5EIBD

Crystal structure of cpap pn2-3 c-terminal loop-helix in complex with darpin-tubulin
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
430
structure length
430
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for CPAP-tubulin interaction in controlling centriolar and ciliary length
pubmed doi rcsb
source organism Synthetic construct
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 175
structure length 430
sequence length 430
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
D PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5eibD03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5eibD02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5eibD01
4O2AB 5EYPB 1FFXB 1W5AA 5IYZB 4DXDA 4YJ3A 4X1KB 4WBNB 4X20B 4O2BA 5FNVA 4X1KA 4WBNA 4I50A 3E22B 5IYZA 1RLUA 4O2AA 5EYPA 4X1YA 1TUBB 5JVDB 3JAKB 4EB6A 3UT5A 4B46A 3JATB 3RB8A 4TUYA 5ITZB 2Q1YA 1W59A 3JATA 3UT5B 4EB6B 4EI9A 2GVIA 3JAKA 4ZHQA 5JVDA 4X1YB 4FFBB 3CB2A 4DRXA 3E22A 3WGLA 4I50B 5EZYB 5JQGA 4O2BB 5FNVB 2XKBA 3ZBPA 4O4LA 4X20A 1OFUA 2R751 4YJ3B 4I55B 2VAPA 1FFXA 2RHOA 1JFFB 4LNUA 4O4IA 4O4JA 2RHLA 3HKCA 1SA0B 5JH7B 1W5EA 3VO9A 2RHJA 3RYFA 5CA0B 1TVKA 5LP6A 1RQ2A 5CB4A 2VXYA 4E6EA 5LA6A 5CA1B 4F6RA 4HNAB 3N2GB 3N2KB 3JARA 5LYJA 5C8YB 5LOVB 5J2TA 5LXTB 3WGJA 5JCOC 4U39A 5IJ9A 3JALA 5BMVA 4ZOLB 4TV9A 3ZBQA 3C8LA 3R4VA 4TV8B 3JAWB 4IIJA 4I4TA 3HKEB 3VO8A 3RYCB 4X1IA 3RYIB 5KX5A 5KMGB 1W5BA 4YJ2A 4U3JB 1RQ7A 3RYHB 3HKBA 5GONB 4O4HB 1Z5WA 3ZIDA 2BTQA 5IJ0A 3RYHA 4U3JA 4ZI7B 5J2UA 5M7EA 1W581 3JASB 1W5FA 4IHJA 3HKDA 3JAWA 4IIJB 5EIBC 3WGKA 4TV8A 2VAWA 5MN5A 4ZOLA 3HKDB 4IHJB 2BTOA 3JASA 5IJ9B 5J2UB 4ZI7A 4M8IA 5IJ0B 5LXTA 2BTQB 5MN4A 5LYJB 3M89A 5C8YA 4O4HA 5EIBD 5GONA 3HKBB 5LA6B 4F6RB 5CA1A 4YJ2B 1TVKB 5LP6B 4EI8A 3RYFB 5KMGA 4X1IB 3RYIA 5KX5B 3RYCA 5JCOA 2XKAA 3HKEA 4I4TB 3VOBA 2R6R1 3WGNA 3M8KA 4XCQA 3V3TA 4LNUB 1JFFA 4O4IB 3WGMA 4EI7A 3VPAA 4TV9B 4I55A 5LP6C 5BMVB 3JALB 4O4LB 5EZYA 5JQGB 3VOAA 4DRXB 4FFBA 2VAMA 4B45A 1FSZA 4ZHQB 5LOVA 3JARB 3N2GA 3N2KA 4HNAA 5J2TB 5CB4B 2RHHA 5ITZA 4TUYB 5CA0A 2Q1XA 4KWEA 5JH7A 1Z5VA 1SA0A 5MN6A 3HKCB 1TUBA 4O4JB
chains in the Genus database with same CATH superfamily
2WWIA 2HU7A 1HDOA 3PNQA 5IU6A 1E66A 3EAGA 2CMDA 4LF8B 3GLHA 4JP3A 5DTQA 3NHUA 4C4YA 2G63A 4X1KA 1CR1A 2O0KA 4IO0A 4K8RB 2QN9A 1E3WA 1REQA 1E2KA 4ND1A 2OCKA 1YMQA 2GNOA 4M1KA 4F2WA 4DB4A 2BFOA 1VHDA 2VBIA 2BFDB 4IDCA 3ZX4A 3L6RA 3B8MA 1CFJA 1HYHA 3E6AA 4F4IA 4JDUA 4B79A 1G7CA 1EH5A 1OZHA 3CIOA 3GEMA 3HB7A 4HWRA 5B58T 4IIJF 4X45A 2KBFA 3X43A 2C57A 4DV6O 1Q81W 4WXMA 3O1IC 7REQA 4IF4A 1HXHA 1CDZA 3I2HA 3AEZA 