5EIBD

Crystal structure of cpap pn2-3 c-terminal loop-helix in complex with darpin-tubulin
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
430
structure length
430
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for CPAP-tubulin interaction in controlling centriolar and ciliary length
pubmed doi rcsb
source organism Synthetic construct
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 175
structure length 430
sequence length 430
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
D PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5eibD03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5eibD02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5eibD01
2VXYA 3HKBB 5LA6A 5J2TB 5CA1B 3JATA 4LNUB 4KWEA 4U3JA 5LXTB 2GVIA 3N2KB 5LYJA 5CB4A 4X1IB 3RYCA 3WGNA 4FFBA 4I50B 3M89A 5IJ9A 3HKCB 3HKDA 3JAKB 4IHJA 5KX5B 4O2BA 1TVKB 4O4HB 4FFBB 4WBNA 4O4JB 3M8KA 3JASA 2VAMA 5EZYA 4I55A 4I50A 2RHLA 3RYHB 3RB8A 3V3TA 3E22A 2XKAA 4U39A 3HKEB 1Z5WA 5IJ0A 4IIJA 5JVDB 3ZBQA 1TUBB 4X1KA 2BTQA 4I55B 5C8YA 1OFUA 5CA0B 1W5FA 3WGJA 5BMVA 4O2AB 1SA0B 3WGLA 4O4HA 5EIBD 2BTQB 4E6EA 5C8YB 3JAWA 4O4LB 1JFFA 3VO9A 3N2KA 4YJ3B 4X1KB 4X1IA 1Z5VA 4U3JB 5JQGA 4I4TA 4X20B 3JATB 5GONA 4EI7A 3RYHA 2VAPA 3E22B 4B46A 5EIBC 5KMGA 5LP6A 4F6RA 3RYIA 5EYPA 3WGMA 5JQGB 2VAWA 3VOBA 4EI8A 5MN6A 3R4VA 5JCOC 4M8IA 5LP6C 3N2GA 3JAWB 4O4LA 4O4IB 1JFFB 3CB2A 5JH7B 3HKCA 4X1YA 5ITZA 4O2AA 4HNAA 5LOVA 5JCOA 5KX5A 1TVKA 1FSZA 2RHOA 5FNVB 5IJ9B 5EYPB 5MN5A 4TUYA 1RLUA 4TV9A 4IIJB 5JVDA 2R751 1TUBA 1W581 3VPAA 4ZHQA 3RYIB 3HKEA 2BTOA 5LXTA 2RHJA 5CA1A 1W5EA 4ZOLB 3HKBA 1W5BA 4TV8B 4EB6A 4ZHQB 5M7EA 5J2TA 3VO8A 1SA0A 4YJ3A 4O2BB 1RQ2A 4WBNB 4O4JA 2Q1YA 2R6R1 3JALA 3ZBPA 4TV9B 5MN4A 4HNAB 5LOVB 3JAKA 3HKDB 4IHJB 4DRXA 3RYCB 1W5AA 2RHHA 2XKBA 4YJ2B 5J2UB 3RYFA 3WGKA 5LYJB 5CB4B 3C8LA 4TV8A 4EB6B 4F6RB 4ZI7B 5LA6B 4I4TB 5GONB 5EZYB 4ZOLA 1FFXA 5KMGB 5LP6B 1RQ7A 3JASB 4DXDA 4XCQA 5J2UA 4ZI7A 4X20A 4TUYB 4EI9A 3UT5A 2Q1XA 3JARA 5IYZB 3ZIDA 5FNVA 4YJ2A 3JALB 3RYFB 1W59A 4X1YB 5ITZB 5BMVB 4DRXB 4B45A 3JARB 3N2GB 5IYZA 4O4IA 5CA0A 5JH7A 5IJ0B 3VOAA 4LNUA 3UT5B 1FFXB
chains in the Genus database with same CATH superfamily
4KGZA 3K0BA 3ZD8A 3IKFA 2J8ZA 3EEIA 1ORQC 1Y63A 3TK1A 4MXDA 1Y1SA 3IHWA 2IX3A 4LNUB 2BGKA 4OXIA 4UARA 4MGIR 1RPOA 3ZX6A 3KJXA 4OXXA 1S3IA 1EBFA 3OT1B 5FYQA 3HB9A 2YHUA 3KL4A 4LMAA 1X2BA 2FTKA 2JGNA 3P30A 3C74A 3GHHA 1Q95A 2ZRJA 2GD2A 4EQZA 3E1KA 5A1TA 1NR7A 4LI0A 4N5IX 2XNDA 4E2XA 4GYKA 2VS1A 3AO0B 5DNEA 5AVYA 1RWNA 3QELB 5EZYA 1IDSA 3CO0S 2VQSA 5KAPA 4FDAA 1TVMA 1YZNA 4PC6A 3HVIA 2DUWA 3EWSA 3D0QA 4IIJF 2N47A 3H8JA 3ZTTA 1AR4A 2DSTA 4P9OA 2KM1A 3WL4A 3PDJA 3CCSV 4MPPA 1IX9A 4U7WA 3TIXB 1BE1A 5BSUA 3ZTYA 1ZVVA 3M99B 1Q6ZA 1YAJA 1VIBA 4C7UA 2Q2NA 4FOSA 4N9WA 4I8DA 1KS9A 4P7FA 2VCYA 4PN3A 3UA4A 2GAIA 4KDCA 1G4UR 3UQYS 2G4CA 5C8YB 3NVIB 1Y8AA 2BKVA 4HN4B 5DNDA 3RFVA 4PN7A 2Z09A 5CX1B 3OKFA 1GNVA 3TMAA 1FLVA 5HZKA 4R5HA 4L2IB 1WETA 5LLDA 4UJ3A 3MJDA 2ZJOA 3SIWA 1Q6UA 2PMWB 3E8FA 1G1XB 2MSLA 3GL9A 1DQZA 1E2JA 4LGCA 4LNAA 1QCEA 1R0RE 3RJTA 4AKIA 3THXB 3SLKA 4B7XA 1ND5A 5K0GA 3D0OA 4M7OA 3FJOA 1M93A 4M8IA 1TGVA 4H08A 2XT9A 3WHPA 4OQMA 1ORVA 4FZ1A 4TT3D 3DXZA 1AB6A 1L4NA 1X7OA 1RLJA 1VXRA 1YQTA 2UUCO 3HN2A 4MLCA 2WIDA 2CYCA 3Q8KA 5EAIA 1W19A 3OZGA 2NYVA 5EMLA 5IJAA 4QTTB 5KWIA 4XTCS 4MQFB 2G08A 1X9GA 1IXMA 1ZINA 3KRTA 3LKZA 2IYTA 3GJQA 4C2AA 1TDJA 4EFKA 1P1FA 2JH9A 5LQJA 3W1WA 2VYNA 2JKYA 4BATA 3OR6C 2CSLA 2R86A 4WKGA 4D6PA 4TV8B 1T3TA 2PX3A 3EFOA 4E14A 5CCXA 3CVVA 4W6ZA 1ICIA 1RWXA 3K1TA 3NHMA 4L8VA 3OC6A 1U0OC 2FK7A 2ZJ3A 4LUCA 4QQRA 4WPGA 1JKFA 4AY3A 2Z0AA 3HJTA 3BK7A 1A8QA 1IN1A 3S03A 2QEXF 4TSFG 1A1SA 1RQGA 3HWWA 3OZFA 3TRDA 1EQUA 2PXHA 3LY5A 4CI9A 1XRNA 4KYTA 2EX3A 4KL1A 3G2IA 3UW3A 2A1UB 4MARA 3GLIE 2QTVA 1EFRD 3CCJV 2J3IA 3MYRA 3ACCA 3OCVA 4M1YA 4N48A 1J9GA 1J8QA 2YFKA 4EATA 1KI7A 2FE4A 3JQ9C 3IVGA 3LMKA 2HLHA 2QZPA 3ILHA 1LS6A 3PVSA 4L78A 2V6MA 3DMNA 4FYXA 1TADA 5TGTA 3CLVA 1REQB 1XQ9A 1JHYA 1V4NA 2A5LA 5JJEB 3EOZA 3IEXA 1Z4MA 1RRKA 3UAVA 1UPBA 2IHKA 1EVIA 1FJ2A 4KH0A 4JBNA 4N12A 4M8KA 1GITA 4X93A 3U37A 4Q7QA 3LRXA 1FNJA 4GP9A 2Y99A 3H65A 3IDSA 1UCFA 1U43A 4XEUA 4AZWA 1CTQA 4F21A 3CCVV 3ZRSA 4B81A 1P2DA 3TUZC 3QVVA 2Y0PA 3FNQA 3PCXA 2C4VA 1E5LA 3SEFA 1V9PA 3UUGA 4YAJA 3NMUC 3VHLB 1XP8A 1YZYA 1ZVKA 3O8RA 2V55B 1P80A 1GO0A 2Y1XA 3D3WB 1MOSA 3OZWA 2P11A 1PJLA 4MRMB 4ZICA 4C82A 4QJIA 5LB4A 5KSOA 3G9ZA 2Z5GA 1FFSA 2DTXA 3U7FB 2C7VA 4G5FA 2XCRB 3QTBA 4LFBB 4AI8A 1SC9A 3KCQA 3PSAA 4QVGA 4ZJZA 4MEAA 3LDGA 1U0GA 4GICA 5ILGA 1XREA 3RS8A 1BH6A 4LRTB 1Y5LA 2PLAA 5A5EA 4K1LA 4LHZA 1QZXA 1WU8A 3BZWA 1T5IA 4QJ4A 4KR7A 3IR9A 2ID9A 2IITA 3EOBI 4EJ6A 1TI7A 3GWZA 2JGKA 4NABA 3OG9A 3TKLA 3DXYA 1C7RA 4LVNA 4MSUA 3T6KA 3PJRA 1N9KA 4RV4A 3QVGA 2JGJA 2B2CA 4I55B 1C9DB 2Y77A 2X1LA 4P4GA 5TF4A 2OCDA 3C1OA 4BRSA 2I4RA 1PFUA 5DMXA 2ACVA 1EI9A 1XDZA 4FGWA 3CEIA 4OGFA 3WK4A 4CIXA 2P2GA 2IYQA 3BQMB 4MS1A 4E6EA 4CH5A 4V0NA 3VU3A 1AP6A 4MW8A 1E4EA 2OAP1 1TMKA 1L5NA 2QX9A 5H4HA 1WDLA 5BSRA 5M34A 