHB 1T9AA 3C5HA 1AC5A 1XLTC 2C97A 1K0UA 5JCOA 1DX6A 1CUSA 1ODTC 3A4MA 3V8EA 1B42A 2CDRA 2PNFA 4L51A 4OCZA 1M75A 4GRDA 4TTQA 4GMHA 3SZ3A 1KB9F 3H1EA 1BXGB 2RCYA 1IHXA 3A31A 3B48A 4LV6A 1NHGA 1XTZA 2IPNA 1NTZH 2GBLC 2HIGA 1RMYA 3BDIA 2BE7A 3DV0A 3FHJA 1G7SA 2E48A 1W2WB 4B6EA 1XKTA 5ERXA 3BIXA 2HA2A 4MVJM 3M1AA 4LI0A 2IPMA 1Y82A 5CTJA 4O4LA 2FK7A 4G9EA 2BKUA 1C9DB 3S3WA 4N0QA 1RYDA 3ZE8A 4FR5A 2QSUA 4GXNA 1XA4A 1UC4B 5GANK 4JGIA 5H9VA 1LI7A 1PLJA 4RGQA 3NALA 5AKJA 2CLIB 1W4ZA 7MDHA 4WZAE 4HQNA 3ZV4A 5JZMA 3TW0A 3AKCA 1TM4E 3LW8A 1XF9A 3MHSC 5LHGA 1T6XA 5DLPA 1WB9A 1OFTA 2FWAA 4PAMA 2F64A 4R2HA 3JX9A 3VAYA 2H65A 3L4BA 3VC3A 2AEEA 3GG2A 1JWAB 2LV8A 3UY4A 1S7CA 4NK5A 1VQ4V 3IILA 2D4AA 3TJRA 4A2PA 1N0WA 3ZVRA 3A4LA 2HBRA 4I9WA 1U2PA 5SY4A 3L6CA 4OLHA 2O7NA 4AKEA 1JEAA 3CXUA 4OHKA 5DCLA 1EFHA 2XWJI 1ADYA 5FI1B 2NZYA 5E7JA 3SEAA 5ALXA 1P5ZB 2CFSA 3QY9A 4ZODA 4PPNA 1EIZA 3H5LA 4Q9DA 1IN1A 3CNLA 4MI1A 2P8JA 2CSLA 3TGLA 2REQA 1N5MA 5C8VA 3T3PB 2JRIA 1BTOA 2FW7A 5L6MB 2ODTX 2BBTA 5M29A 2CLFB 2EHDA 3IUJA 4YAWA 3UENA 4YRGA 5EIFA 4QBHA 3M4SA 2FWPA 5LLSA 2BHRA 3BJEA 3EPRA 1SN7A 2XUJA 4DLAA 1IOWA 1E79D 4CLOB 2H1OA 1QVAA 3P94A 2DYSB 4RH1A 1H4SA 2AQ8A 3O9ZA 4MVJI 1DC4A 4GPD1 3BE8A 4ZC8A 2LE0A 4X41A 2CAZC 1XVTA 2PSJA 3WHKA 5ALWA 4GLBA 3K1TA 2IXDA 4L3OA 2VP2A 1PBTA 4JK3A 4FMDF 3BXOA 3DE3X 3WWDA 1G3QA 4BO5A 3NTVA 1UCFA 1A7AA 4CLRB 3PEWA 4B3TB 1OX4A 4DJFC 4O63O 1D9XA 3CU5A 4QJ3A 3BJZA 3ED1A 3BH6A 1Z39A 4UTXA 4JI3O 1TJ5A 2WHRA 2I1LA 5I47A 3GZTB 4PHCA 5EP3A 4M2LA 2EBHX 1ETUA 4CH6A 4C6RA 3Q9SA 1ZL8B 2NVUA 1EZJA 1DHRA 1V7CA 2D1QA 4HLQB 3FHCB 3HKDA 3EMKA 1DAKA 4KHZA 1VL5A 3QLVA 2QHXA 2Q0SA 1Z63A 3I8SA 