2VUTA 1V5WA 4QE3A 5BQFA 4QGSA 3RKRA 1HTBA 3U7EB 1EK5A 2OB1A 3GLVA 4PO1A 2COUA 1XMQB 1EAYA 4NZYA 1G8KA 4NCKA 1JV2B 3RTGA 1SA0B 1Y66A 4G9BA 4NESA 4IDFA 3PD0A 4FVMA 3QY9A 4Y9RA 4ZYTA 4OXSA 4X84A 2Y0IA 1AY0A 1BU8A 3MTBA 2DYKA 1S8NA 1UFIA 2JIZA 4XUGB 2GHIA 2OXCA 1OOEA 4N5NA 1DINA 2EJUA 1NATA 4O1IA 1LVUA 1H93A 1WXXA 2P0YA 2V7TA 3CLTC 3QVWA 4GKJB 2DVMA 4WLVA 5CFLA 3SJBC 5T8KC 2QE7G 2Y1DA 4FMPA 4J8PA 5T6MA 2EGUA 3HXTA 3FFMA 1W35A 3H75A 2JANA 3DXXA 1UJNA 2I33A 2PMPA 1RYZA 2HT6A 3M4JA 1DTOA 4TV8B 1IURA 2H7VA 3DMPA 3I09A 4EATA 4Q7QA 2AA3A 2IXAA 2IT1A 2JFHA 1VIDA 4ZVMA 3LYUA 4XI9A 2QY6A 3AR3A 4MI9A 5AJTA 2KJQA 2RI0A 4UNPA 5EXDA 3QW2A 1WDWB 1NHGA 2JG3A 4O3MA 3NP7A 2O2EA 2CLFB 3DBRB 3SPJA 5L3BA 4B8WA 3C7KA 4DLYA 1SC5B 2ZI5A 1U7PA 1F51A 3ZY5A 4DOMA 1DKPA 4HDCA 1FTNA 2BEWA 2A67A 1VLVA 2CBGA 2G17A 3ONFA 2LIPA 2WWHA 4Q9LA 5DBEX 3I6ZA 5BN5B 1FXWF 1SCBA 2O59A 1SKBA 1DC5A 5CCXA 2UYOA 2VCEA 1UM9B 3KEMA 4P5PA 4GSLA 4PFKA 3UJHA 3TTYA 3QMMA 5GGXA 2BE3A 1SIUA 2X9GA 4L75A 1EVJA 2Q27A 1SEVA 4D57A 3D7MA 3B1FA 2DKFA 2P1RA 2WFAA 2NV0A 2P6PA 1UINA 1GAWA 2Q49A 5CT4A 2X4IA 2PEZA 2LGQA 3L0PA 4P6VF 4BLPA 2PIDA 1K7FB 2Z8YA 5LBIA 5M3BA 4YRCA 1P4RA 1NZJA 5DLPA 3ZP4A 1K0UA 4OI1A 3GPBA 4B4OA 4PZUA 5E6SB 4AYWA 2FYUH 4IDBA 2XDQB 2PL9A 2DUJA 1RKVA 3EQ6A 2P9QA 4P4LA 5ALFA 5TVKA 5E3HA 2OBXA 4HLUC 3W3AD 3ZE0B 5FBVB 5H8WA 4DXHA 1KKMA 4ZI7F 4LFCO 3V7NA 3ITNA 5JZOA 3CCVF 1MDFA 2WIDA 3NKVA 5EUBA 4JYYA 4TQDA 3RFTA 3PC8C 2PYJA 2F1MA 2OHFA 2FZCA 1CJTC 1PDOA 1Q6ZA 1VJCA 1ZNXA 3F3KA 4M86A 5FKJA 4EGQA 5EWLB 2PXCA 1KEVA 4QFCA 3B2EA 4HAUA 1V6SA 4HX2A 4KW7A 2BRUC 4C5AA 1D2HA 5EAZA 3SIVA 2GBIA 2OZKA 4MIEA 3SZ3A 3T94A 3R7AA 3Q8HA 4P58A 3MTJA 4U7GA 3NVDA 1TEHA 2JNWA 3PF9A 3GELA 4Q93A 4Z53A 5TPWA 5L3GA 1IHUA 4HXGA 4R1LA 3E2EA 4KEAA 1VMGA 1VJTA 4TYQA 5GV7A 4PYMA 2MINA 3WLMA 3SEQA 2ZIGA 3S4YA 2HKIA 2ORED 2Q5JA 3HJAA 2ZCEA 1QX3A 4C3ZA 1Q82W 1YI2F 1LB1B 2HHLA 2PR2A 3KSDO 4R3UC 3NBXX 5CFOA 3GRRA 2O06A 1JVNA 4BNKA 4JK3A 1YQDA 4CJXA 3K0CC 4KNVA 4WA8A 4XQCA 4B08A 3GLFA 2FFQA 3RUPA 2JIPA 3BMOA 5TPZA 3DFMA 1FFHA 1VQPV 5EVCA 5EWMA 1XUOA 4AJKA 3Q2KA 1N4DA 5HUQA 2IG8A 5B4UA 3A6JA 4OOEA 2WHPA 3IOEA 2QAGB 1Q43A 4M1TA 4YB8A 4UREA 1C2YA 2WNIA 4WXRA 1DJQA 3LY9A 5TQVA 4CEHA 1TKAA 3ZPXA 2PKYX 3KAPA 2OHOA 4E5PA 1M6WA 2JHFA 4WFIA 4V2UA 3QTCA 2RN9A 3EDCA 4OHOA 1SUCA 5LWQA 4J7JA 2J7PA 4DR2O 1X8KA 1MO6A 4JT2A 2J59A 4KWHA 2JRLA 2VTKA 1CK2A 1L1EA 2NSJA 3D2LA 3LDHA 2C98A 2OBFA 4EUKA 2VK8A 3H99A 2VF5X 5T67A 2QBYB 1ZYUA 3ZK7A 5A1JA 2RH9B 2MIIA 4ZT4A 1SUBA 4TVBA 1JXQA 4B3RB 2Z5GA 1U1DA 3M9WA 1ZD1A 5DLEA 1FX0A 1VBMA 3CMCO 3DE5X 1BHJA 4OXIA 5ALYA 2EX1A 4GECA 5EXPA 4QDOA 3BJRA 2FGJA 