4D74A 1F12A 2OFOA 4MDEA 1L7XA 2Z95A 4ZMSA 2GERA 3L02A 2JJ2G 5EC2C 1WTAA 3A1SA 4RIEA 2BFPA 3IBFA 4R1LA 3UPTA 1W2BU 1IHDA 2EP8A 4GGOA 2PZAA 2V7PA 1GR0A 3KSAC 4NOKA 1UWLA 2VAWA 3VOBA 1EVQA 1Q3HA 2HJRA 3OEED 1KWKA 1UWKA 3H8WA 2ZU0C 1TNDA 3H2ZA 2PYZA 3QELA 4LPSA 1V8OA 2EJBA 4W7SA 4C07A 3OFJA 4JP1A 5AM3A 2H6LA 4MUAA 2NTYC 1BEUB 3DTVB 2ZODA 3PQ5A 3WGUA 4NH0A 4Z99A 5J2UF 3IP1A 1U6JA 4FT2A 1RVV1 421PA 4OX9B 3EC7A 3V8RA 1I1OA 1XCPA 1MNQA 3PPIA 4P33A 3UUFA 2GBCA 2Y6UA 3L7OA 3NEJA 4DABA 4ND2A 5EHQA 1N1DA 2IOQA 4GXRA 4WVLA 1E18A 1C81A 4G5OA 4TS1A 4MA0A 1V54C 2LBPA 4KIUA 2FG7C 4R5MA 3CXRA 3FMFA 1M90H 1O8CA 4G2NA 3TZKA 2V5AA 1H4SA 1I14A 3G9XA 2W43A 3ZBPA 2PGNA 4HNAB 1E69A 3I3OA 1IN7A 4FSDA 1Z4OA 3RUAA 2PBZA 3SC2B 3FYHA 5I7WA 2W6QA 4MWCA 1A4UA 3DCNA 4HH0A 2OV3A 1GFWA 1EE9A 4TXMA 1U7UA 1R5JA 1YZLA 2WD8A 5F3DA 5THQA 1Z26A 4FUTA 2XMGA 2PX4A 4PC7A 4QHYA 1OOEA 3PF8A 1OV6A 3MVEA 3FE2A 4GMKA 3WWDA 1XHFA 4QPNA 1ONBA 2AJLI 2IBMA 3B48A 3AEQA 3QFRA 2YWDA 5I3ZA 4H0CA 3PG5A 2A57A 4KYVA 2NPFA 2O23A 3EUAA 3DG9A 1WABA 1QFXA 3CBGA 4G65A 3R3VA 1LVGA 3O47A 4NV0A 5KSPA 2LP7A 1Y9JA 2O8DA 2ECFA 4G9BA 5CITA 1Z6ZA 2OENG 2XNSA 3BZBA 5LUAA 3NT4A 3H1FA 4KR6A 1NVPD 1PT7A 4BIMA 4RTPA 3IAFA 1ZCBA 2CXRA 3TSAA 1C2YA 1L4KA 2GM3A 2H57A 4FILA 4NZYA 6LDHA 3UMCA 1M2GA 2EFGA 4J0KA 2P22C 2OZLB 3FBAA 2GVZC 1BA2A 3FMGA 3NDJA 4GMFA 1L7AA 2B78A 4XVRA 2CT8A 1OILA 1UDCA 3KYDA 4YCSA 1JLRA 1HW7A 1C30B 1CIVA 1LBHA 4UXIA 4WFIA 2WUGA 1V11B 3Q7SA 2YY5A 4QGAA 4IAOA 3HXOA 2OA0A 1G3UA 3ROZA 1P74A 2C77A 1NN3A 1MV5A 1EFVB 2OZBA 2NACA 3COSA 3Q2OA 1Y3BE 4Y6LA 3RTBA 5KINB 4ND6A 3VNUA 4TL7A 2EZ4A 4DLPA 3O8BA 2HX0A 4Y6RA 2XXAA 1R7RA 4H1UA 2VHEA 2RHTA 4X6UA 4I50A 2OGTA 4XWYA 1DRKA 4TRMA 2D2XA 2A9HA 5LMUO 4E4EA 2Y93A 2OCBA 3FB8C 4G3XA 4JVNA 4LOAA 4QYMA 4ZVLA 4F5WA 1JFTA 4WNIA 1IPFA 2KTVA 5TIIA 1HZZA 2I55A 1AZLA 4REMA 1F4LA 4KE8A 4FYKA 2ZUSA 1T5SA 3V4SA 3LKVA 4Z54A 2WT8A 1TD1A 3VZBA 4IYIA 1O54A 2Q46A 5DHAA 2CTWA 3I1YA 2NTNA 3MCWA 4J16C 4JROA 1JKJA 1H3NA 2ZB2A 3E23A 4GYYA 4IG9A 4LDPA 2CMHA 4R2IA 4DQLA 3ZDDA 4DCSA 4RQBA 3W2TA 1M2KA 3AJ8A 3AF5A 1EFLA 2V74B 3AHGA 4P34A 2IBZH 1KI8A 2UZHA 2HBYA 2ZVPX 1EGVB 3HADA 3K35A 1KAGA 5CLFA 2FFHA 3VQYA 3LKBA 3WZLA 4CS4A 2D7CA 3ICPA 4GSYA 4M6WA 4C43A 5EPEA 1KKLA 3JSAA 3TOVA 2JK5C 3RW9A 3C1UA 2XUAA 2X7XA 3EJ6A 1G21E 4CF3A 1TQ8A 3L6BA 1W93A 2CYBA 1PZXA 4Q15A 3BIFA 5KVVA 4MVJF 3BEOA 4ZJPA 3BHPA 3RWRD 1U0TA 3CINA 3D3NA 3PIDA 4IIUA 3PLRA 4Q4LA 4XH9B 4YRQA 5DGDA 3R9WA 1SBTA 3SLGA 2FVYA 4YAOA 1QB7A 3Q7PA 1X8JA 4DTIA 2YC2C 4JU8A 2Z5LA 1NR5A 4XB6B 1E6WA 4UCXA 4AICA 1RIFA 1TT7A 2C5HA 2EQAA 3OKCA 4HZIA 4M0FA 5CTJA 3T7KA 3O2SB 5JAHA 2Q0XA 3AK4A 4Z0TA 3G6BA 2HA2A 3GPIA 4N0PA 2HA5A 2YJZA 4HWGA 4TYNA 5EB1B 4B3GA 1SPBS 2QR5A 3P0FA 5ICMA 5KYXB 3N2IA 3HUEA 2DUMA 5F3WB 3QE2A 4C78A 2ECPA 1XAHA 4M0PA 3WYBA 3FY4A 3HCDA 2GF0A 3PXDA 4AXBA 2DYSC 4LH6A 4ALJA 3DTYA 1EXDA 5HX7A 2Q8QA 4I81A 5JD5A 5DN6A 4G4SO 1C0EA 1KVTA 2WJJA 9LDBA 3DGEC 3IA2A 5LP6B 4BC0A 2FUEA 5C7IO 4B4KA 1RIIA 1RC1A 1XZHA 1NBAA 5K1PA 3CURA 5ENVA 3REQA 4AJ2A 4BCBA 1ISSA 1OC4A 2RFLA 3KZOA 4NVRA 4Y9RA 5IKEA 1NQTA 1KUQA 3WXMA 1OBFO 2IK8A 3TN7A 5K1ZA 3I09A 3T52A 2NSYA 4GSLA 3V80A 3SYRA 3S0JA 4FW8A 2PLWA 1CJTC 4NVPA 5DI3A 3BM5A 1D0VA 5FI0B 4ZWNA 2H85A 5DHTA 4PNZA 1J8DA 4KQGA 3ZDAA 3ZZNA 1JDBC 5EKDA 1DX4A 1JDPA 1KFBB 3K9SA 3E9RA 5HIJA 4HUTA 3QUSA 2P62A 1JDJA 4YGYA 3DQQA 3H2JA 1J56A 2W71A 1A9XB 2CHEA 1R15A 3NIGB 4K5QA 4QICA 2FVXA 5ESRA 4HLUC 2CHFA 5TQ2A 3C90A 1E3TA 4NYMQ 4BVJA 2B92A 1WR8A 2JD0A 3H11B 4QG7A 2H16A 1E3WB 4LK2A 3MAJA 5H6RA 1UXJA 3WL3A 4D6TH 2PGJA 2BBWA 5ICFA 2EBUA 5JLAA 3LY7A 2AG8A 2CZGA 4Z2WA 4PNPA 3VC2A 2XA1A 3G1UA 4QOEA 1NMYA 2W22A 3AONB 4NUTA 3L8GA 3DQPA 5EUQB 4CCWA 2A06H 1NL3A 1VJ1A 1JU4A 2J9RA 3S99A 3RN4A 4PRKA 1I4DD 4OXKA 2Y4UA 2PJDA 4MQ4A 5CW2A 1DE0A 2AOVA 4RABA 2DY1A 2QL5A 2C97A 5LZ5A 4WK2B 1N7GA 4KACA 1VIYA 3WV4A 3FUXA 2PO5A 3WJ2A 5HS4A 3KQYA 3GXBA 1GO2A 2XHEA 3PNLA 3TI7A 1SN7A 4LJ8A 5IKMA 3F74A 3F96A 4R1TA 1JKXA 1NRXA 5D87A 5I7AA 4PDVA 4BU0A 4C89A 3OPMA 3I9LA 3IHLA 1CJSA 2X1VA 4XX0A 1ORIA 2X23A 4EUNA 4OPAA 3JV7A 4DIUA 1E79A 5KMGA 3CLRC 3L7LA 4UTZA 5KHKA 1P1RA 2A0LA 1DBIA 1LRKA 3VR4A 4WY2A 1C3XA 1T1JA 3GRPA 4JX8A 5EXPA 1BVUA 3WYGA 4LXXA 1U96A 1N2XA 5I9TA 4Z7OB 5JI3E 4ZANA 3CZRA 2AZMA 3M6LA 3FB5C 3MN1A 5K8IA 1JVNA 3OMIB 4YR7A 2QN3A 1FBNA 1C1XB 3IS3A 4TQGA 1IWPB 2GT1A 3BTOA 5B58C 3WGVA 3L5KA 3MQ4A 1KP2A 5EA2A 5IDXA 5L3QA 2QTPA 1TK2A 5CA1A 4X90A 3USES 4F0JA 5A02A 2WI8A 3R0IA 4FXOA 3UXEA 1C7QA 2C20A 4IZ6A 3FOZA 1B0AA 2IIVA 1TEZA 1I1QB 2OFFA 1M6EX 2QXUA 1ORDA 2QIPA 3P10A 2L35A 3RUIA 3PX7A 3AP2A 4ALLA 1M1KW 3FX2A 1V1RA 1T4CA 1Q19A 2HFKA 1EFTA 1VRCA 3N53A 1IWOA 3KQPA 1NNSA 4Z86A 3WTCA 5JOQA 2AVDA 1KD1H 4U7OA 1PPJH 3PDIB 4BN0A 5JXHA 2Y92A 2Q3CA 4ZVKA 4CR6A 1UMKA 2CMGA 2QPLA 1QGOA 4L72A 3JQ8A 3WOVA 3O8NA 2AOUB 4ZOBA 1ARZA 4QFDA 1W87A 1OGJA 2YFQA 3DLIA 4XTRA 1PTJA 5F51A 5LB2A 4AZ0A 4UM8B 4U1RA 5T64A 5B7GA 1E2GA 2GBOA 3KVNA 4QODA 3SHVA 5CK5A 2P3QA 3U9TA 1AF7A 4Z6KA 1RA4A 3FUTA 4ZTUB 3Q7RA 4G4JA 3DDUA 4V3BA 4ZDKA 5LP1A 1IV2A 1NQUA 1E58A 2L42A 