1RE0A 5C1OA 2JNBA 3KHTA 4DCNA 3WDLA 4AJIA 3ZZUA 3IVRA 1ZO8A 3WLMA 4R05A 2YXEA 4PGGA 4CU5A 1X2EA 1T9GS 1ZK1A 4NE9A 2Y1OA 3CUSA 2UZ0A 1SEVA 3TLBA 3ICOA 3EIQA 5JFGA 4ARAA 4NENA 3EOBI 2IX9A 3PHBE 1YMUA 3PLAC 2I5PO 3ISJA 3TXSA 1VQ4F 4CKCB 5LZ2A 5HWSA 5FI3A 5H83A 1ZK4A 2JAUA 3ZZNA 5LUBA 1C7RA 3I1IA 2TMKA 4OHMA 1YZQA 1XRLA 2OD2A 4KR2A 1ZCFA 3A04A 1XTUA 3LVFO 5EPOA 3NG1A 4NZYA 4J6FA 3UC5A 3TOXA 3OOSA 4YDQA 3EX7C 3ME5A 2AW9A 2PX3A 5EFOA 5IYBO 1FX0B 4EB6B 2A9QA 1N1EA 2VYQA 1C9JA 3BH7A 4CLDA 3I7TA 3DNMA 3FVQA 4L28A 1EWKA 2XOKD 1K75A 1SMKA 4A5UB 4DEYA 3VPDA 1E2KA 3GRRA 1FMCA 2I2DA 4H3KB 3HKCB 1L4LA 3OF3A 2PU7A 4I8XA 3KLNA 3N8HA 4YGYA 2AOWA 2SCUA 4MUIA 3EGOA 2VRCD 1G8MA 4DF3A 3EXEB 2YXLA 1K2VN 1WUYA 4QUIA 2UUCB 3ORYA 5FLXN 3CMCO 4B6QA 1WVIA 1H94A 2GARA 3T80A 1J5PA 2Q69A 4DUZB 4X1KA 5EAIA 4QVGA 5AM1A 3AVQA 3OMLA 1NP7A 1WN7A 3IDQA 1XAJA 2AXNA 3SVTA 3AHFA 1ULUA 2HA7A 4ZVUA 2BDEA 1X87A 4ZEOA 3LVQE 4B71A 4ME6A 4C6SA 4D7SA 4HEJA 1N9GA 4B45A 5D51S 1FUIA 1E4EB 3B2EA 2OLKA 1HDZA 5D3MB 4KGXA 2P5YA 4L8LA 4LRUA 1VJ0A 1ZD8A 1BMTA 2B4RO 5HIJA 3G7UA 5JNWA 4NI5A 4S2UA 2CLLB 4EMBA 1I5YA 5C8XA 1HMPA 1KI2A 4GMKA 1NMUB 2PQMA 3I6MA 3L18A 4MQ4A 3AUUA 5HFMA 5SZIA 1YL5A 2R8ZA 3MTIA 4XUCA 3P4XA 1C8KA 4JL5A 2Z6AA 5D84A 3WLKX 3NMUF 4KQ9A 4M9ZA 2WUEA 3UTCA 4GOOD 2XUFA 1TQHA 3UT6A 1RQ7A 2F1IA 1N9ZA 1RRPA 1QIKA 1I3MA 4PZLA 4H7PA 2NSJA 1GN4A 4C7OA 3KPUA 1K3TA 2O1SA 5EIEA 1NF2A 1YDXA 1FAFA 3ZHRA 2ORWA 3VR5A 3A0RB 1UJCA 3SMQA 2VRBA 4MI6A 2Z4TA 3Q9NA 2CSUA 5FFFA 3TCXB 3P2EA 4KI7A 2A35A 4DHEA 4LBVA 1VQ1A 1VEWA 1PNLA 3ONNA 1CUBA 1PR5A 2OC4A 5A7GA 3EFOB 1LWOA 3OFKA 3VTFA 3V7YA 1XHEA 3QBVA 4U6QA 4LOKA 2IH5A 4DT1A 1EX6A 3E7XA 