3OOYA 1SAYA 2FZ4A 3HR0A 3K1TA 4U9HS 3A2NA 3AR2A 4PE5B 1JYSA 1MIHA 5I4KA 3FDJA 2FMFA 3RI3A 1NE7A 1FX0B 3BFJA 4NICA 5LZ5A 3WADA 1V8DA 4TMXA 3TTUA 1ISJA 2VT6A 2WKRA 1OR8A 3EOZA 1WW3A 3G4SF 3IOYA 1IPHA 2K1SA 2XB2A 5BZBA 5KBYA 2H3OA 1P84F 3CSUA 4G2KA 1WZCA 2R6ZA 4Q3EA 4R1OA 4YXFA 1ORHA 2GSDA 5ICSA 3LSTA 4KREA 1CJBA 2XHEA 5ALEA 5GV8A 1CQWA 3SPGA 4N6GA 2C9YA 3B7WA 1EP3B 3QXHA 3UAVA 1PJTA 3H7AA 3KQYA 1EX9A 1W0JG 1SUFA 5FUVA 4Z3OA 3W79A 3HKBB 1PT9A 4OQMA 3VR4H 3C3BA 1RC8A 1N0WA 3EGIA 4TM8A 1QPBA 3LHDA 3HJCA 4Y0NA 2OT5A 1LFAA 5FJ4C 2PX5A 3OE7D 4HB0A 4WA7A 3NK7A 3OQNA 3SFTA 3CCLV 5FPTA 5CDSA 1OH6A 3O9MA 3HNPA 2F93B 1ZX3A 2EOAA 1KAEA 1WCYA 2CMKA 2F67A 2LV8A 2W90A 3HCWA 5HK8A 2AG1A 4RIGA 2MSLA 3WHIA 4BBJA 5ICMA 3TG8A 4UUJC 3OZWA 6ABPA 1SCDA 1TAGA 2IM9A 1IEVA 1FMTA 3FCUB 4HDSA 1OH8A 3WL6A 1YI8A 2RGAA 2O3TA 5C7IO 1NLYA 4P53A 1FLNA 4BXOB 1DAMA 1U7WA 3OBYA 2RDCA 3RBZA 1C3JA 4X6XA 3W5IA 5JT1A 3O4VA 1NTKH 1K9SA 3PGKA 4X94A 4AY4A 1UJ5A 4RPCA 3WFIA 1VQNF 1J33A 1T9CA 3D6MA 2FFRA 1CJUC 4OG2A 1K5GA 4BB0A 5TPWB 4E2WA 4CMEA 3CNNA 3KD2A 1ZLZA 1ZJ5A 4YROA 2NZUG 4PR3A 2LWIA 3J80A 2C42A 2FPOA 1D2RA 4OUDA 2OYQA 1DG1G 4D9KA 1I08A 1AJNA 1H2LA 2QTGA 3ADPA 3FJOA 4KZPA 4LXGA 4R8KA 3LWZA 4ZEMA 2E4ZA 3GV0A 3L0OA 3GEIA 4C43A 5FOVA 3IOMA 4TWRA 2PMFA 3E15A 4GSYA 1EVZA 1M2JA 4RDIA 2ID7A 2IOYA 3AEUA 3JD3A 4JLSA 2H2AA 2YUAA 3M82A 1XBLA 3TW6A 3X3HA 3ADDA 3R3HA 4W5QA 2B83A 4FDVA 1NV8A 2FEAA 3K59A 1LPOA 1X19A 3ETJA 3MUFA 2EU8A 1XVIA 2BGGA 2AMYA 1PFWA 2BGRA 4P7KA 3T15A 4R7TA 5F12A 1Y76B 1JXOA 4BIUA 3SWWA 3FH0A 1G4HA 4N21A 2F3RA 3HWWA 4CNQA 3OA0A 4ITUA 5IAGA 4A0QA 3SJCC 3PVCA 3EMKA 2G71A 4NIMA 3OZAA 2QRJA 3IBFA 5FBQB 5JJCA 1AJQA 1W0JD 1KO4A 1MSWD 1GDDA 2B30A 3C3TA 2VYVA 1QBZA 5B1OA 3ZWCA 5BN3A 1BYUA 4GXQA 3GJ6A 4I9WA 3FZGA 5AI9A 4CBVA 3A2KA 4NEQA 1GSHA 2GA8A 4U5QA 1IRXA 1RJDA 2NPFA 2Z6VA 1L4UA 4CFZA 1OB2A 2D5CA 1CE8A 5HKLA 2VJOA 3AHHA 4FCTA 3OQBA 2IE0A 4NCJA 1NUPA 1PYGA 3CPJB 2R9AA 4FGKA 1G7SA 2FJ0A 1MO3A 1GL3A 2C9ZA 2MCFA 2YY7A 2JCXA 2I87A 4O1MA 1ZNWA 1BKYA 1P81A 3F78A 3P2IA 2ZRHA 3P9RA 4YCDA 1D4FA 3I62A 5C8VA 1U6KA 3JWGA 4RVFA 2AIFA 1GN8A 2EQAA 3FX2A 1USUA 3R0QA 4BMCA 5KWEA 1U0EA 1YNSA 2Q28A 2DFPA 2D5AA 4N3AA 1CN7A 3B85A 2I5PO 2WJAA 1JXMA 1Z0KA 3FM9A 4H1VA 4JJIA 1MC8A 1O96B 2JIBA 2OECA 4ZI5A 3WIBA 1Z0SA 4WDQA 3VQTA 3WK6A 3ZZNA 3FSJX 3GXOA 3K0FB 2YC4C 2KSDA 2CHTA 1SCNE 2XBMA 1M34E 4HGPA 5EXTA 2IOFA 4MEBA 4D80A 2OCCB 1A9ZA 3IVRA 2C99A 1HR0B 3OZ7A 4FYWA 2P65A 4K9RA 1CUSA 1DT5A 1NFFA 3KJJA 2HGSA 3NIWA 4E88A 1ULUA 1SULA 1E8NA 4D0SA 1KC8H 3IRUA 5CEJA 3G9QA 2AR9A 4YMVA 3UGTA 3CJHB 4FYJA 3C1UA 3L6CA 1GPH1 1N0JA 4X1IB 5B1NA 2EV9A 2GBLA 