4Q3BA 5F7ZA 1F2UB 3MOIA 3PWSA 2D3OW 1PR6A 1IJEA 2DKOA 4KWHA 4MRNA 3IX7A 5TJ9A 2Y8EA 3PE3A 2Q49A 3TX6A 3F78A 3WYCA 1A96A 1YHNA 2GKGA 1P1CA 3T1YO 2F4NA 4DUYO 2IG8A 1K6IA 2PWAA 4NZNA 3N8IA 2FPOA 1V5GA 1S2NA 2EINB 2IPOA 4FVTA 5LKAA 1DT5A 2VXBA 3OTQA 2YV3A 4C3VA 3Q7EA 4WDQA 4BT2A 2AG6A 1FFWA 1JI3A 3ACBA 3RSHA 3N2KB 4WA7A 2CEKA 3QYPA 1ESCA 4FYWA 4M49A 4NENA 4R1OA 4UMVA 3VYVA 2EHJA 1KO5A 1PFWA 2JFWA 2AUMA 3ICWA 5HCNA 2RGDA 1GM8A 3PDWA 2EERA 3K0TA 2HR3A 1SU4A 2WNSA 4MLZA 1X7WB 4K6MA 2WMOB 3L1UA 2CWJA 5G4LA 2QAGA 5DHSA 1ACMA 1T25A 4PC2A 4HVTA 5F76A 521PA 4DBLE 3A1TA 3D8TA 4O5AA 5K01A 2HA0A 1JEDA 2ZWAA 1CV2A 4R2KA 4PSKA 2EW1A 3KQMA 3U7JA 5T57A 5JS2A 2IA5A 3DXXA 2W4QA 1M9NA 1GPMA 1QPZA 1GGFA 1L5QA 1UEJA 2VK1A 3NHUA 4IH4A 3I4CA 1T9HA 3A0RA 4IIJA 1P4SA 2ABWA 2WABA 2ZK7A 4MB6A 3MFYA 2XYGA 1OB5A 3SJBC 1NVVR 5CDHA 2ZSBA 2C3PA 5DTIA 2D8MA 2DMXA 1YK1A 3BHNA 1T9CA 5KQSA 1YHQV 4U2EA 3AL2A 3W04A 1TUEA 1WCIB 4MWZA 4NS4A 1LI5A 4U3FH 1QVGU 2XUJA 1MO5A 3B3GA 4KAJA 5HZHA 4Y0VA 1QVZA 2D1RA 5DYNA 5JXWA 1E3DA 2VPZA 4MYCA 3WHIA 4AT1A 1I9GA 4BMSA 3OWXA 3DM9B 4CVNA 1P39A 5EYPA 4B6QA 3LCVB 4ND5A 5CDFE 2WZQA 3GN2A 3AETB 2UAGA 4HEA1 3ZDYB 4WN9B 4AKHA 4JNCA 2CKMA 2EQBA 2Z5FA 4DJTA 1R12A 1NPDA 3LVQE 1ORRA 2IZ7A 1D2EA 3EF1A 4LZAA 1FSZA 2PXCA 5B1DA 3ZQ4A 2DQZA 1EE2A 1J8YF 5GTHZ 1P29A 1Z0UA 2I9PA 3FJ1A 2Q7OE 4DZTA 4BXOB 4I1OA 2XDWA 5EOVA 5FUXA 3B2NA 4FNAA 4LMBA 4EY7A 1Q86H 2WILA 3OY7A 2CL6X 3B2QA 4UB8Z 3L7CA 5FBHA 2C5SA 5E6SA 4ACBA 2CUTA 4B8WA 1WAMA 4IJKA 4W1SA 1NRJB 1IV4A 4ZOLF 5DO9A 3HJUA 4Y9UA 3P27A 5DCWA 2ORWA 5EJ8A 3JSLA 1N92A 4B7UA 2FN4A 3HXLA 3KDAA 3TQHA 3CRW1 5JSHA 3KQLA 2NYUA 3ADKA 3OOEA 3QFSA 3WJQA 1ZOOA 2OEPA 4L4RA 1FVHA 3CCSF 2HCTA 2QB5A 2WT4A 3UMFA 1A7JA 1G16A 3FRJA 1IEWA 2YQZA 1GU1A 1LI4A 1N1EA 2BP7B 4MTCA 4U5XA 3U31A 1SBYA 3R1IA 3A4NA 4FM2A 4B3MO 4NBWA 4P4UA 1AKTA 3DMPA 1EUYA 1WL8A 4ERHA 5BOSB 3D5TA 3MT7A 3RF6A 3X1ZA 4F6EA 3X1YA 2PHNA 3UKMA 1E7YA 4HN2A 3LF2A 2XUMA 4A23A 4GXQA 3EODA 1KFCB 3U7QB 6YASA 4X61A 4C0HA 2ZAIA 2CL5A 5F2OA 1VB3A 2JC3A 4IEEA 3ZWVA 4FQ5A 4MINA 4JITA 2G80A 2CCKA 3HMQA 4AJPA 3ZI4A 2IUYA 3G6EF 4AQYO 3DXRA 1HH4A 2VAVA 3QLEA 4PZ0A 1YDWA 3R4CA 2CDAA 4RFLA 3JD4A 2WQZA 3UKOA 1VL8A 4EBFA 4EHNA 1Q21A 4UVGA 5I9IA 4JJKA 3NJ8A 1F38A 2QRUA 3A9CA 3BK1A 4EKYA 1GX1A 2NSJA 4ZJYA 5H9WA 3SHOA 4EKEA 3LH5A 4OXQA 2YJ6A 1RRMA 4LOLA 1J97A 3E1GA 3FGPA 1W46A 2X7HA 4H7PA 2YWFA 4XVCA 1P81A 1EAYA 1N6RA 3HA2A 3CJHA 1LLUA 1JPUA 3BXFA 3IIIA 2PUHA 3PP8A 1LPBB 1KZ9A 2QKYA 4OJNA 5D3MB 3OJ0A 5HQTA 2JNWA 1F7VA 3H4IA 1JMVA 3KOYA 5DECA 1Y89A 4JUDX 3M70A 4J0QA 1APBA 3SXPA 4P3NA 5L3RA 5AUOB 2XOEA 3CZ9A 3NGLA 1PDOA 2YWEA 5IF9A 5LZ8A 1YR9A 4GPIB 3WLIA 2VQDA 3AYXB 1JX9A 1K4YA 1GA6A 4LXGA 1Q2UA 2O19A 1CYDA 4HTAA 1K4CC 2AOWA 5JANA 2D2IA 1VP7A 1VQLF 4BFTA 2QEXV 1PR3A 3L4JA 1QYVA 2PY6A 1Q5PA 2Q1WA 1P2FA 1JHVA 3KR1A 3L93A 4NG4A 2IOFK 1ZMBA 4JHXA 3HNPA 2WIAA 3CSUA 3S29A 3BHJA 1TUBB 5F9MA 3EF3A 1TJNA 1MXHA 3FDZB 1NFFA 4F1WA 5FA8A 4YRZA 4IM7A 5KOJB 2WW8A 1K33A 4O4HA 4Q1CA 2PM8A 1WB4A 2YJTD 1UXIA 2W6JD 1XTVA 3JAWA 3A4LA 3NTQA 1DRVA 4PIVA 1W0JG 2J48A 3P45A 4KXLA 1WLSA 1SVOA 4QXPA 1F4MA 5A2GA 1K9MH 3FKSG 1WNSA 1DHTA 2DQ4A 2ZITA 4ZK2A 2G0AA 1D5CA 4RJKA 5EINA 1THMA 1XZFA 1J2RA 2QMZA 3RU3A 2RB9A 2FSVC 1DAPA 3H3FA 1P18A 4KXFB 3ER8A 1VMAA 5DNAA 5DJ5A 5JC1A 4TQFA 2I3AA 3AUFA 2TYSB 3KVOA 3IV7A 2WWFA 2GCGA 3ZD7A 5LFAA 4G56A 4WFHA 2AE1A 1RCFA 1Y8QA 2RGEA 4PXSA 5DTEA 3SEQA 4O2AA 1YCGA 4RPLA 3CCJF 2L69A 1AXRA 4YMVA 1SZCA 4HQRA 4ZZ3A 3K5HA 5DE3A 2QWPB 5HZGA 2XYHA 1DK1A 1NLFA 3Q9LA 4JOCA 3U49A 4H7KA 4E31A 3CSDA 3KJQA 5EC1C 4QX6A 4CHGA 2PZLA 4ZVNA 4KOEC 4Q9DA 4U2GA 3DE7X 3AY6A 4XVQA 3C8DA 3PHCA 3Q88A 3QMMA 4YEDA 5PNTA 4TYWA 5ILQA 5I7SA 3FCEA 3CFYA 4CMJA 2ZJBA 3V2HA 4D0GA 1GRRA 1WCV1 3GARA 3OUFA 1LK5A 1SKYE 1FP1D 4TOIA 1T2FA 1VMIA 2FQYA 2QM3A 1Y6RA 3R5TA 4GQBA 4L16A 2ZINA 3FFMA 2D1TA 4HNSA 3VJMA 3CCVF 5DGTA 1VG0B 4O25A 4AN1A 2P3SA 4BFVA 4HYOA 3PX2A 4EMBA 2G9QA 5C9ZA 4OB6A 2EKBA 3C3DA 2F9MA 4S0ZA 1NQWA 4I4IA 1XQXA 1HPLA 3GJ3A 5JECA 3W7TA 3ZVRA 1AKQA 1LDGA 2FRVA 3HZRA 4AZVA 1XRMA 1ZK1A 5H6QA 1IBLB 2AW3A 1USVA 2OUKA 3A3NA 2B5OA 4MRAA 1Y1QA 4TXLA 3THOA 1OWNA 2X3UA 2ZBEA 4HVAA 4OIFA 3MAAC 3V8QA 4AY5A 1CZKA 3X0DA 2WLMA 1PKEA 4EFNA 5C81A 2DUUA 5KOYA 2WB2A 3ZJYA 5KJ1A 2VF7A 4MTGA 3BTVA 2GM9A 2WVJA 4F4CA 3UC5A 4QXOA 4ZT3A 2X6TA 1WLYA 2Q3FA 1B06A 1ISFA 2XT6A 3SR0A 8LDHA 3ZGZA 1KYIA 1RCTE 1ZGAA 5K4AA 2YYYA 3OICA 3MINB 1L5YA 1OX4A 4CKYA 1SURA 1X9HA 4UDXX 2OCIA 2C4WA 4LHWA 4IDNA 4JJ8A 1SOVA 2UVQA 3KXIA 2GTSA 1QFZA 4GYWA 4RA9B 5HM6A 5TB5A 3T9FA 5E2BA 2O3JA 1XD8A 2XKKA 4JI7O 4IEFB 3HWSA 4W1QA 2ORVA 1DXYA 3IGAC 1TLLA 4NJMA 5EWJA 2CB9A 5TS3A 1IUPA 2X8LA 2GEKA 3ED1A 3MMZA 4W9NC 1XL0A 1JKJB 1PT5A 3O0DA 2JVJA 3V6MA 2G82A 3LDUA 5BNTA 2AXNA 4R8RA 5JASA 2OXFA 1DX6A 1I3OA 3SMQA 2PX6A 1G19A 2WPDA 3JZIA 2XYRA 5IUNC 2D0OB 1PRYA 2A5GA 3G8BA 2EDAA 1RM1C 3H8VA 1XVTA 4FHEA 1VFNA 3ZHQA 4MZDA 1AF4A 5KO2A 5CW1A 1F20A 4PU0A 5AKIA 4E7PA 1Z5WA 4EARA 3DEFA 1VPVA 4ZGWA 1W36C 5B5SA 4G1CA 4I46A 2VNAA 5JATA 2X5NA 2I2WA 2H7XA 3KPJA 5ELLA 3FPFA 3SFVA 2O8BB 3I56F 