4J94A 1G19A 3OIVA 4ND4A 1SXQA 1N57A 1VI6A 1TMKA 3GA7A 3C45A 4QBGB 4HN2A 2Z9CA 4OYRA 4U7PB 3PPYA 3AF6A 2FOXA 1HE1C 3NVIB 2GH1A 3EG5A 3LBFA 1JU4A 4MSUA 3MINA 5G41A 4ZI3A 2JVJA 1MABB 4ICGA 2A1IA 3QTLA 5CHYA 5C0OE 1U0OC 4W4TA 1Z6AA 4AULA 1N33B 1N77A 1EK2A 5DRYA 1K5DA 1K7CA 3KXLA 1HGXA 2GHRA 2Y6VA 1E2IA 5FX2A 2K5UA 3GRPA 3BRSA 1UZUA 3RRMA 2XWBF 4Z0HO 5FFNA 5KTMA 2CFOA 2XDWA 4O3FA 4ARUA 4BLVA 4GUNA 2E7ZA 3ZZTA 2J7KA 1IBMB 3UO8B 4EYOA 1QF6A 5I4CA 2HU8A 1KSHA 1JAYA 1SUFA 4W5WA 3DDWA 3IO3A 5U1PA 1EN4A 4JVLA 4G5YA 3B6NA 1FE8A 3U7QB 1PSDA 4LYHA 4JLUA 4E3ZA 1ZD2P 4B6OA 5FV4A 4KL1A 1SQPH 4RD2A 2ETVA 5TDHA 3K1AB 4PRLA 5IYZF 3ANMA 2Z6VA 2IEZA 3V33A 4G85A 4ER5A 3F7OA 1I4LD 1QX4A 1T1EA 2VPIA 2BZ1A 1V5GA 3RH0A 3GPBA 4TQUS 1RP3B 2HS3A 4A2WA 4KAFA 4KN9S 5LNK6 1MG0A 3HR8A 2ACEA 3GGGA 4EVRA 4FU0A 1FYVA 3I56V 2X9GA 4YX9A 4BR6A 2WYHA 4LNUB 4KXNA 3VOTA 2Y2VA 2Z4SA 3PUJA 4HDRB 3RS2A 2DYRC 3GRYA 2I2AA 2OBLA 3TSWA 2BISA 4HYYA 4TXMA 5AT1A 5KVSA 3UMYA 2EDAA 4GQIA 5H0IA 1EM8A 3SDBA 3FLBA 1DQPA 4ZOLA 4F4HA 4KWIA 1Y6XA 1IXBA 2AF4C 1GXSB 4LE1A 1Y67A 1QRTA 4LY9A 3KKEA 2TS1A 1C0EA 1J42A 4TTJA 4B47A 2EKPA 4I9UA 5ILGA 1NTRA 1E77A 3ZMVA 5HCNA 3Q3JB 2GZSA 4HC4A 1B6TA 1X92A 1XTTA 2Z04A 1WXQA 3IV9A 3VTKA 1S72V 5CDYA 4Q9HA 1P73A 5BW8A 4EUHA 1QWSA 2ZYSA 2PUBA 3H1TA 3E82A 2ZUSA 1X9HA 4M9CA 3MMSA 4OJNA 3TW8B 4CQLA 3BFRA 5ULLA 1JAHA 1AUVA 5MDHA 1CQWA 3W7VA 4MQ6A 3D2LA 1DCFA 1JBQA 2HMUA 3LC7O 1M56C 1ACJA 4MROA 1I32A 3L8DA 1QHHB 4FGUA 4GGMX 4UNNA 1U0FA 1F20A 4UOZA 4AUKA 2FZGA 4Q3CA 1RSOB 2FPRA 2PFSA 3BABA 4IO0A 2V7QA 4FFSA 3BTUA 2GVDC 2BEUB 5CBFA 4F1WA 4BVQA 5JCJD 2AR0A 3QPAA 1XZJA 4IJVA 2ENWA 3EGCA 3N27A 5KKNB 1TLLA 