4ZDIA 1DFIA 5JEEA 2DE0X 2PUDA 1NC3A 2V7QA 4LOIA 1PPJH 4LF7O 4BIOA 1RKBA 3I1JA 3KKZA 1UZMA 2PUTA 4U5XA 2CDYA 3QQPA 2NPIA 5F9MA 3GG2A 1NBMG 3AJ9A 4RIEA 3TL2A 3V4VB 5K2OA 4E5DA 2KQXA 1G0OA 2VDMB 3FBWA 3LRTA 4HNAA 1XUQA 3V80A 1L6RA 3G13A 2RHHA 3KSBC 1V1RA 1PDVA 5GONF 2Q5OA 3KEFA 4Q4JA 1K7SN 3HRIA 1JVBA 1ZGZA 4HFNA 4ME6A 1E3WB 1FFXB 2YYEA 1L7RA 4J91A 5JZBA 1WKBA 3A6EA 2PFSA 3NHYA 3RAJA 3IQIX 1E9CA 2X9NA 4ZFNA 1Y0BA 3W9UA 3OA2A 1KWGA 2PYZA 1K73W 3LWVC 2ZTLA 5K0NA 3GNTA 1C5KA 1LV8A 1BGYH 3FPKA 4H7PA 4HP8A 3RJ9A 1T43A 5AQ1A 1MEOA 1UJ4A 3OSZA 3CW2A 1XTIA 4K0KB 4FGLA 2Q3DA 1ZA2A 4IEIA 1TRHA 2AN5A 3R5FA 3DYBA 3AOEC 3OEYA 4JZKA 2XZDA 3SG0A 1KYXA 5H9WA 1G4UR 1TUEB 1JPUA 3BA6A 3PGVA 4KX3A 4A6XA 1G1XB 4PLVA 1SZQA 1XF1A 3P0EA 4RGVA 4WN3A 4YXWD 2FQ1A 4E12A 3QPWA 1ZWZA 5KNCA 3BVPA 2AQIA 5CN0A 5DN6A 4IW3B 3IEQA 3QLVA 3QVTA 4M6WB 4FLWA 4RH0A 2QSZA 1YQWA 4LDRA 1HETA 2IDMA 2PJDA 1I3KA 3G17A 2OYSA 2NXEA 3OPXA 4MW5A 3CX6A 1BXKA 4Y6RA 3AM1A 2C04A 1YS4A 3JARA 1LD3A 2JAHA 2OZLA 2XZTA 2Z1NA 3DO5A 3EQ2A 3ILXA 3SIRA 4DABA 4EPRA 3RUCA 3OJ0A 3U37A 2M9MA 2GS9A 3DE4X 2FP4A 3G1WA 2B4AA 2YNMA 3AJ8A 1V5GA 3CC8A 1M2GA 3HI6A 2JJQA 4FT2A 4BC0A 4QTUB 5IULC 2D7CA 1YIJV 1CHNA 4JLWA 4A1FA 1AH2A 3F7NA 3PGJA 4O0LA 5JZMA 1Z0IA 3IP7A 3QBEA 5MDHA 1RAFA 1PV1A 3F6YA 3FCEA 5JAMA 1NV9A 1R3DA 5FOUA 1MDBA 3MPUA 4Q9DA 1A7KA 2QSYA 1NUHA 1J07A 3HJWC 4U3JB 1RQ7A 1R18A 1TEXA 1V4VA 2KSQA 2BR5A 3LMKA 3W7WA 1JA1A 4WOKA 2P06A 1V7PC 5BV2P 1VCMA 3A28A 3KZKA 1OBVA 3KTDA 2A4MA 2QLJA 1G0NA 3V46A 4C0SA 5J2UA 5EQDA 1ULTA 1LS1A 2ZRPA 4JI7B 3ODGA 1Z13A 2WM2A 1GQFA 4AUKA 5DCWA 2FPIA 1JZSA 3QI2A 4JZGA 1O6FA 4C05A 3QJGA 4EO4A 2A59A 2WHYA 3SD7A 4XYMA 3A6GA 1FP4A 1LLDA 2X5JO 3W1VA 1YIDA 1ACLA 1E0SA 4HOYA 4D4MA 1GIAA 4ZI7A 2Y2VA 3JYOA 4MX8A 3HRHA 3VFDA 2R0QC 2HCBA 3OFKA 4Y6OA 1CETA 3QIAA 4QSMA 3WMXA 7GPBA 4NK5A 3JVHA 1PI3A 4BGVA 3A05A 1KB9F 1THGA 1PEKE 5DYYA 2W2KA 2A9HA 1NMZA 5JNSA 1FVHA 5AKHA 2GESA 2JI8A 3OFNA 2BEVB 1G5TA 2A4KA 3ZWXA 3R8FA 2G1PA 2IEBA 5T41A 1JLLA 3PL1A 5CM2Z 3QUAA 4F84A 3BMQB 4Q7LA 1R00A 3GR6A 1V8ZA 1UXJA 1OLSB 4ROSA 4E22A 4PZCA 2OILA 5HF5A 2WABA 4RL6A 3WKAA 3ERNA 1YR3A 3ZOPA 1SUWA 2B61A 1CVIA 2J5RA 2M98A 2WWXA 3EC2A 3AB8A 3HYSA 2I76A 3E81A 4WADA 1HK7A 2Q4BA 2O1XA 2PGOA 1FNJA 2UAGA 4JC5A 2D3TA 4JLBA 5IVKA 5I7FA 1M1YE 5H83A 4G1VA 3RE1A 1UAAA 2IWRA 4XSVA 3CZ4A 4UUQA 5HZMA 1EM8B 1TU4A 4IM7A 1AI7A 2GUZB 3HKCB 5JHGB 5B2FA 1YITF 4LK2A 3D8SA 4XWTA 4Y2YA 2JLYA 4EDHA 1JSXA 1PRYA 1V0JA 1NUUA 4P9NA 3EVCA 3DHVA 4ZHSA 3GP5A 5KNCD 1OCRC 3ZWPA 3IJRA 2G0AA 5TF4A 1AQUA 5IYZA 1EE2A 1P8AA 2YN4A 3G8CA 5ALGA 1DKOA 1P4JA 4O29A 3U4DA 1IDOA 1OC4A 5BRNA 1KHHA 4OAOA 