4XVUA 2JCYA 5G2OA 4NXMO 1E61A 2IKQA 1FS0G 2VHCA 1QB8A 4GM0A 1UK7A 3KOXA 2BF4A 3N05A 5JISA 3FNRA 3O75A 1UODA 2F3RA 1D0IA 1W75A 4RZSA 4R83A 4UBOA 3T0IA 4D8UA 3L2OB 3U61B 5FI1B 3EIHA 3AFHA 1ZLXA 3T3IA 2QSZA 3UUWA 2PUGA 2PYDA 2OZLA 2OILA 3L7IA 3X2QC 1R1BA 4P83A 2EWCA 1ZSVA 4MGEA 1QTQA 2YHAA 4ZK7A 1HLDA 5KTTA 2PQMA 1EFRG 4JX9A 1GPAA 5EIOA 5AW5A 3TLAA 1FNCA 1ODSA 4Z51A 1E6MA 5IEJA 5FUVA 2Q3HA 3L5OA 1W0CA 2IUFA 1GPKA 3L41A 1IDN1 3KSZO 1NSTA 1P7GA 1KDTA 2W8BA 4YT8A 1NUHA 4LDQA 3V8MA 5U9CA 2DYRB 4TMVA 4N23A 5H9VA 5BSWA 3WIOA 5JY1A 4QPKA 3JQ6A 2VT7A 4H1TA 2VQFB 2DJVA 2DT4A 1T91A 1W1UA 3UUEA 3DE2X 4NPCA 1EMDA 1Q6HA 5BR7A 4S0XA 3HBJA 3SYOA 4F9GA 5JZBA 5GJVC 1LWOA 1KO7A 1VMDA 4BKRA 1J39A 3FFAA 3OESA 4Z0HO 1PT9A 4IDBA 4BKQA 3K57A 3KAPA 2W0FC 2IRWA 2VWPA 4F2HA 3R3XA 4R01A 1PTKA 3VAAA 4JD5A 1H6DA 1R5NA 3LSYA 4GPBA 4F8JA 3MERA 4OATA 3AF3A 3RGWS 5EIAA 7GPBA 3DF7A 4RF3A 4R6XA 1V5EA 2R6HA 1TRHA 2R68A 3GEHA 3SYMA 3TW4A 4DOMA 2XMPA 5GINE 5FPOA 2HS4A 5DP1A 3AIOA 1IZZA 2CXSA 4MAAA 1GGEA 2AMFA 3EPJA 1AK1A 1I8TA 2IHYA 4H18A 1SVNA 4TV8A 3KWLA 1F2TB 2UZ4A 2FPSA 3AR5A 3VR3D 1EP1B 2DBZA 3BWYA 4FR5A 2PBFA 2AN5A 4HYYA 3LYLA 1O2DA 2W6ID 3GT4A 2QP4A 2VWHA 3R6LA 5DDIP 1ZJ5A 3UXHA 1EZVH 5J3JA 3U56A 5TPZA 4MJ7A 3WG9A 3F5WC 1W2HA 4WF9V 4CCYB 2HT6A 3AVTA 1GRCA 2FX5A 4UHFA 1OCZC 3X2SA 1P72A 3TLJA 4E5NA 1UM8A 5BVGA 7YASA 5J43A 3ZN0A 2M1ZA 4Y6PA 2PKYX 5DBHX 2B98A 3VBCA 4I1UA 5FDFA 2XV1A 1Z15A 4J4TA 2ZUWA 5FJJA 2D5LA 4IJMA 3ELWA 1FTGA 1K7FB 2Z01A 2FZVA 3KTDA 4BJ6A 1UP4A 4KQWA 4DMLA 4I14A 2V6BA 2DQSA 1MH1A 2OB1A 2OBYA 3EA5A 4EENA 1MG1A 4OYYA 4YRLA 5FIUA 3BB4A 4M1OA 1YA6A 3R3JA 2XLBA 3EXHB 1I5OA 3DKVA 4JUIA 3ZU3A 1AUOA 2W6OA 3N0WA 2R6AA 4Y98A 5GJWC 4JXZA 2G9RA 2I4MA 1MNAA 2GUZB 1BMTA 2VPIA 1NI3A 2EQ5A 3L8HA 2AW9A 3M3HA 4IDFA 1I7SB 2HC9A 4O4JB 2WNHA 1YZUA 1JR4A 5BXZA 1QVAA 1VM6A 2WJ4A 3L8DA 4ENQA 2W6IG 1IQ0A 1ADFA 4Q24A 2P5SA 3TQTA 5CB6A 3E86A 1AJNA 1IOLA 3JQFA 3AC0A 1A7KA 3HABA 3RG2A 3ULKA 4ZKDA 4U39A 4IQ0A 5DW0A 5BQPA 3STYA 1QAOA 4ZU1X 2C9ZA 2VSYA 3ADOA 5JVDB 1ZTEA 3MCAB 5LYYA 4YIOA 1QQ5A 4D0LB 5L3FA 3IMFA 4EGFA 2C5FA 3FZNA 2HPZA 1HZZC 3KVRA 1Y8CA 1C3OA 3RC9A 2B21A 1J0XO 1COWG 1XYGA 4BFWA 5JHHB 4HADA 2ZIFA 5FWAA 2WDZA 1C2TA 3IP5A 4IT5A 1N36B 3RU7A 2DPHA 4HH4A 2C9CA 5DKFA 3Q3JB 5CJPA 2PUEA 3BXHA 3N28A 2YMMA 2CLEB 5EWJB 5AVTA 1RSOA 4B9AA 4X1IA 4P4TA 1MH9A 3HXTA 3IAYA 1GK9A 1O5TA 1ULZA 1QU7A 2AZTA 3CONA 1ZVJA 4N5HX 4NDZA 5K0NA 3Q8LA 3ERCA 2ZB7A 3WYNA 4P3OA 4LFAO 3CE6A 4HAWA 5GVSA 1DXHA 3SSOA 3U7EB 3UK1A 3LCRA 3ZDEA 3WGMA 4ZK6A 4YX9A 7ABPA 1M2HA 5KIAA 2HLDD 10MHA 4JB3A 2KLBA 3HG7A 4GLBA 4UCWA 5HJ2A 3QXSA 4F4IA 1JFFB 3CVWA 3FHTA 1PWXA 3K16A 1PGNA 4ZV7A 2RONA 4W63A 2OESA 3L7BA 3MRXA 4TV9A 4CBCA 1FYWA 1IDOA 4R2HA 4KMMA 3W1VA 4XDZA 4DPKA 6ABPA 3DEYX 2MYNA 3HCCA 3WLHA 2ZQYA 1MSWD 2DHDA 2QOEA 4FKBA 4AG3A 4ZFNA 1GUFA 3I04M 4E12A 1VPWA 2UUPA 3FPAA 3B40A 4BR6A 2PGXA 4NSNA 2OTLF 1SVLA 1EVJA 2GFHA 3H2HA 3B1JA 2J9FB 5DIFA 3Q4HB 1NBIA 5KPJA 2SHKA 4C1BA 1BMDA 1UAAA 4GCZA 1LGYA 3NS7A 2PKXA 1P7CA 3DDNA 4CN9A 2H9AA 2F7SA 1G1AA 1XZPA 3QVMA 1N8NA 4WERA 4YJFA 3LBHA 4PX2A 5ARDA 1Z0JA 2RBEA 4EYGA 5KNCA 3NDBB 4JR2A 1KPIA 3LUTB 4JB2A 1LQUA 3B70A 2Z43A 2WJYA 3S2SA 4K2HA 4RKFA 5JEDA 2OHWA 1CQJA 5E1MA 3IKEA 1LDMA 3L70H 3JQ7A 2YH2A 1FDRA 5KMGB 3PNPA 1K9MW 4XCQA 1ONNA 1ZEJA 2GXSA 1G5TA 3C3BA 3D0KA 3MRTA 3RC1A 3SXUB 1Z4NA 3DWEX 2PT7A 3EVZA 3ZIAD 2HRYA 1M56B 1OY1A 1ZLZA 1PK7A 3VQWA 2OORC 1SS3A 1G20E 1OHHD 1B76A 1SCDA 4HQ6A 3GGOA 3HB0A 4GOXA 4DCMA 4ZHSA 4B45A 4LRQA 1A9PA 3HEMA 4KHPB 2IS1A 2PU5A 2JIDA 2H1FA 2O20A 2APJA 1P73A 5AK0A 5FEUA 2AZDA 1GGVA 3OURA 1XEXB 1AHIA 5EMMA 1SC4A 1V16B 1O1YA 3VDRA 1CUGA 1ATIA 4N3GA 4Q93A 2ZJZA 3S6JA 5K3OA 1H2KA 1VHDA 4UE6A 3TLGA 3T4XA 3MTDA 3WFVA 4FFKA 4GZ6A 4HDKB 4BX9A 1A04A 4YJHA 5HQJA 2D2CB 1DXQA 2XCUA 3NHSA 4PVCA 5I9LA 5HQ3A 3O4FA 2VPWA 1COZA 3R23A 3KG2A 4PRZA 4CR7A 1O94C 1FJHA 5BUQA 3EEBA 5LQCA 4R9UC 1DFGA 4QRIA 4BP9A 4C08A 4ATNA 2VAMA 3UT0A 4CG0A 3COJA 2E6KA 1OXSC 3BC1A 3KJKA 1QH8A 3QWBA 5F4ZA 5LLTA 4GX5A 4F85A 1T5EA 2OGWA 3SVTA 1GQYA 3ET5A 1O4VA 1YJBA 3B77A 5C5DA 2VK8A 2A92A 4KYIB 5T67A 4C8GA 1DO2A 2D13A 2FR0A 4UUPA 4F97A 1QTRA 1XZJA 1KXJA 4MICA 5A03A 2DWQA 3HE3A 1B6TA 5BRNA 3SU8A 2LNDA 3DOUA 1N77A 2AJDA 1I2CA 2HJWA 4GR5A 4E13A 2UZ1A 2HKIA 2HWWA 2JAUA 3CJQA 4M89A 1LJLA 2XUKA 3B60A 1Q12A 5LQRA 5KHHA 2OAGA 2ORED 2ASEA 2DQKA 2AHYA 1G21A 2UUOA 4COKA 4EUFA 1J07A 1BE0A 1AGRA 5T3YA 5GZ1A 2BI7A 1QG4A 3AOEC 4AD8A 7REQB 4EI7A 2JAOA 3BYZA 2Z3YA 1KC1A 3PUZA 3Q5DA 4QQNA 2H8KA 3WLSA 5BYBA 2N75A 2YUIA 1JHQA 3LM8A 2NXJA 2X2EA 4J7XA 4UQLA 4G2TA 4OBBA 1H69A 3IP9A 3L1JA 1VP9A 5CPFA 1N8RW 1X8LA 4DSZA 3WB9A 3SG0A 5HFAA 4B6PA 1TKAA 3THWB 3ASNC 3GPLA 3F8WA 1VL0A 4BECA 5FJ4C 3PJEA 2G76A 1IXZA 1K27A 2OHVA 4QTZA 2HHHB 2VQEO 2EILB 5FOUA 4A8JA 1J0AA 4CV3A 3EHEA 1DKNA 3ZHUA 4WE3A 2I2CA 1XXHA 1M83A 1JRLA 1NN5A 2ZI3A 4LY3A 2V45A 4FOLA 5D3KA 4IVRA 1H1LA 3D9QX 4LJAA 4BU1A 2W42A 3FCOA 1KI1A 1TYBE 2NV2B 1W85B 4TYPA 2WTXA 1E6KA 4WLFA 3KZIZ 1E5TA 3D3WA 4OM8A 4LF4B 2G36A 3R7WA 4YJ3F 2X41A 5AUNB 4TQ9A 2BFFA 5ALYA 5I9SA 