1PJCA 2FG5A 5FOVA 1FDOA 1XVLA 5A3QA 2ATVA 2H7XA 5FJIA 3BJRA 3M1LA 3HNOA 2I2CA 1UK9A 2OHFA 5HZMA 2BJVA 5JI2E 1N5LA 3WJQA 4OXQA 3ELBA 3PUKA 1DDIA 3DL7A 3NBZC 2YOGA 2ZETA 2V7WA 3WGHA 3K9CA 3OHMA 4RCVA 3D2BA 3LOQA 2B9ZA 4GM1A 2E5LO 5TX7A 2H1HA 4PZAA 1NKDA 2FL4A 2BZ0A 4PG6A 2DVMA 5B5SA 5LLDA 5LQAA 3GUYA 3PHGA 3HCWA 1JB1A 3WL6A 3ZY5A 2XUAA 1OR8A 4UUAA 1LFAA 5KJ1A 1J39A 1MXHA 3WL5A 1JGTA 2CEKA 2WUDA 3P0RA 1LV7A 4A9AA 4C78A 3IQHX 1Y3DE 4YCJA 1Z6TA 2N42A 5E95A 1TDJA 1UOQA 1Z0SA 5ED0A 2QKSA 2FPIB 3ZHXA 1BXGA 3LCMA 5U4XA 1SKQA 4D3DA 4DY6A 2H8EA 3OFNG 1J7KA 4RUKA 3K0GA 4UXHA 4F46A 1DTWB 2LP7A 1U7PA 1Y48E 3SI7A 3QU7A 5T4HA 4DMHA 5TQJA 2YV3A 3D8CA 3OPYA 4N3BA 2ZKLA 3WAGA 3I56F 5ELLA 1X19A 2WA4A 2MYNA 1EG7A 1OD6A 3DCYA 2AFHA 3CZ5A 3O1HB 4G1EB 3H84A 1JFRA 2JVIA 4QQNA 2R3SA 1KH1A 4B4VA 1T9BA 2XYQA 4WZZA 2JFFA 3IDOA 4S35A 3PDCA 5DX1A 3L6EA 2IELA 5FLYA 1AQ6A 2YDEA 5HUJA 1UXGA 3JR7A 2CUTA 4KLAA 1KVUA 3L7KA 4B75A 2QM3A 5KHKA 4F4JA 1SRRA 1S72F 2DHRA 5HNKA 5F9FA 1XCMA 5AHWA 5AVZA 3Q40A 1RR6A 3IULA 4IDGA 2W48A 2XY4A 1Y3CE 1XROA 2VVTA 4YJFA 1NVUQ 4WMLA 1WXWA 1QZZA 3VHLB 1TIKA 2GZLA 4LCBA 3FAVB 4MPTA 3MDSA 1WMDA 2ZROA 3F4KA 1RM3A 1XEAA 2QXYA 4YRCA 5KBYA 2XVXA 3HZZA 1NXVA 4FDVA 1RE1A 1U65A 1G2IA 3X1WA 5B3JA 3R7SA 4QOIA 4UQPA 2W93A 1Y74B 1T34A 4MQUA 2Q45A 3MN1A 4W5JA 3VPGA 2VP3A 3BFKA 4U3JB 1JQEA 3DZ8A 5BSRA 1J25A 4AO8A 2H94A 1W581 2HD4A 3T6KA 3SHTA 3O95A 4DQXA 1V8OA 1RRFA 1UBEA 4FJ2A 4GZ5A 3N53A 2X86A 3PDIB 1SCNE 4QG7A 4JLBA 1GPNA 2IP4A 3ZX5A 4G5GA 4PO1A 4P0QB 1RC8A 5ALNA 2HHHB 2YY5A 5TJHA 1U94A 1IQPA 5AH0A 4UFNA 4ZCTA 1YB5A 4B6GA 1OMOA 3C8ZA 4V3BA 3Q8LA 1NONA 2YV1A 3I4FA 2CGNA 2KI5A 1HFJA 5BV8A 4ZV7A 