3J7AC 2ZCUA 3CF4A 2Z4SA 1KECA 2P9GA 1KBQA 3CZ5A 4L73A 3SDBA 3WE7A 5CB8A 3ISVA 2OXIA 4JI1O 3G5TA 5JXJA 4RA6A 4MTLA 2CB0A 4FFNA 3CCSV 2FN7A 3TW8A 2DN9A 4JI2B 3LUHA 5TISZ 2QV0A 3FTNA 5LQSA 3QE9Y 3GRCA 4UTRA 3CVOA 5B4VA 5K8CA 4N0QA 3N7AA 1DGSA 1Z45A 4O4LA 2OMKA 1E2UA 5C32A 1G66A 4JQYA 2V1UA 2JGDA 4Q34A 3UMBA 1PD0A 2EBHX 4QJ4A 4QOIA 1ORIA 5MHTA 4ZVKA 2O7QA 3LX8A 1X7XA 1YWGO 4EEZA 3AG3B 4H08A 4FMDB 4V0OA 4R8CA 2ECKA 5DM2A 4D3DA 3F9IA 5I7HA 3PHLA 4JYPA 1WSBA 3HYLA 2Z6UA 2NZXA 1XNQO 1R6AA 4EFKA 2YIJA 4EZBA 1KP3A 4K6MA 2FK7A 3PUKA 3QNUA 3TINA 3TOVA 1N77A 3CC7F 2FWAA 1IQPA 3B20A 4JSYA 4RQEA 4K8OA 1VMDA 1FJHA 3CC2V 3F0GA 1QNLA 2QENA 1KI2A 4KC0A 2ZIEA 1UIRA 1SVSA 3CLUC 3VO2A 1JIUA 4OY3A 4Q9KA 5EHXA 2H00A 2VG8A 2VPWA 1RLIA 2YASA 4GGOA 4DW8A 1S8OA 5DNUA 2JIZG 3LVRE 1H5UA 1YJBA 2BFEA 2DU8A 2GX6A 4YCNA 3RAEC 4HBNA 2ONCA 4H44B 4XBFA 3UO3A 1W47A 2V7WA 3K1ZA 3JVIA 3BFVA 2RQ6A 2PO5A 4BQEA 4ZZIA 2VDJA 3AFOA 1BMTA 5DNWA 5P8WA 3AV0B 2HLPA 1OB5A 1D6NA 1PR6A 1GNTA 1Q6YA 1Y6QA 3BTOA 1G6KA 3GZ4A 5B1IA 5A3VA 3VR4A 4QU0A 5MGBA 1DSSG 2IHJA 2CFRA 1GZ6A 3IEIA 4QBFA 1Q5OA 2PSEA 2YS6A 3OT5A 4AO6A 4TWZA 2DFTA 1TTPB 4GX2A 2H0RA 2V45A 1W85B 3DE3X 2P8SA 3KSUA 3L46A 4HQNA 1R16A 5BNTA 3ZGOA 4B0OA 1VLLA 4MZDA 4XRGA 3QHPA 5KJFA 4QPZA 1P0PA 2W6JD 2AV6A 2BUCA 2WIAA 2ET6A 5C4MA 4ARBA 4LISA 4JI7O 1V8FA 4D2IA 2CNKA 3IAFA 2QMEA 4RQTA 4J03A 3WXMB 1CBUA 4UDXX 4N47A 3S02A 1HG1A 3GDHA 3LI2A 3WL5A 3DL4A 3VYVA 2XUHA 5K0JA 1ID8A 3MWKA 2CVPA 1V7CA 3VBCA 2PX6A 1KC1A 1PNMA 4TS4A 1QU7A 1XQXA 3BMNA 2I1LA 1JHVA 3T9DA 4EBBA 5E6RB 1R9JA 2BF4A 2ZAIA 2ZINA 4TZTA 3DVQX 4X97A 4OK6A 3GAZA 1QYDA 5HGJA 3OJLA 1C0EA 2VSOA 1UWKA 3U3XA 1JLRA 4R31A 3S70A 2JGDB 4O2AB 4YGXB 2AEMA 3K79A 2UYQA 4BRZA 2O2DA 3C3SA 3BRWD 3LFUA 4WBNA 3SYMA 1MOSA 3MCWA 2PRSA 5CNJA 2D74A 2PN1A 3I5DA 2NXNA 2Z2XA 1U1FA 3FVVA 1XKXA 2GWHA 4ND5A 3G9UA 1Y5LA 2AJBA 2ATEA 1UODA 1YKGA 3HBNA 4G0ZA 3RIEA 3LBYA 4EYKA 1KWKA 1LBTA 2JFOA 3DV0B 3QKIA 3ZS9A 1S2MA 3RUHA 4CF3A 1J5EB 1JEDA 3SY8A 3CYOA 1S7CA 3K32A 3E5RA 2RB9A 5JD3A 3N0VA 1REQB 1TUGA 4E3ZA 5HXZA 5HY4A 2AX3A 4QKQA 1XZGA 4I46A 2WHXA 2YZKA 3IEUA 3QSGA 2JH9A 1OCZC 4C29A 2DUWA 2EG5A 4RHTA 4D02A 3R0XA 5FX2A 4M1QA 2YN2A 4UD2A 3H5WA 1B76A 4R8LA 5M2QA 1ZR4A 3GHYA 2GUZA 3N86A 4DBZA 4O33A 1XMSA 2C2GA 2GBPA 3GUVA 5EY5B 2WYOA 3AR5A 4YMIA 3I9OA 2WG1A 2HS4A 5BVHB 3BXPA 4ML3A 1C30A 5EBLC 3LQQA 1E3DA 2F9FA 2N1BA 1G5PA 1MMFB 3IAS6 3QUSA 2D1FA 2IIPA 4U63A 3SX2A 2QAGC 4FNMA 3V7QA 1N36O 1BQ4A 4NPCA 5IFLA 3VXKA 3IL2A 2VEOA 1M5RA 4EI2A 5AHRA 4KPUB 4CTJA 4QNNA 2HSEA 2J9ZB 3LUAA 1QRSA 5DCUA 2CDRA 1QH1B 2PHZA 1MAUA 2QU7A 1FVFA 1ISPA 2QL6A 3OO1A 4ILEA 4HXEB 4NBRA 