4Z7NB 3VPCA 3R20A 3MBOA 3GLUA 9ABPA 4HX2A 3LCMA 5EWRA 3CCMF 2PI5A 1EDDA 4MIOA 5LUBA 1F1BA 1AZSC 2ZRIA 3VA7A 3THXA 4CS3A 1K7CA 4M2LA 1LKZA 2XF8A 4PCUA 3CZAA 1VHLA 5KTRA 1KDZA 4XFDA 3CCQV 1G8YA 1GLNA 4GPEA 3W9BA 1VLZA 2X9GA 2ZE8A 1U3LA 3WQSB 4EYEA 2EINC 2B8JA 3NEPX 1CVRA 5IPFA 5KU1A 3N39C 4FFVA 2B7BA 3ERNA 4IGIA 3DZFA 3QLVA 1FDSA 4JL8A 1MKYA 1U8EA 2ACEA 3JARB 1YE8A 2FW0A 2VJNA 4RHFA 5CA0A 4DFDA 5TQ2B 1C14A 3ZWWA 2YI9A 1CFZA 5LMNO 2ZXWC 4DV7O 2NVUA 3RTGA 5A4DA 2WDPA 6REQA 5B1AC 2R60A 4WFGA 4LX8A 1SUCA 5FBWB 3TRKA 1EX7A 3T1CA 2W2XA 3ETNA 1QLEB 3CCEF 3ETJA 3PA8A 4RJLA 3OI7A 1W41A 3P9PA 4HI0E 4XM1A 5F1OA 3W9YA 3YASA 4Y7DA 1KY5A 1EN5A 1NQ5A 2ZROA 4IJWA 3JQCA 3ZY4A 1ZD2P 3T8YA 2XT0A 4O29A 4X3LA 5JAIA 4X62O 2C7OA 4I50B 3KAJA 3KJFA 3CVYA 1U3TA 1REQA 3WV5A 1U28C 3K6JA 4X7MA 1BNCA 2HS3A 1TIBA 3F6PA 4X66O 3I32A 3IIMA 3LHDA 4O1IA 4RSMA 3M8KA 1RRCA 2DWCA 3T80A 5JT1A 2OZKA 1GA1A 1QR9A 1IBKO 3CY6A 3H1BA 3KEGA 2TECE 4FMBB 4I9FA 1RJDA 2UXXA 4PYOA 4DR6B 1ECCA 3M4NA 1GN3A 2WHEA 2JAQA 3WWPA 5JD4A 1FMFA 5HUHA 4Z4FA 1W4RA 1AZTA 2QDXA 3O8DA 2ISQA 3P2OA 4JJZA 4YHBA 5LKRA 3CLUD 1RPTA 3EMBA 3LUHA 1B16A 4MRVA 2GTAA 5NULA 3LLMA 1N3YA 4YO7A 3LC7O 1G38A 1DFHA 4J49A 3LYHA 2G9VA 1B1CA 5DPMA 3L46A 1WN7A 1LPAB 3FB1A 4CLHA 3C8ZA 5HRUA 4M0DA 4L5IA 1EM6A 3ROKA 3TTUA 2JARA 1PJ3A 3BIXA 2DLDA 3NC0C 1M57B 4FGSA 1YIOA 1EINA 1X19A 3K94A 1VE5A 2LBWA 1CLEA 2UUAO 1A9QA 3OLYA 5ARBA 2NP6A 3D2CA 4LRYA 2WU1A 2H2GA 3ZS8A 4RGVA 4ZDIA 3DEHA 2CNDA 3WFZA 4BQFA 1W30A 4F6RA 1H5NA 4UFZA 2PD3A 2Q99A 2DERA 1QQ6A 3NOOA 5DM4A 1KD1W 2OP0A 2R85A 5EHGA 2ZTVA 1R0WA 2GS9A 3LWOC 4FYPA 5ITZA 1A98A 1GRVA 2HMAA 2HQSA 4RTMA 2IP1A 3K04A 2HTFA 3UGQA 3JYLA 1CHNA 4WNYA 2YYZA 3PEEA 1EB8A 2ZI9A 1XCGB 1K73H 4S2EA 3RR2A 2AG0A 3U9SA 3DYIA 1MX3A 1RHKA 1LBQA 4UCQA 5BWBA 4ZHQA 1XLTA 2FJPA 4U6QA 2VP9A 4RORA 3FSEA 4AJKA 3FSGA 4PYIA 1LW6E 2ETVA 3MHHC 2I6SA 2COKA 2REBA 1EGMB 3OQ6A 3MFQA 3IDQA 4WN3A 5E38A 1QHYA 3JAMA 1SUPA 3KV1A 2QYHA 3QUTA 1HF3A 4NTYA 2Q73A 4O2BB 1NW5A 1WM1A 2NLOA 3G0BA 1Q0SA 4QT0A 4D8VA 1R6KA 2DH6A 4XYLA 4KPEC 2I6QA 4UM9D 2QJFA 1QH1B 3PITA 3QO7A 1W5AA 3BGSA 4MI1A 4QBIA 3C24A 3ROXA 1B8UA 1HFEL 2W0MA 1FTYA 2XKBA 3RKSA 3I9NA 1Z7BA 3QOFA 3JWPA 2J0UA 1GPNA 3LT4A 2FSPA 3ZHXA 4TMTA 1TUGA 3P96A 4YRGA 2ETXA 3VTIC 2R1TA 3OA0A 4EFEA 3TB4A 2R6ZA 1NXQA 4NARA 2JS5A 1JHZA 1T9KA 1TJPB 2LTAA 4A92A 4E32A 3SF8A 2OK8A 4UNRA 3PT5A 4LSZA 1MVLA 4X6XA 4OJTA 1X1EA 2RK4A 1P0PA 3NANA 3KK0A 2H3OA 1N5LA 2WJIA 3EY4A 4Y2QA 3RK0A 4LXIA 1FFBA 2QX8A 4A7PA 4EIWA 4YUZA 1W73A 5KJFA 4K6KA 4F4FA 1ZK4A 1OD6A 4EZEA 1YZFA 4NIMA 4EYQA 4HHEA 1PX0A 4LNUA 1UZMA 3HHEA 1D4OA 1U0HC 3O8CA 1XOIA 2AFVA 3D7LA 3F0FA 2FUG1 2OK7A 3P71T 4BX8A 1DINA 5A5FA 3PEWA 1MABB 1B41A 2FPUA 3T2MA 3VYUB 1CDZA 2R7NA 4YROA 2QKSA 1TW3A 4J1NA 3SBEA 5EO3A 2X1MA 3SC6A 5KJCA 1PGJA 1B15A 3IVCA 3ZMSA 3IQZA 1N6KA 4GHWA 4MWOA 4OIMA 4UZFA 1RXUA 3PGXA 2QL9A 3TX2A 1NONA 4Q7LA 4UM5A 4ZAXA 4W1PA 3ZCRA 2BEKA 2RI6A 2C2HA 1DIRA 3OIVA 1IYZA 2UYNA 4O2BA 4G88A 1SKQA 2ZIMA 3H1TA 3KL2A 3R3WA 1KAEA 4MV4A 4D9KA 1RM4A 1U7TA 2HK6A 4DSOA 3CB4A 4KCGA 2CJFA 1I08A 3JQFC 4ECEA 5KC8A 1FLDA 1NT4A 4YQYA 4CQJA 3M7MX 5KDDA 3T3OA 1NZFA 1XJ0A 3BD9A 4ROSA 2QAGC 2CAZC 1UQRA 5ALLA 2P7HA 2Y0IA 1P31A 2ZTSA 5TSDA 2XZOA 1WAZA 3KQUA 2WM9B 3CF2A 4C7OB 1LLDA 2WC1A 3AUUA 4YDHB 2JFGA 1QMPA 5IM4F 3G7SA 3L0BA 2OPHA 2HA4A 4DIEA 4LXHA 3A37A 4UBKA 3ZYZA 5JAOA 1XNRB 2BLNA 4QSHA 3GLGA 1VQMV 4B4DA 4KN5A 4Z7QB 3AOEA 1DDIA 1GYRA 1PU2A 3HFJA 3L9XA 1IVNA 1WDTA 2AV6A 4MMYB 3IJRA 5F2EA 1VQ8F 5TVKA 1G8JA 1XALA 3T7TA 2W2OA 3TNFA 4CTKA 3IKTA 4DLLA 3FF4A 1SU8A 4XVHA 2J5BA 2QT1A 1AKWA 5E1OA 3TCXB 5DHUA 4WJLA 3UPUA 4IIFA 1J95A 1SCKA 4OBEA 5I48A 4F46A 5ALMA 2F2TA 4RIIA 4Y18A 4MR8A 4H6VA 3K09A 4CDMA 4KZPA 1FYFA 3HFGA 4UU7A 3ESCA 3ONVA 2BSQA 4A82A 3WGQA 4EO9A 2JLAA 2BPOA 2XAHA 4RXUA 1Q11A 3D8RA 4OI1A 3G13A 3SWWA 4I4NA 1QDLB 5GPBA 1KZHA 5C93A 1PLKA 2A9OA 3QX3A 3A3PA 2AN9A 1C4XA 1T6XA 3NCTA 5COAA 4C3UA 4E07A 2J0QA 3JR7A 2GR9A 3KKZA 1DQSA 4FI3F 1O5IA 3RE3A 1XQ8A 1CEZA 4KE6A 1SELA 2JHCA 4P30A 5BN4B 5FWNA 4GC5A 4DQDA 1SZJG 2A4KA 2Z3WA 2HRBA 1A2OA 3K0FB 4EVQA 3KZ1E 2C2KA 4M1EA 5C1BA 4P35A 1FU8A 5CCDA 1UJNA 1VKNA 1GXSB 1MIHA 3A1UA 1VRVA 3N4YA 3MRSA 4TTPA 4B82A 5CFZA 5CLJA 5K3EA 2C04A 3SLRA 4HGNA 5CAEA 4UDYX 1K5HA 4M7WA 2BD0A 2AKYA 4FHFA 5JNWA 4AJIA 2SNIE 5J4HA 1TA8A 3PQDA 3H1EA 4Y0AA 5CD1A 2WHRA 2X6BA 4R71A 2RHDA 1ZD3A 3EN0A 1XI2A 4FIPC 1GUBA 2ANCA 1W34A 3I01A 4KLNA 4N39A 3TZQA 4ZT5A 4BGVA 3K9FC 3AL3A 1SXJE 1W4BA 3UJ7A 5HOQA 5DEDA 1ZWKA 4GT1A 2DLNA 5JSYA 4BZXA 3GLGB 3K2XA 1SXJB 2ID4A 1XK7A 2XZLA 3DFFA 1U0EA 3R3YA 3SQNA 3C5WP 2XBUA 3NJ4A 1T9GS 4LCJA 1XTTA 4YAFA 5AK3A 5H80A 1SEVA 2OQRA 2YW9A 3PT9A 1JE1A 2X6AA 1EH5A 1OGIA 2JFZA 3NYIA 5F77A 2OKCA 4I4LA 4YN3A 1XROA 3VVLA 5C7OO 3PX3A 5EVCA 2FYUH 1AQYA 2JEUA 3CX5F 4JBWA 4CKEB 3PQFA 2I34A 4DLAA 4U7DA 5DEOA 5EWMA 2O3TA 1YO6A 1EDOA 1K3EA 1TVKB 1MT0A 2GNOA 2GVNA 2KE5A 3C39A 4JIGA 4EEXA 3WK9A 1KXZA 1AQ6A 3H16A 2VIIA 3A32A 1YOVA 5L7TA 4UVCA 3N9IA 3HB3B 3OZ7A 5ICGA 1VCNA 2WTMA 1M6YA 2P4EA 2BAGA 3L8YA 4PR0A 3T7SA 4NPAA 4D1YA 