3DE1X 2QRNA 2YZKA 1GG8A 1E6MA 3SHWA 4FJCC 3K5IA 1XDDA 3AJ8A 1I1OA 4LFAB 1N1GA 2DPMA 3OZXA 2XZDA 1WEHA 2XJ9A 4RGVA 1WKVA 1KPGA 3GRZA 4CLRA 3VQXA 1Y63A 1NUPA 2FZLA 3A9RA 3WMFA 3THYB 1IK4A 4YROA 4UPDA 3FF1A 2AMTA 5LMZA 1W47A 1CUAA 4RM2A 3UGKA 1VDMA 1ZMRA 4IQ4A 4HH1A 2QDXA 3WV5A 4IWYA 2PL3A 2HJ9A 4UOEA 1ZH8A 3O8DA 2B2CA 2HK8A 4UTNA 4MRRA 2OORA 1WA8B 1M1NB 2RB4A 4R9VA 4Y7CA 4PXSA 2CLOB 2ZRPA 4LNHA 3QVJA 4Q6BA 4BVAA 4RQAA 1L8XA 3MRTA 2JLUA 2AFIB 1ZL8A 4K6HA 2UDPA 1WF3A 4P92A 3AG1C 1SBTA 3QITA 1LDGA 3K0DA 3MRXA 1A9RA 3R24A 4DW0A 1K88A 4I5EA 2CHVA 3N59A 1RCFA 1RQLA 2ZEJA 2ZSBA 2XGJA 3LO8A 1KYVA 2P3LA 2QY9A 3PCXA 2FU5C 5IC5A 3HV2A 3WOVA 1Y34E 4RZHA 3ZMZA 1UJ2A 4IY1A 3KHUA 2J67A 1MSWD 1JN1A 2CVZA 1PDVA 2DPHA 4CGYA 2H48A 1YB6A 3B40A 2XH8A 4RS3A 5H6RA 3NRCA 4B7CA 5EJAA 1JX6A 3EXAA 2PGOA 3USES 3ABZA 4LGCA 5EZYF 4CFYA 1SXJD 2AE1A 3O31A 4TL7A 2RONA 4CKCA 4X8MA 2KLHA 3LPMA 3RU3A 3UJBA 1WG8A 3ZIDA 4NJEB 4JQSA 1K68A 3L7OA 2O0MA 4BLOA 1X1SA 4Q4JA 1D6JA 1X3SA 3T5GA 4UCRA 1PV2A 2FZKA 4FYPA 4Q24A 2WAOA 3NIGB 4J7JA 3X2QC 2NU7B 4EWLA 3H8JA 2DH6A 1FNMA 1JW9B 2FZCA 2VQ6A 1G3IA 2G6TA 3TDMA 3THWB 1A97A 1Z4PX 5H02A 2VK4A 1JEYB 2X3UA 4PTLA 1RWOA 5DYWA 1T8YA 4G9GA 1Q7YW 1CKEA 4ZCRA 3OF5A 2W2MA 2VLBA 1ENVA 2HFKA 4YP9A 1HDOA 4URZR 1GUBA 2JIQA 4IWNA 5AM5A 3ENNA 1M90W 1JYSA 3HKCA 3WVNA 1GZ3A 4N9QA 3RTGA 4IDNA 2Z2KA 3JQAB 1E5XA 3GLRA 4OQDA 3T5PA 4CM5A 3TL3A 3K0EA 1U90A 2I4RA 2VYVA 2OD7A 2KS6A 4J16C 1RCUA 4ZTZB 3OE5A 3ZHQA 1NVVR 3J80A 1IPHA 4JUAA 2Q62A 1QDLB 2QA4V 3PNVA 1DGQA 5EUBA 2KHZA 3ORSA 2JBAB 4B84A 3O3NB 3V4DA 1TAGA 1PW7A 3ZXYA 3W2IA 5F98A 2UYQA 1NJFA 4BNZA 3CN7A 3RYFB 1Z12A 2I3BA 3WWYA 4X7MA 1KYZA 