4PC2A 3C8LA 1QX4A 4PO3X 4PYLA 4UXHA 3TTWA 3DCIA 3PFFA 1YE3A 1E58A 1V4NA 3MWEA 3NOOA 2YWBA 3NHAA 3E83A 3R0VA 3PN1A 4TTQA 3ICPA 1O87A 4Q1BA 1MX5A 2EVWX 2CJWA 3CYFA 5DI9A 1ZVVA 1C1DB 3ZXIA 2OLJA 2VT3A 1OIWA 1KHTA 2NXCA 4J9ZB 3IQEA 3HB9A 4Z0TA 4C7OB 2AMTA 2HGZA 3D8BA 1M8KA 2Z4TA 2UU9O 4DV7B 2OVBA 3OPQA 3R7NA 4DWOA 4PCUA 5BY1A 3KOZA 2Q3LA 4HDKB 1OLXA 1XLTA 3CH5A 1JEQA 1LTQA 5KDLA 2FEOA 5AW6A 8ABPA 3VR5H 3IESA 4IFTA 5CAEB 1GP2A 2I6UA 4OI0A 4CKCA 3WLFA 2V1XA 4D4KA 4EX7A 2JZCA 5CBFA 2J46A 4WOJA 2P4VA 2CHSA 4Y3UA 3MB5A 3JQAA 1T5IA 5CLHA 2YOHA 2Q0HA 2WFLB 4AECA 1UXGA 4A82A 3NUZA 4ZAGA 4OXQA 3WJAA 1FS4A 1I33A 4JBXA 2J9XB 2XNDD 1VLHA 2O8BB 4IDQA 1TMKA 1H2XA 2QHXA 1JDJA 4R51A 3DPUA 2DHQA 1NXTA 4PI0A 1XB2A 3STZC 1YKSA 3T06B 3IE1A 1Q19A 1OH7A 3AFGA 1PSZA 1MQSA 3BDIA 3IP1A 1ZGCA 2ZSJA 2HBYA 5LZ7A 4Q9NA 4FWBA 2GVZC 1ZN8A 2A1UA 2BGKA 2J45A 2ORYA 2PJZA 1VBKA 2LXNA 3FSGD 3LDUA 4Z1MA 5TQ2B 1DCMA 1FFAA 1XLWA 2D0PB 4YS6A 5F7JA 5C18A 1P2DA 4ETWA 1OREA 2DBZA 4Q7JB 1E7QA 3BGSA 3O8NA 4IL6Z 1ORWA 2YCLA 4L78A 5IZCC 3VTAA 3FD9A 5JH7A 3A4NA 4HSGA 4X93A 4MITA 621PA 1T4MA 4BMNA 1A7JA 3OEEG 4FZRA 3U7QA 5DHQA 4BZPA 2NO5A 3HLTA 2PUHA 5A0FA 4ZYVA 1PS0A 4HLDA 4QRHA 3MDSA 5HHTA 2I1VB 2GN1A 3CBQA 3DZHA 3EUAA 4K86A 1UUFA 3OEHD 4JI6B 3RVLA 3BWVA 3WLOA 4D45A 5AR1A 1JX9A 3SDLA 3NNSA 1FMJA 5AVTA 2LTAA 3VV2A 1M8JA 1PFYA 2FEWB 2H06A 1WN7A 1KYZA 1QTNA 1M2VA 1KNQA 1PFQA 2XXAB 4MQ4A 2LE0A 1NLFA 4BW0B 1JGTA 3KVYA 4YPOA 3F7OA 4LCUC 2Z0MA 2EINC 2WG0A 4M8KA 5BNZA 1I7SB 4FUQA 2VUUA 4N7MA 4PNPA 3GHHA 3DOIA 2GJ4A 2IS4A 3ANTA 2PZJA 1TVCA 2YOFA 2RHOA 1TF5A 4HWPA 1RIIA 2XOXA 4I50F 5SICE 4LNUA 4IGAA 1KQNA 3U49A 1JT9A 2BBWA 4KVZA 2ZS7A 3IKTA 1Q7TA 5PNTA 1UBMS 1ZOPA 3QFFA 3DLAA 3HMKA 1IUOA 4GXNA 1MA1A 1CF2O 1R0CA 1NYLA 1T2NA 1TJ3A 2IA5A 4L8YA 2GKSA 4WCVA 1I3MA 3S8EA 1IBCA 3TM5A 1UQRA 3P4UA 2NMUA 9LDTA 3EUEA 2C3OA 2EL9A 2IHNA 5JWPA 5LLTA 1U8FO 3CMEV 1Z8HA 4GBED 4LG1A 2OV4A 5HTKA 2ZUWA 3UJ7A 2ZW9A 3GLUA 3MLAA 5A4AA 2F90A 2ZXFA 1YFKA 2JEXA 2RHDA 4PGAA 1CUVA 4OHBA 2GM4A 3LSSA 4YV0A 2Y3IA 2O0HA 4EVSA 3GZNA 3DM9B 5GW7A 3K6SB 1X39A 1OAPA 5AOBA 3A1DA 1NOJA 4YRPA 2C84A 1QYCA 2RARA 3F6RA 1K5SA 4I9UA 1OBCA 3AEYA 3QXSA 3EGXB 3OO0A 2HCRA 3A4LA 3I6QA 1JJBA 4FU0A 2HIMA 2FSPA 5AKEA 5EKSA 3ZHCA 2KE5A 4Z4QA 3G49A 1G8JA 1NE2A 3OAAG 1VHJA 1LUWA 2QEQA 1J8DA 3ANXA 3PFHA 4RCZA 5A6SB 1A8SA 1ZJ6A 3H2JA 3ADOA 4PY2A 4DHEA 1QRTA 1T0JB 2QNRA 3EVEA 5CNMA 1M5UA 1NNI1 2DQSA 5MN5A 1XP5A 2PUJA 4F2DA 1ADGA 3G67A 1Q0PA 1QH0A 1UKYA 1WHTA 2OHHA 1EHIA 1CY7A 1XAGA 2AMLA 2HIGA 4FTWA 4HEJA 2RG7A 5EJFA 5CEEA 2JFNA 3DGEC 1X52A 1W4RA 1D8AA 1U9JA 4ZKIA 1ZD3A 2V8BA 2YV5A 3DZCA 3PGLA 4QQRA 