3TFWA 3SQOA 1VI5A 2QU8A 3NJRA 3UB2A 4D0NA 1H2NA 4JVLA 2E4XA 2WIBA 4IDPA 4Q21A 4ESHA 3LC2O 5K6AA 4ADSG 1YZGA 3B13B 4OCZA 4KK4A 2Q5QA 3DB1A 3HGQA 4H0FA 5E2AA 3L0DA 3SS8A 4ER7A 1HDEA 1P2TA 2D1FA 3DGFC 3GRCA 3O7MA 5EIBD 4KQ2A 4TTQA 2DKNA 4E2ZA 1G5QA 4RLQA 4IJUA 1PZMA 5IG2A 4K3VA 2EIJC 3M5DA 4Q7KA 1QVFF 1U99A 2PYLA 3AJDA 1JLSA 3CKKA 5IYCO 3A6KA 3FCCA 5JJ5A 2VAPA 2JFFA 1Z35A 1JDZA 1RYFA 3K0DA 1MC4A 4EB0A 3FNGA 3LUGA 3FHJA 1NTOA 4R84A 1RXCA 1P5HA 3I55F 4NK4A 2IEYA 2MHCA 1KP9A 4D4IA 3DOEA 2KG7A 4FFLA 4HDMB 2G5CA 3RRJA 1U9IA 4AJ1A 3FF1A 1F3LA 3D8HA 4B4UA 1NVFA 2Q4RA 3TLGB 2ZVDA 1QK4A 3TW8A 4AS1A 4TL9A 3RC3A 2RE8A 1CY2A 2P9FA 2AE2A 3NHKA 1XMXA 3S3XA 4DXAA 5ICEA 2YYSA 3L8MA 3AV3A 3EVNA 1K5GA 2EKPA 3DT6A 3PQ8A 2P6YA 4ZREA 2QYTA 4BZZA 3T5AA 2QV7A 3F6MA 2CSUA 3N6RA 4LJ5A 3WISA 5M7EA 4B3XA 1Z6YA 1BDMA 1XX6A 1ZUD1 2H3EA 3P9SA 3DLHA 4PHZA 2IXAA 1SPXA 1A1VA 2DTEA 4YMIA 1GZ6A 4DMFA 4KTTE 5I4CA 1HQDA 1BDBA 4J41A 3ZMVA 1L5HA 3H9EO 2N0SA 4UMFA 1U7WA 4ZV9A 2GN2A 1OIVA 3GFFA 4TKVB 4CTOA 4JUFA 3GP5A 4ZOEA 3D36C 2GCNA 4GM1A 1JHRA 5FLYA 3Q72A 4KKXB 3GD5A 3WWCA 4AG6A 1DHRA 2P9JA 4QM7A 1PYDA 4F1KA 4QXAA 5BWMA 4UVIA 5FPPA 3EIOA 2IEAA 3BF8A 4B47A 2QTCA 1A7UA 1KGDA 2CDCA 3LGAA 3VYSC 1Q3KA 4TPKA 1DUVG 5E0OA 3Q5GA 2H4XA 4QLBA 4WFJA 4DMMA 3TOZA 4Q3DA 1VPTA 2E1PA 2PUVA 3H1IH 4WIAA 2KWIA 2QRJA 2WFLA 3D2BA 3DAYA 3HNRA 3QEOA 4U7PB 4QO7A 2UXCO 5TLSA 3KALA 3U6KA 4MCIA 4A03A 2JZNA 4GP7A 3RLFA 3MS4A 1KU0A 3W7XA 1XDDA 4XQEA 1W9HA 4BFCA 4R3UC 3FFTA 1GPH1 5LMUB 1JALA 3Q0IA 3JD1A 2A7QA 2NYRA 4NTZA 1BGYH 1CS0B 2FG5A 2FWNA 4ZAYA 3CPSA 4RD2A 3QE4A 4L50A 3U3DA 1YTFD 3R0XA 2HWKA 1UKVY 3JQQA 1O6FA 3OZAA 2ZTLA 1FDWA 3JYNA 3U9LA 2Y1LA 2QW0X 1AP5A 1TF2A 2P4SA 3PEUA 4KVAA 1WD5A 3HB5X 1E1KA 1LJUA 3I58A 1KGSA 2HOQA 2BDTA 3N7TA 3MJRA 2IU0A 3D6HA 3N86A 5U4QA 3I0ZA 5J58A 5BW5A 3BJEA 1DAGA 1CUFA 1VCIA 1BH2A 1U8UA 2E9SA 3H9QA 3E8XA 3I05A 3U2QA 4D3XA 4DVJA 3AIIA 3X2EA 4NCAA 1GKYA 1YOBA 2G7ZA 1GNTA 3JRNA 1QGDA 1WBBA 1U1FA 4FM1A 2R7AA 1XKTA 1TC1A 1YB4A 3L77A 3E22A 1IURA 2CB0A 3O93A 4PFQA 4PV1B 4ALMA 1MJHA 4C6TB 4YMLA 2Z1DA 3GP3A 4BIZA 2G0NA 2YVQA 4L9SA 3HR4A 1DJQA 3FWZA 4UASA 3QITA 1OH8A 2GSMB 4YDQA 1G59A 5DGIA 1OWLA 2C2GA 2ZUVA 3UJ9A 1Y4UA 1M8FA 1VG9B 3OEHA 4NE9A 4XYGA 2B30A 5G40A 4ENWA 2NNUA 2IAFA 1NJGA 3RC7A 1V43A 1Q74A 4BPRA 1VQ6V 2C4UA 5HUJA 1J1UA 4FLTA 4GYJA 1ATZA 4PZLA 1EM1A 1ZJYA 4DJFC 3M3PA 3CPEA 3TB6A 5G0UA 3WKCA 1X13A 3V8NA 3EPKA 1RHUA 3Q8MA 4IS3A 1GTZA 4MI9A 2PH3A 1GL9B 1YOVB 3ESAA 3NKLA 5LP6C 3IIEA 4GAEA 1A9RA 2JJ8A 1PJ4A 3K2EA 4H3KB 4NYIQ 3RAPR 1CN7A 2H9YA 3A7DA 9ATCA 5JCOA 2RGNA 3QYFA 2OM6A 1ZWLA 3KJJA 1YVEI 2AT1A 3GPDG 4BNKA 3E7PA 1E62A 4DG9A 4G27B 3HCBA 1U94A 1HGXA 3NOQA 4KBYA 4ZT2A 4ZC8A 3NO4A 5JV5A 4C0AC 2R1UA 4C6SA 4BBJA 3Q1KA 3NVMB 3S5UA 4FJ0A 1QRTA 3SPHA 3VKHA 1ZICA 2X5XA 1HX7A 5A4FS 2FXIA 2LFSA 3N87A 4XBFA 4JI5O 1ESZA 2EFDB 2J87A 2MYPA 2VJQA 4KN6A 2XUHA 3ICCA 4FHZA 1RQ2A 2DJ5A 4PZDA 1WP9A 3VTKA 1LV7A 1JAIA 3R24A 3ON5A 3JALA 4K26A 4US2R 3HUFA 1GG9A 3OU7A 2FL4A 4DANA 5A4AA 5FOXA 3RBXA 1XJ5A 2JLQA 3QX8A 1KBZA 4DMHA 5J2UB 5F4BA 1NUAA 4DIKA 1KH2A 1OJHA 1BU8A 2C92A 3A7EA 4D3FA 3WJ1A 621PA 2Z9DA 3WY9A 2VHVA 3NHLA 4QJFB 2WWYA 4I4TB 3CCUV 1X80B 4FGZA 1N5OX 4IMIB 4WLOA 5DNCA 1KDRA 2VN8A 2PVSA 4G0ZA 4JLUA 5TNXA 1SHTX 2QI2A 4AG5A 3FCUB 3ZMTA 1XTPA 3QX7A 4FNMA 4L8GA 3VR5A 3A28A 2ZI4A 3ROFA 1TJ5A 2XYVA 3CPQA 3KKQA 5CB4F 5JC8A 2YOHA 4YRCA 1BHQ1 4KK3A 3KLPX 5IYZA 3TXAA 3K3PA 4BLQA 5EK0A 1ULSA 5FFNA 3NZEA 5EJMA 1E3MA 2Z8XA 5AI9A 5ITWA 5IXYA 2AHZA 3PNBA 2PQ2A 3SGIA 2A35A 2BF7A 2GYVA 4IXTA 2PMEA 3ZCVA 5J4LA 3KHNA 3CN7A 5B12A 1Z5ZA 4EY5A 3LQRA 4LFBO 4GOND 1CUCA 3CP1A 2HB6A 5K4HA 1T3LA 3LK6A 4GUDA 2XEXA 3KHTA 4KQXA 3UK2A 2HF2A 2J5QA 2JFPA 4GKJO 5E3IA 1SIBE 1NI4B 1P44A 1T35A 2PKQP 2LQTA 5ALUA 3QVOA 2GZAA 4YC7A 1Z29A 3A58B 3B6ZA 3STXA 4QTUB 5J1SB 2G7MC 3QVNA 1E2NA 1S3GA 2A0YA 5EG5A 3TGWA 1EUQA 1XWWA 1CZLA 2YX1A 3E05A 4XCXA 3RJ9A 4Z0NA 2VUTA 4MJ3A 3ZDQA 3EX7C 3JVDA 2B2NA 1YBAA 3B51X 2BIFA 3NAGA 3OAAA 2IL1A 2ZIEA 2LW1A 1JLHA 2YMPA 5B2FA 3K15A 3WC4A 2PUCA 3JTEA 4FINA 4FS3A 1W8IA 1QNMA 1DC3A 3EJWA 1HQYE 1PO7A 4MUKA 4BJHB 5DT2A 1UBGA 2WLLB 1WCIA 1Z18A 4Z5XA 2GWRA 3ND7A 5IT4A 1JHPA 4WCFC 3SN6A 3K12A 1T8UA 1LTKA 2CGNA 1GNSA 4RJIA 4ZP1A 5AVKA 4AXXA 2XSZD 4PYMA 3CG4A 3F7OA 3RAFC 4NYMR 3CX7A 1GNPA 3PC3A 4KC0A 4OFWA 1EHYA 3SYKA 4GSKA 1DVRA 2C7GA 1QRDA 2Q8PA 3WWEA 4OHVA 1W2BF 1XZQA 1ETUA 5CBKA 4ZKIA 2B1JA 3P20A 4RTLA 1NNI1 4L6IA 1TU3A 4O59O 2J07A 3RVNA 2PVCA 4UFNA 1E2QA 4NZMA 3LQ2A 2QORA 3ETHA 5SYMA 1JMKC 3ND9A 3LFTA 1CEXA 3ILXA 4DW1A 1B6GA 3EHDA 1JL3A 3DFUA 2QY9A 3LLCA 4KW7A 1T1RA 1U2EA 4TKUA 2QTZA 1SKVA 3GRYA 2VP5A 4B3SO 4YWJA 5B1IA 4CF4A 5AW7A 1H94A 1VYHA 1X1DA 2ZAOA 3DM5A 4YJGA 3RVPA 4UTPA 1V5WA 5CB0A 5LIPA 4A0GA 3GJ6A 3ZV5A 2CXOA 3L92A 2GB4A 1KRHA 4XGNA 3TSZA 1SD5A 2KJQA 3KZCA 4F4HA 4BP1A 2F62A 4B85A 2HJHA 4ZHQF 1XZCA 3AIKA 2FSSA 3PUXA 1YC2A 4V0QA 3RS3A 4I2NA 2IYPA 3SEAA 1GL7A 1IJKA 1B8OA 1N6PA 4TV9B 1TQDA 2BFEB 2P35A 3H4VA 3U60B 3F5SA 1VQ1A 4LHSA 2ARHA 4L4ZA 4LPKA 3RSFA 1V54B 3QSGA 4BLOA 2YCLA 5CBPB 1GT6A 1KC3A 