3E84A 5LDHA 4QGGA 1E4EA 2Z1NA 1A7KA 2VBFA 5D3MA 1SGWA 3EGEA 1ZFNA 1W30A 4UD2A 2O8BA 2PZ8A 5JXJA 4GPZA 1YJBA 4DWVA 1EQ2A 4HAIA 3TD4A 2GD6A 2HPZA 5E1AC 2FXVA 2JI7A 4KR7A 4H18A 4BJ3A 4EHIA 2I4TA 1WXHA 3M6IA 1CTQA 3L46A 1BD4A 4R1UA 4OHFA 3PQ3A 2OT3B 3WS7A 5JHHB 5EIBD 1A7JA 2VG8A 3ADOA 4MGZR 2VCEA 2QLTA 2WJGA 4YO8A 2Q4EA 3FB8C 1Y98A 2WTEA 1Q7GA 4PSUA 4PYLA 3P2JA 3A0RA 2CL5A 3BGOS 4BQIA 1MB4A 3U3DA 1M2NA 2WWTA 2WHPB 5AUOB 4X9QA 2ZYTX 4FDMA 1UIRA 3KEFA 5K9ZA 3OTQA 3GR6A 3Q7PA 2ZSAA 4U7WA 2BP7B 5EE1A 4A0GA 3PC4A 3WG7B 4B35A 4JLVA 3P9SA 3BHIA 4YECA 4UUPA 3FMOB 1BQ4A 4O33A 2O2XA 2A84A 3FNQA 4DA9A 1E96A 2D8MA 2Y92A 4X60A 3LU1A 2FP3A 3SYPA 4OQQA 5JTUA 3AZOA 2VXBA 1OCZC 3JYCA 1QRDA 1R1BA 2EF0A 4C4ZA 3WGVA 4M1MA 5E4JA 4DSTA 1EHYA 1B8VA 1QYCA 3TH5A 3OIDA 1D2EA 2C2BA 2XCTB 2WUWE 2GD0A 2QL5A 2G76A 4US0R 3V8QA 3I2FA 1LX7A 3C6BA 1ORQC 5E1OA 4IIVA 2Y4OA 4NABA 5D85A 1IZ3A 2UXCO 3PIDA 2ODAA 3NHWA 4AMVA 3GFPA 1M2EA 1JVNA 4PWTA 2P9BA 1YVEI 2Q5JA 3ET5A 1OJLA 1H0HA 3WLFA 3K1AA 1U2EA 3R7BA 5AXCA 3L6DA 4HEHA 2C5GA 3IKVA 3S02A 1KI4A 3A1UA 1DBWA 2HJSA 2JW5A 3M4XA 3T7TA 4XX0B 4FMBB 2QA4F 1ZNYA 3U26A 3SR0A 3V8BA 2ZG6A 3EXIB 1DZ3A 3PUZA 1CB0A 1JSRA 3VV3A 2B82A 1X4TA 1B15A 1HH4A 4KQWA 2AC7A 3FZEA 1CP3A 4Z53A 4LNUA 1OBCA 3ILHA 4HDRA 1J8FA 2W22A 1W52X 1WO8A 4AIIA 1K7FB 2GK3A 5LMCA 4K6GA 3PX7A 3BILA 3C5VA 2LUOA 1EFLA 2NO9A 3TRDA 3UMSA 5IM5A 2VF5X 4A26A 4NFHA 3M9WA 3CRRA 2G1PA 4I9FA 2ONZA 4KMOA 2OCBA 4RZXA 4NOKA 4J0JA 5K3SA 4UBKA 4M9SA 3MQ2A 5IM4A 2HA0A 5C9ZA 2YJNA 3E53A 4XEHA 2FGJA 1TA9A 1GXSA 2F3PA 1P3DA 3BFVA 1I01A 2PPLA 1QHEA 3JVHA 1N92A 2ZRKA 1E3SA 1NV9A 3GNLA 1GK9A 4HSEA 2JLBA 1BC5A 4RPCA 3TNFA 3LL7A 1N8RH 