3C97A 2Q3JA 5G0VA 3N8HA 4P98A 3TQSA 4Y2JA 2O3UA 4KQFA 4NFSA 221PA 3ZDQA 1VQ4V 3DWFA 1A96A 4Z51A 1EK6A 3CF0A 4DC1A 1QFJA 4AM8A 1RJ9B 1K92A 1KQ3A 5EIFA 4F72A 1QIIA 3DDHA 2CLMB 3RT9A 3WLAA 3GLFE 1ZZGA 3O8QA 1SG6A 3K71B 2FW1A 3GRAA 4TRRA 2F2TA 4LWPA 1QAOA 4J29A 4GCZA 3LMEA 3H5IA 1VQ5V 4IJWA 7YASA 4P0PB 1MGPA 2HJWA 2D1RA 1JU3A 4NH0A 2QWNB 2OYRA 1CE8B 1RRFA 3EPHA 1YBHA 1IBKB 4IKEA 2IOFK 5F21A 3ABMB 3ID6C 5COAA 3T1HO 3CS5A 4KDEA 2JFBA 3AXTA 1XFAA 3COSA 3CE6A 3H97A 2RNBA 4B33A 3PDIA 2HV8A 2M2IA 1DJNA 1G4YB 4B71A 5HNKA 4JL6A 1NSYA 3K3PA 1D6SA 1U98A 4WKOA 1JVSA 2QN7A 1Y1LA 1Z5VA 1PWXA 1YVRA 4BWAA 3K06A 2A9OA 1YOVB 3HJUA 3IURA 1YZ3A 5BR8O 2ZVZA 3ZWMA 5BYAA 4X66B 2LBWA 5FTWA 1CF4A 2Z9BA 4ZMRA 1P2BA 4FJCC 3E27A 4REMA 5AKKA 4QXRA 1QVGF 2IEDA 4CT5A 2PY5A 1FU7A 3EHEA 1XD2B 2NU7A 4FPXA 3SKYA 4JGIA 3AI3A 3TAUA 2ZUFA 2H7CA 4B17A 3FB6C 1D07A 2QTCA 5FI0B 4MR7B 1KZ4A 5FPHA 2WALA 5I7RA 2QTRA 1SESA 3PJGA 4TMTA 3U16A 4MKZA 4AP6A 3MJSA 1CRPA 5KYTA 2ZI4A 1CLIA 2PRJA 4BLSA 2OIGA 2H65A 2COKA 3ZZ0A 1J2TA 3ZQJA 1U2PA 3LIPA 4HWKA 1IG0A 1E1NA 5F52A 3PQ8A 4JJAA 1NVEA 4YACA 1HX7A 3DEIA 4YQZA 3LKBA 5ALRA 5LP1A 1FF9A 4N23A 4CLOB 1WQ4A 2FMTA 1UFKA 1S2IA 4QTYA 1W5EA 3CVXA 2E18A 1ABEA 3QF7A 1EXMA 2OGZA 2WP8J 5DT9A 3ZIUA 4RTMA 1E1CB 1YASA 2EZ4A 3IP3A 1XMOO 4P54A 2CXQA 1NP7A 2XF2A 2Y76A 3AI1A 4MWDA 1J0AA 5ELMA 1DBIA 3WGJA 3OKPA 3OJOA 5I9SA 5E4JA 3RQIA 5JCOC 4PS1A 1SCKA 3OTQA 1ZH6A 3U48A 4JGSA 4DLXA 5JJJB 1SRQA 3OONA 4BY9D 4JROA 1AQJA 2R1VA 4FMCF 3DBIA 3N58A 4O8ZA 2UUAO 1HGXA 1KPGA 5EC2C 1HNXB 2PUCA 1T4CB 2DW4A 1B8OA 1CULC 4MP6A 3THRA 5BXQC 4K9MA 3ITDA 1K8YB 2R87A 1U5CA 5KSWB 4LGMA 1OVGA 4RVNA 3AG3C 4UHDA 2Q8VA 2I6GA 2EX3A 2UXXA 1KKUA 4C0HA 2Q9UA 1YJWF 1J6UA 1FD9A 3AF2A 1Z6TA 2ZVPX 3JVEA 4LC9A 3NQ41 5IJ0A 1TGOA 2WPNA 3AGPA 4FYVA 4MVMA 2QN1A 2Q7GA 3IDAA 1R5JA 3FYDA 3IUSA 2VFAA 4MB6A 2A3QA 3HAXD 1OXBB 4CIVA 2QTMA 3KKPA 2W6IG 3I76A 3MN1A 5D3QA 5TDHA 3LC2O 1F14A 1E2IA 3NBZC 1N25A 3FB1A 4XYBA 4DN6A 2XVYA 3THOA 4QGPA 2CFOA 4WOPA 2W4MA 1A4UA 3SSMA 3C85A 5JMTA 1WO8A 1F3LA 2GZ1A 3FRIA 4REOA 5DKFA 1CJSA 3DKRA 3MBOA 4PA6A 2KMLA 1EJ6A 1USKA 3FDZB 2ECPA 4HGZA 2H4HA 5BO5A 3T5TA 3UANA 4BVGA 4EFEA 1WDTA 4R8MA 5EFOA 3RHSA 5EO3A 1DMRA 5KOJB 4FJ0A 1B04A 1URPA 3OZRA 3MOGA 4HQRA 1G3UA 2R97A 2CXSA 2W9XA 3JYNA 4BIIA 2WZBA 1TQ4A 4DARA 4GNRA 1W36B 2C78A 4UEJA 3GDGA 2WF6A 2IYXA 4MVQA 2HXYA 1Y7IA 2C4VA 2PKEA 2W6QA 2X3YA 3VKUA 2WM3A 5BMVB 3EPJA 3TZQA 5HP7A 1XMPA 4JOBA 1R50A 3KOMA 1Z3IX 1JNXX 5AHWA 4ABYA 1K6MA 1KDOA 5G4UC 1DXOA 2B5OA 4PAOA 4B7CA 3K9AA 4L76A 3U09A 4GVPA 4LJYA 4TYPA 1FVOA 1TZMA 5E7MA 1O9HA 2IU6A 3VZDA 1ZONA 2F55A 1OCRB 2X6AA 2ZOVA 1SXJE 