1N2OA 3B52X 2R6CA 4ISCA 1WSBA 4KQKA 5DM1A 2PR2A 2H2IA 5A4IS 3ZK8A 5FBRB 4MW2A 2AIFA 4TN1A 2ZIWB 4ID3A 1I01A 4I1IA 1OXVA 3TEJA 3V1UA 4DA4A 3NT5A 3G0CA 4BLVA 5GONB 3MB8A 2ZXWB 4UUJC 1GFZA 1T9GR 2A84A 4Q18A 4BJ5A 5F23A 2IYNA 2IELA 4RX1A 4A8PA 4AF6A 3PUJA 1UBLS 1AHHA 4RKYA 3HDVA 3ZHTA 5AHOA 3AVXA 2E7ZA 3NHJA 1OLSA 4L15A 1MU0A 1UC4B 1ZOPA 3JQBC 2I6TA 5L3EA 1DBVO 1ULTA 2XVMA 2ESRA 4OGKA 4BWGA 3C9TA 1VF5B 4B43A 3DSQA 5JZVA 1GSOA 2GPAA 1UBKS 4PYNA 4CFZA 4E0BA 3GD7A 4ZV4A 4M83A 4MP6A 3U6BA 2HT1A 2I1LA 4MPTA 2KTUA 2QSYA 2C2XA 5FOTA 1FJGB 5LDDC 3FTCA 3FTFA 1UJ2A 2YXLA 4KXMA 1H8EA 1NW9B 1IXYA 2YWCA 1OLUB 3UOGA 2OQIA 1E5QA 4XB2A 5AVOA 3ANYB 4E5KA 3RRMA 3V4ZA 1GZ3A 1U31A 4DIBA 5KNBA 1WVMA 3A6EA 3EOAI 4ZYYA 3AIMA 3VAYA 5JNSA 1OHHA 1YZBA 5LM3A 2A79B 2R1VB 1JSXA 1VE1A 2JVDA 1M1KH 1WUIS 4XDLA 2ZRCA 4BQSA 4D9GA 1P0QA 3DHNA 2RC5A 3VZPA 3ZJ5A 4G5QA 1M10A 3BL6A 4KBFA 3L72H 5HEKA 5B1SA 3WLNA 4F45A 2CD9A 1H8HG 3SJZA 3U4HA 4KREA 2KSQA 4GMGA 1NASA 4GZLA 4P7JA 4ZO7A 1EVEA 4TXHA 2ZP1A 2VF8A 5SY6A 5JTTA 3H83A 4Q9JA 5B3JA 3ZLTA 7REQA 4WZAB 2R66A 2PA3A 1E8NA 2BKXA 2WYWA 2ZJYA 3WK8A 3ZCTA 5C5CA 2PDAA 4KP7A 3AR4A 3GDGA 2G1KA 3J80M 3AEXA 3HP7A 3SHFA 1KOJA 4AUEA 2VRNA 2FTKE 3NIDB 3E9DA 1G4AE 2P30A 2D4HA 4EPWA 3KSMA 4CIDA 1UINA 2EYQA 3V4PB 5I4IA 1R6VA 1RKXA 2QL7A 2DWDC 4O33A 3ET4A 3COZA 2PZJA 3VC1A 2C54A 4R50A 1KTIA 4PHGA 2BM1A 5B3AA 4C05A 4YPOA 2ZUFA 1QOQB 1MR3F 1MABA 1PSZA 3VKVA 3GJYA 5IARA 1MJFA 3BYQA 3SDLA 3NVDA 3G85A 1MNGA 1ZUHA 2O2GA 5KJEA 3UMMA 1U0SY 2WJAA 1LRJA 1O6ZA 1O4WA 3D59A 3ZHSA 1SRQA 3IT1A 3K1AA 2BFOA 4LQ4A 3T99A 3RVKA 1JVMA 1ZUNA 2ZRKA 2H63A 4BXOA 3L0CA 5F1YA 3MTQA 2FP4A 2OV2A 3A1FA 1OYVA 3WNVA 1FX0B 3UMGA 1A2QA 1UDXA 3HVJA 3AJEA 2ZKIA 2YL2A 4Q34A 4OAQA 4JUBA 1Y76B 4N5DA 2WJZB 5D1HA 5ICSA 4TUYA 4WADA 3AETA 4IUCS 4B9EA 5HOEA 3A1WA 4K40A 3QEKA 4RH1A 4UHDA 3TLBA 3EGWA 3VTFA 2OCAA 1TAGA 5CDFA 3LXUX 3ROGA 2GN9A 5AW8A 2SKDA 3QRWA 1E77A 3WL5A 2QN6A 2HD4A 3C70A 3MWKA 3LA8A 4JA0A 4BASA 2IXTA 1VQ9V 3O3NB 5DASA 3JQEA 1ZR2A 1NU1H 3KXPA 4F8EA 5KKCA 2BM0A 4GL4A 1Y74B 1ADBA 1YZ3A 3AERA 3AF1A 1UUFA 4HWKA 3MS7A 4JOQA 4RJ2A 4RESA 5KQGA 4ZTZB 2Z2KA 4RSHA 2QTGA 3SJUA 1MX5A 2IHNA 3E9MA 5FWXA 2WKRA 1R00A 1XL1A 1JQ5A 3TXYA 1U5BA 3ZHVA 3V1NA 2QF7A 2CJPA 1CUZA 3B12A 3JQGB 1U7OA 1JHDA 1M1ZA 2NO6A 3CVOA 4BWFB 4J42A 2DFNA 4EPVA 1V71A 2HMUA 4PLHA 3ABRB 4E22A 4DLTA 4BB0A 4FKZA 3BMNA 3FOFC 2NU7B 1P33A 2PRKA 2WTEA 1UJBA 1T2AA 2XQGA 4FP9A 5G0SA 3DEAA 2X8BA 4PQFA 4U9HS 2AFIE 1VRWA 4Q3EA 3ELBA 3ZZ1A 1OWMA 2Z04A 3P97A 1JDVA 4J8PA 4OKNA 4ZOQI 2PUWA 1L7PA 4RXMA 3F97A 2IYEA 4YQFA 4OXYA 2Y76A 3RTDA 4P2ZA 1DZIA 5JADA 3B09A 3DCJA 3O1LA 2JEZA 3R3UA 4M9XA 3V2GA 2AMYA 4E21A 1AKUA 2AC2A 3LPAA 1MUUA 1FFXB 1UMDA 2CLOB 3MT9A 4TTVA 1FDIA 4BVEA 4DUGD 4CMGA 1HYBA 1I2MA 3O9ZA 2C59A 3W4JA 5BPHA 3U0VA 4DL9A 1SDSA 3DBHA 4L8FA 4M6WB 1E2PA 4MR9A 4E46A 5HJEA 2ISCA 5LSAA 3BE8A 3MCUA 1VPDA 5F2KA 5C35A 1MIOA 3PNYA 4XJVA 5DYGA 2YIBD 3U0BA 1H6AA 3PQEA 2C2MA 3DZCA 1EDEA 4CL3A 4EJ0A 3EEQA 5BWNA 4QD3A 2L2QA 3EW7A 4HH3C 2GZSA 4LXYA 3G80A 2Y4OA 2QT0A 2QI9F 3PGLA 3DBLA 4FYJA 4Q1DA 2ZUUA 3TQOA 3ZBTA 4F9FA 4N6OA 4FMTA 1MC8A 2YXDA 3CW2A 4D8WA 5E2IA 1U28A 1Z13A 2OTJV 1YR7A 4RY9A 4X45A 4V2IA 4JJGA 2KW5A 3A27A 3BGIA 1TA0A 2ZANA 3QJGA 3PXGA 2ITDC 3ZBUA 4B44A 3OQBA 1NVAA 1EFRA 1GTL1 3GLHB 4Q3LA 1TT5B 3BWVA 3JWGA 2VDRB 1HTWA 1LSSA 3ML0A 3EARA 2VF4X 3VOUA 1I5EA 4P7BA 3CD6V 4R0VA 5AK6A 2W2PA 4G1FA 3A14A 1IPHA 3FTEA 2V6JA 1F7YA 3NU1A 3LBYA 4MVJI 2WA3A 5F21A 2EULA 1XDWA 1SOMA 4MCHA 4QPJC 1N6OA 1Q1EA 3UGJA 3WP0A 4WN9A 4HSGA 4HN9A 1U2RA 3VMMA 3OEYA 2WG2A 3BWXA 4XX1A 1MX9A 4K6OA 2ZBVA 2JVKA 2O0JA 3ZE7A 2P4VA 3DDWA 3EDMA 4YJ3B 3HSKA 3HU5A 3KSDO 4QDXA 3DHWC 1W76A 4EW2A 1PBTA 3MQFA 1VZ3A 1KJIA 3EDOA 3OFSA 1IBKB 1FNMA 3KPVA 2C29D 2QTHA 2YVUA 1YVWA 3AF2A 3TM5A 5FTLA 2XVZA 3OGIB 4X8LA 2G4VA 2NUPA 1K98A 4LWZA 3T1YB 3NAMA 2WD7B 4K9PA 3L7MA 4IOKA 2Y0DA 4U7GA 2HCBA 4ZI2A 2PH1A 2H8PC 5BY1A 3DV0A 4Q6GA 1HL3A 1N5RA 4ZVSA 1VKJA 5CLIA 4PX5A 1SXHA 4Q4AB 5EJ7A 2UZIR 5E7JA 4W8HA 4OHUA 3AZPA 2BM8A 1VQVA 2HV9A 3OT4A 1S8NA 5FUQA 2CDBA 3RYIB 5KVCA 1NLYA 3IUNA 4RHUA 2I1VB 2FQ1A 3D4IA 1NX6A 3OEEG 2XMRA 2EATA 4B4OA 4C0WA 1YD7A 4KSYA 4U6SA 2Q4EA 3FVRA 3Q7QA 1CQZA 3ONEA 4QNNA 3G7NA 4AS3A 1R5OA 3LWRC 4H3HB 4UCFA 3RANA 1TEVA 4L5CA 3WMWA 3V8PA 4YRIA 3AG7A 1VQPV 2YV2A 3L1IA 2PUFA 4CQNA 1XTUA 1U3PA 4ZTBA 1F9EA 2J59A 1XHXA 3E3OA 4TL8A 4D44A 4YJ2B 1P2UA 2PV0A 1JV2B 1WZEA 4IWXA 4AZSA 1KA9H 3KU4A 3CHXA 2ZOVA 3U62A 3C8LA 1W96A 1K4DC 1GSHA 4DA0A 5B3LA 1Z4KA 2V6FA 3OQ1A 1OIWA 2YJ5A 4JBLA 1TL7C 3AEKA 3NOXA 3ZGYA 2Q1TA 3B3FA 3IP7A 4R3WA 2XODA 1CC1S 1V45E 3QHAA 2FRXA 4TUYB 2CXQA 4IUDS 4B2LA 3DBOB 4YMHA 2IJJA 3RA5A 1A71A 2Z9BA 3GBVA 3W2FA 4R7GA 4B71A 5JBQA 4FVMA 2Q5HA 4DK0A 5FLXN 4WAUA 3AG1B 3LSQA 3SJ7A 4BNYA 4IHJF 1HO3A 3AWDA 1EDZA 4F86A 4U7NA 3E27A 4EP1A 3KB8A 3GA7A 3FDZA 3HKBB 3RH0A 2VAXA 4A0HA 2VQEB 5FV4A 3BFVA 1EP2B 2B20A 2ET6A 2NN3C 3FCYA 4WBSA 3R09A 5DULA 1D4FA 2Q9BA 3MRVA 2ADPA 2ROQA 4PHFA 3PNMA 5FB3A 1KRWA 3R0PA 4WJKB 4G1BA 5BR8O 4C87A 4UOZA 4TX1A 1OGYA 4DHEA 2XXAB 1H66A 3G9QA 