4WTOA 4HZGA 1DQRA 4B17A 4OQLA 4QEKA 1NV8A 4MKHA 4XWOA 1XRPA 4UJ5A 4RSGA 3UAVA 3QNMA 3BBLA 2PGGA 1A50B 1D5NA 3MILA 4ISCA 1KAOA 3DMFA 2V8BA 2IGTA 3OFND 1HETA 2N1MA 1NJ5A 1QHHA 5K0SA 2PKRA 1RZVA 3A58B 1T2FA 5MGBA 3LE8A 4N39A 4WXHA 2ZYAA 3A9SA 4D0SA 1DUVG 1RWPA 2OA0A 1UR5A 3DW3X 1G98A 4OHBA 4G8DA 2O8FB 2BEUA 4XH9B 4BNMA 3OTFA 3E22A 3ER8A 2CNKA 3KWLA 3SXJA 4UZEA 3S81A 4G4GA 1KK2A 3K9WA 5KYVA 1D3AA 3HU1A 3JD1A 1K8AH 1NPYA 2VPXA 3HKEB 2F48A 2YWRA 3N2LA 2JVKA 3DWGA 4BRUA 2Q67A 3HZHA 2XIJA 1FSPA 3PQEA 1KAQA 4QLBA 1IE3A 4F6LA 4A23A 4BPBA 3I09A 3W78A 5EJ2A 3QVUA 1OXXK 4WX2B 2AOUA 3FI9A 1E9AA 5P21A 1NE2A 4OVKA 4E2LA 1MPTA 3M8KA 4H1WA 2HNAA 3G2JA 3G80A 5T64A 3A3NA 1W48A 4TSKA 4FW9A 4MW0A 4LCJA 4RZ2A 5KSWB 1YHQV 3QFRA 4PLGA 3RSLA 3J7AU 1TCVA 4TUYF 1MIOA 1Q90D 1P7VA 4FXOA 4KE7A 4UBIA 1GEGA 1DINA 2QYTA 1Z5GA 3AG2C 2RHLA 5LQKA 3SG0A 5ICMA 2W9XA 1WW8A 2C2ZA 3PJSK 1P80A 1DAIA 5JZ9A 4YUXA 2OV3A 3TQIA 3E58A 2G4LA 1CS0A 2D54A 2C4WA 3V55A 4X88A 2E49A 5A5EA 4IKEA 1A4XA 3C5WP 5BQPA 5JATA 1RD4A 2IEDA 3INYA 4I8DA 3AYXB 4U7NA 1Z18A 2J0QA 2EF1A 4JTAB 2PJDA 3GAAA 3WSWA 2XVMA 1XAIA 3SE7A 2C8VA 2O0KA 4JEIA 5A5FA 1BKDR 5DF1A 2P11A 3PXUA 3UQYS 2EWWA 4QYWA 2B33A 2CLDX 3UKOA 2H4WA 4LJ8A 2D2XA 4O08A 1YI2V 3DE6X 3M5WA 3DMTA 3GQVA 3RLFA 4BLUA 4K9RA 4L76A 9ABPA 4Y2GA 1Z34A 4X7PA 4Z4QA 4ARBA 3NH6A 4QODA 1Z8NA 5JIBA 4R9SA 3RU9A 1RPZA 2B94A 1LF5A 3BE6A 2XOKG 1DAOA 3PXDA 1MQ9A 3L8MA 5KUMA 2WIFA 1LVUA 1Z62A 3CLKA 3DJYA 3OA0A 2W71A 1TJ4A 1QIFA 5SY9A 4G0NA 1E1MA 2QTFA 4FBLA 4KXRA 3HB4X 1HWYA 1X0XA 2QUJA 1MVOA 1PR9A 3T4DA 1W85B 1FPMA 1F8YA 1XCGB 5ICFA 4Q37A 4WT7A 4NG4A 2JFZA 1IBCA 3H6HA 1QFYA 3CF0A 2VDNB 3AG6A 1I0IA 4FYYA 1XEXA 1T1RA 3OZDA 5KKCA 3HXQA 3ZLJA 1YH3A 1NXXA 2EIHA 4G8BA 4DSAA 1DOAA 5E7MA 2FRXA 3PDIA 1JR2A 1QVGF 1J1UA 4ZYYA 1SXPA 5C7IO 3HBFA 1ZUIA 3SX2A 3OPYI 3GEGA 5FUBA 2H0QA 3ZN0A 2QG4A 5JY6A 1I33A 4G36A 4XOUA 1A5TA 2O7SA 4WCFB 2W6OA 4RANA 5GY7A 4JMLA 4TTRA 2D5CA 1CJVC 4RTOA 3PRJA 3ANNA 3NX4A 4HWPA 3CCSV 2P7HA 4K3AA 1C9NA 4DC0A 5MF6A 1YQWA 1AB3A 5KCZA 2NZJA 2C2YA 2M1XA 4U2DA 3IMKA 5I7VA 4KPFC 1KQSF 5ALFA 2GI4A 4OJQA 4HFNA 3FI0A 2D74A 2ZYIA 4ISBA 4F4UA 3UMJA 2J3LA 4MEBA 2XB6A 2C1EA 3PYMA 4NS4A 4HWOA 4CL2A 2DYRB 3TAHA 1O0SA 2C3PA 1N3YA 3HFSA 2TYSB 1CK2A 3OM3B 4B43A 1AMOA 1EDBA 1JG2A 3VFDA 4DA7A 4RVUA 1N2ZA 1QQ5A 2GTPA 4PHGA 4MJLA 1DEKA 3ZZMA 3IUNA 3C3XA 1UKCA 3OF2A 3VTAA 3ZUPA 3L8HA 4MNTA 2CV0A 2AK2A 5HFJA 5EXPA 1O94A 4ZYTA 2A9FA 2V0CA 4ETNA 1XCOA 3UQZA 4EDHA 1GN3A 4XVRA 1K3FA 1YRYE 1PBNA 3WNVA 2O19A 2OKGA 1RLTA 4JEHA 2H17A 4OKNA 2CHQA 1GNPA 3FOZA 2AFIA 4RADA 2DY1A 1W2BF 1VPEA 3UJ6A 4JKYA 5DEDA 4H3HB 3K0AB 1P5FA 5AVXA 3MBIA 1NDQA 1PJ4A 3QKIA 4J0CA 4RO0A 1A69A 3N5KA 1Q74A 1GG9A 4MI3A 4BB5A 2EFEB 4N82A 1YI2F 1XSEA 3K0BA 3LK7A 5A9GA 3KSAC 4HNUA 3G9UA 1M56B 2WYUA 1GYRA 3UWPA 3Q8WA 5FUYA 5HMMA 3TTXA 1Q2XA 3EIEA 5EBWC 4YV2A 3V4VB 1EWTA 3U2QA 5DXJA 1GPYA 2ZSJA 2IYNA 3HSKA 4LHSA 3UKMA 2FE4A 4IDHA 4NU8X 5KX5F 4EJ6A 1TGVA 1Z6QA 4KRGA 3WBKA 1RYHA 5BN3A 4JI7O 3NK7A 5CXQA 1CQXA 3PNPA 4FLZA 4S1TA 2GPNA 4DKJA 1CT9A 3TQFA 4JXJA 4BYMA 4XM1A 3GVHA 4MWGA 5FWDA 4RZIA 1L5HA 3U3ZA 4HS4A 4UTRA 4O2BF 3PGMA 1KMIY 3LWBA 1M8FA 1MVLA 2KWIA 1US6A 3FNGA 2QUKA 1VE9A 1JEYA 2XCIA 1QK3A 4KODA 1AVMA 2OCLA 4EJSC 4HN9A 2X8BA 3ECCA 2HY7A 2FSIA 3O74A 2ZRMA 1N6IA 1GVNB 1NYRA 3M4NA 3O8QA 3FZQA 1B04A 1KZHA 2R9VA 4KPEC