2PWBA 1E1CB 3LSUA 2OAQ1 2YV5A 1BDJA 3IOBA 4LQLA 4DG5A 5GADl 1Q0RA 1X3LA 1VQPF 5K3FB 3JU3A 4JJEA 4UCSA 2BEWB 1BZKA 3OCWA 3R44A 1DARA 1V11A 4HT3B 1SCAA 1UDBA 2IIBA 2E82A 2ZR9A 1JMYA 4RWEA 3EG5A 3N58A 1AOXA 2YXEA 3LX5A 4IVQA 3RVLA 4X5OA 4YCAA 1JECA 1I30A 1VDZA 2I6GA 2PL3A 4L74A 4CIVA 3QU5A 3AGQA 3HJRA 3KJNA 3M1YA 3P9KA 1BO6A 1PUJA 1NNUA 2KB1A 4M1SA 1KMHB 4FFDA 2V7XA 1CJCA 5HE8A 3INRA 4BO3A 1WQ4A 1ROPA 3ANMA 3KELA 5JPDA 1F48A 2BY4A 2WRZA 3UJHA 2ZCJA 3PK0A 2PI4A 3L4EA 4RUEA 4IGGA 4PHHA 4TWBA 4G24A 2B34A 5ES4B 3DJFA 2DTDA 5JJCA 3S8YA 1YDXA 4X95A 2ICAA 4JI3B 2Q4PA 2VS0A 1CUXA 1P2BA 4ME6A 4AZTA 1RABA 1NMZA 3GLFA 5BQXA 1S2DA 5DW3A 2F9ZC 3MDSA 2ATVA 2JI4A 3QEMA 2VDVE 4JS0A 1G5IA 5DTQA 1C7JA 4MVRA 5CH8A 4OB8A 3F7NA 3H13A 3H86A 4IH1A 3LQYA 2D06A 2NU8A 3WNCA 4M99A 4FOOA 3RS4A 4QOFA 1OI4A 2WTNA 3NX4A 3NK6A 1VIAA 3QWFA 4ITRC 5NLLA 4DSAA 3RA6A 3IAAA 1VSQA 1S7CA 2DWOA 1NURA 4HNAA 3NNNA 5GINC 1KY2A 3QKRA 1ABEA 1G0NA 5EPOA 1JYSA 5BN4A 3NKFA 5TPZD 1YEWA 1NWCA 4RE5A 1TVCA 3P0IA 1Z2OX 3UVEA 4Y2UA 3W06A 1AQIA 4K6GA 1Z34A 2ZJAA 4ER0A 3HXQA 1KMQA 3O91A 4Y2YA 4QARA 4ZQIA 3TLCA 1Z5UA 4Q3CA 5DTJA 4V1CI 5HHTA 2ITCC 2X8JA 3QLJA 3I2IA 4RWZA 1NLZA 4FOTA 3CCEV 3QG1A 3LDEA 1BIFA 4EAAA 5JUWA 4YFYA 4XXHA 3R9XA 4AJ4A 3WTBA 1AR1B 4EG1A 4NFYA 5BWOA 4DEXA 4R2WA 3NOVA 1IZ3A 2GAFA 3LE8A 2FKNA 1IZ7A 1C4WA 2FWAA 2P3OA 2PLFA 4MV0A 5TC4A 3TETA 2AI2A 4CF6A 1BKYA 4EKGA 3NI2A 1YJWV 1NMSA 3B4SA 2PYIA 3NG1A 2CTRA 3SHTA 3OZUA 3W8DA 4EA6A 4Q4JA 1K7XB 1FE8A 1L5OA 4UPEA 3TLYA 1IY9A 1ZXBA 5ENDA 4DXDA 2FN9A 3QVJA 3FD6A 1PGOA 2ADOA 4B7KA 5AK4A 2IXEA 5CMLA 5E9JA 3ZIDA 2B5UA 2PZFA 3KQQA 4Q16A 5KSZA 4BO1A 2DR2A 3PFWO 4Y2PA 4MB2A 4G8CA 2A6PA 3K0AA 3TL3A 3KCYA 8OHMA 3WA7A 3RIEA 4X8AA 4HUQA 4RWUA 3B6KA 3UAYA 3W5VA 1NH2B 4BNXA 5MN6A 1K5DA 4DQXA 5AM2A 3JS5A 3II6X 4A16A 1ENZA 1ZM4A 3H04A 4PZUA 4J3NA 1GTOA 1IXKA 3JZDA 1JZSA 5KPDA 3GQBB 5C34B 1BQEA 1BMFD 3CUTA 4ALKA 1K3TA 2PFKA 3EVDA 2D2FA 2HA3A 1MABG 2CNOA 4M9QA 4UTXA 2UXDB 3OM1A 3QP9A 3SPCA 4MS2A 3DAPA 2GZ3A 5KLVH 4JTDB 3OM0A 2QUIA 1N2EA 2Z3VA 3LLUA 3MB5A 4JBYA 4CLDA 2E76B 2PSEA 1HE3A 1X1CA 1WNFA 4O2RA 3QKRB 3LG2A 2Q1SA 1WSAA 4CM8B 5I01A 4FFBB 1LLQA 4D9BA 1N2SA 5DHFA 1DO0A 3LF1A 3L01A 3RJZA 1KKUA 3DKPA 4IRXA 4OSPA 3TAUA 4J7UA 3WWYA 1SXPA 4BO8A 3D7MA 3FZGA 3Q6MA 4U0JA 4PLCA 4GDMA 5T7BA 2L17A 3ITKA 1J1ZA 4PD4F 4LWQA 1R16A 2QMQA 1XRPA 3G9TA 5GIPC 5CJ2A 5CNKA 1II9A 1B0UA 3NHFA 3RUPA 4YQZA 2OP1A 1DF5A 1IRXA 1AG9A 2X3YA 1ZA2A 3SYTA 4ZOCA 4F3CA 1RLGA 3K5PA 3H5OA 4DCVA 5JMOA 3B9QA 4Z1MG 2UYGA 4KQMA 5ANRB 1ZX3A 4QPPA 1FMTA 1AUXA 3OR7C 2BWJA 5H3CA 3UH1A 1ZNXA 1BRTA 4ZYTA 1MO6A 1SUIA 1L3CA 2ZRNA 3ROMA 3PJSK 1ZONA 2F8SA 2GBLC 3KUCA 4BW0B 3OTHA 1IH8A 1JQDA 2WZCA 4EGJA 1PWZA 1II8B 2Q45A 3QMVA 3FSJX 1PFGA 4Y2GA 4I66A 3SF8B 2PO7A 4F06A 2HK7A 5CCBA 4ROTA 3DEKA 1Z74A 2EG5A 4C4XA 4WFKA 2F1KA 4JI3O 4WMLA 5DXJA 1EFKA 3E81A 2EIMB 5TMEA 3TAHA 4BE9A 5TS2A 4DQ0A 2ERCA 5J9PC 1R0SA 4GE3A 1S8FA 1Z45A 4WXMA 1D2MA 1P8JA 3MGBA 2ATEA 2EX4A 3F1KA 4OLJA 4PZPA 1H2YA 3SC3A 2MMCA 2W0SA 3AR8A 4EWLA 1EUZA 1N1MA 1HP8A 5HUQA 3U5TA 5IFLA 1TUBA 4HQLA 4BNDA 1QONA 4MKIA 3PQ2A 4MKGA 1HDCA 2UVDA 3WICA 4R51A 1I36A 3ZWBA 4D43A 3O4HA 5EESA 4CLRA 2YBDA 2P0EA 2D0DA 4ENUA 1PJ8A 2FUG6 4RTNA 5FWYB 1FSGA 1AN0A 1H3FA 1XDCA 2H6EA 3A4YA 3QHQA 4LJYA 2A3RA 3T7AA 1E7WA 3STLC 4JI1O 1KR5A 1MOQA 1T0KB 1XTJA 3GOQA 4P31A 3WP1B 4YCMA 5I7UA 3LT1A 3WXMB 2E37A 2QT9A 5AIAA 4Q37A 1DX9A 3FDFA 1Q1ZA 3E7WA 2OO7A 3VR1A 4MNTA 1U7ZA 2VZ9A 2FE1A 3WGKA 5BR8B 1C9JA 1O6BA 3C14C 2VPQA 4L3WA 3CC4V 1RMTA 2WF5A 1BE6A 1IY0A 3HPLC 2WUWE 2Z4TA 3JVEA 1KI3A 4UD2A 3RSSA 3I0MA 1M5RA 4PHTA 3QV2A 4FQ8A 1ILEA 4XOIA 4AJ9A 3AVYA 3OHPA 2FGKA 5F52A 3FGNA 1N8SA 2Q8VA 1E9BA 1NT2A 5AXAA 3VO1A 1NOJA 2WF9A 4BMZA 1CE8B 1EWQA 4KFMA 5CVUA 1MJGA 4O1HA 1OU4A 4LDRA 5FUMA 4MV3A 4X1YB 2JIZA 3ZBHA 2W2VA 1NA5A 1F0KA 4HQKA 4DM4A 2ZRLA 2VF2A 5EEHA 3K6KA 5CYGA 4PR3A 3ETDA 4MV6A 2GXQA 3T3DA 2QSAA 2KQUA 4K8XA 5HTKA 3OE7D 1B0PA 1PL7A 2O5RA 4NZ9A 1Y98A 4EABA 3M8AA 1I13A 3ZVMA 5LPNA 1JR3D 4HFNA 4KVGA 2ES4A 1FSPA 4N18A 1H9BA 2WOJA 1W4LA 3ILYA 4H33A 1WZCA 3ORQA 3V4OA 2CN1A 2XB8A 1FS5A 4KPGA 2ZDHA 1HLFA 4LZLA 3GAAA 3HK2A 1PN3A 3EAGA 5DBOA 5EIEA 4YQEA 3CPHA 5AHXA 3EVAA 2BEUA 3TR6A 3E5RA 4URVR 2MSEB 2J1LA 2IYFA 3N5CA 3UAWA 4LSWA 1MV8A 2IYXA 3IKLA 1HDRA 1PHRA 3IV6A 2FMXA 4KXXA 3ZQKA 3HNOA 4BO5A 4S3MA 1NVTA 2C07A 3WGGA 3F5MA 1B43A 1W2WB 1Y8RA 4XPZA 5HR5A 4AILC 1QFYA 1JF8A 1UEIA 1Z4JA 1RYDA 2HF8A 1WDKA 4HXFB 4DZZA 3RFCA 5LJIA 3GV0A 1QV6A 3EZ2A 2B1RA 2WYIA 1X92A 2HUNA 4QYSA 5DH9A 1FQOA 1N6HA 5CD9A 1XD2B 2J0VA 5ENZA 1FRFS 1GFIA 3TDKA 1JWAB 3SKXA 2Q3DA 3AM3A 2BFEA 4OF4A 4K88A 1N3LA 4RK1A 2LW7A 3TTXA 4HXEB 1AI6A 3G2MA 3W5AA 2I67A 4ZGGA 2BH2A 1D9ZA 2C9DA 2VRWA 1M1NB 3WGLA 2F55A 2GN1A 4U5QA 1XZAA 5KBYA 2Q3LA 1CUUA 4RUFA 1UP7A 2O6HA 1N5DA 3AG2C 1TZBA 2I71A 3M9XA 5E9QA 4PDLA 4U3JB 2DZDA 3TR0A 1VHAA 1MFZA 1RJEA 2ZBFA 1UBSB 3MTAA 2E4AA 4BWVA 1N2CB 1HDJA 1FVFA 2PTMA 2Q9AA 3FMPB 1FXSA 2ONZA 1PJAA 4IILA 4YBRA 1V95A 3PGMA 1IC6A 4MS1B 2A3NA 4KPUB 3CC2V 4BT5A 3Q3VA 4GPAA 4R1MA 3T12A 1A9TA 4BQIA 1WZNA</