3JQPA 4Q6GA 1E2DA 3T9CA 1LK0A 4JMLA 1YK0A 1Z8NA 4HNGA 3RFCA 3DDNA 2M32A 5BSFA 5BV0A 5EWMB 2TMDA 4I2VA 1LBEA 5F3DA 4MVJI 2O7SA 2JI6A 2G06A 4V38A 1SXHA 5FCDA 3MWYW 3P9IA 3SZMA 5JVDB 2PXAA 1CX9B 3NOXA 1WXFA 1IOLA 5DHTA 1JAXA 2EFHB 4AKTA 4IGFA 5GVSA 1DOAA 1WXEA 1IB6A 5JSZA 4IYHA 1ZK3A 4ZZ1A 2GETA 1UBKS 3PT5A 3E9CA 1J9EA 1OAOC 2A1TS 2BFPA 1P19A 3MSXA 4BTVA 2NO6A 1J90A 3WP0A 5AICA 1KJWA 3QVSA 4LHEA 3V1KA 1DEXA 4AJLA 1UDCA 4DT1A 3T3OA 3VO1A 1RZUA 1ZX1A 2ONZA 1GM8A 1BAPA 1TJ5A 2CD7A 2PMKA 2XQGA 2YV2A 3FPFA 4ODIA 3VPBA 4XWOA 4HK4A 5JXIA 1Y5RA 2B94A 1RRKA 4YN3A 5L53A 3DKKA 4MQFA 4BNUA 1MC5A 5LQCA 2RHJA 1QB8A 1AN9A 1RJ9A 2ZQ5A 3UJDA 2B2XA 4FNOA 4S1VA 2AHZA 5FP0A 1DEHA 4Y2GA 1NNUA 3N2KB 3CUSA 1VHAA 4Z5XA 4CQLA 1PL4A 1J2EA 1JALA 3HCEA 2CLKB 5ANRB 3ZZUA 1JPXA 1TOAA 3L8MA 5BSMA 3CGGA 5ERXA 2NADA 4GDFA 2O50A 2XDQA 2EGHA 2QRKA 3FYUB 4MYCA 3VDQA 4ZO7A 5CTJA 2IWHA 4CLXA 1USWA 1O94D 2PGIA 3MA0A 4F4UA 4EJSA 3CCQV 1TU0A 2RGEA 3HKEB 4FLFA 6LDHA 1RWXA 4ZO9A 4UVAA 5GZ6A 4AMBA 2PSSA 4W1PA 2D7DA 3O93A 5TPZD 2IY8A 5JPCA 1A2OA 1X2EA 3RYHB 1YQXA 2CBZA 3I8XA 1H5QA 4XIGS 4BUCA 1WLSA 4C7BA 3PTLA 3IJPA 3H3JA 4A27A 3A0BZ 1XMOB 2PL3A 1OLUB 1WZUA 2Q5HA 3K31A 4L9AA 4UUAA 5FBWB 5KIAA 3KJIA 2AJTA 5IT4A 5KU1A 1DAPA 2ZJ4A 2TS1A 1KMHA 3DF9A 4IGKA 3Q6MA 5F98A 4N1AA 1UM9A 3WC4A 4EY3A 1YRYE 1W36C 2BHTA 4A73A 2CK3D 5TQJA 3V8QA 6AT1A 5LQRA 2B33A 2AXQA 5HUJA 1JKIA 3RS4A 2F43B 1HE2A 2AG6A 5JZ9A 1MABB 2QRVB 2RGDA 4IVPA 4ZOAA 3AUXA 2ZITA 3B2NA 1BFUA 2IYPA 4U2CA 4TYWA 1O6GA 1RWBA 1AN0A 1XCJA 4FB5A 2C61A 3RUDA 1HWYA 2AN4A 2H31A 2BSKB 1D4AA 3JR7A 4EMBA 3KTAA 4FN4A 3NVKI 2HHJA 1OFGA 2OG1A 2C7PA 5LP6C 1KY2A 4G63A 1J00A 3E9DA 4JB0A 3IDQA 4BBPA 5I9TA 1SHJA 1VSQA 3I58A 3VYWA 3ZV3A 2X0LA 3X1KA 3WLSA 3O8BA 3RROA 4CG0A 1ZVJA 5LD2C 4CKYA 5EZ5A 3I32A 3V5NA 4UCQA 1SK8A 3E89A 1ABFA 3KM0A 3OR6C 5B1BC 3S7TA 1UQTA 2B1GA 4MCHA 4TZZA 3SGIA 1C9NA 1V55C 2DGDA 2WT9A 2BYTA 2DXIA 5TXGA 2NTEA 3LYLA 4YDRA 5ARCA 4IDDA 2FZ5A 3PE4A 3G0HA 3ETGA 5K0LA 3G5MA 2JGIA 3T5PA 2BE9A 1TM2A 2OLEA 2ZDQA 3P9QA 4I50A 3QUWA 3BXFA 4IRUB 5LQDA 1FJXA 3IEVA 3DHEA 3L7LA 4AS2A 1QJCA 4DRZA 2H0QA 3LQ2A 4YRTA 1OFVA 5CLJA 5JROA 1AP6A 2IIVA 3FWYA 5C7OO 3CNQS 2VR1A 3RT7A 3EE6A 1R4MB 1U9IA 2AIRA 4G0WA 2YEVA 2PLNA 1O4VA 3V8EA 4EPVA 2ZE7A 1LUAA 1NMSA 2VSYA 3BE5A 4LJ4A 4ZRNA 3ZDBA 2QKAA 1I7QB 4K6CA 1R0ZA 3T7SA 2R6JA 3WQSB 5IYCO 1WXDA 2Y1KA 4A0GA 1QR8A 1UBEA 3BK2A 4GI1A 4OXXA 4N4AA 3RHFA 3RRXA 3C3WA 3EEYA 5FNVB 3UWSA 2CTPA 3OQIB 1Q44A 2VRZA 1X14A 4RFLA 2G77B 1RZRD 1QR6A 5DSXA 5HOQA 3AVXA 3SDZA 3OQPA 4X62O 1NJ2A 4P83A 1TI7A 5B6JA 1UFRA 2WRZA 1JDTA 2WICA 1PZMA 5A05A 4B84A 4ED9A 4BNHA 3EMDA 3B5JA 2QN8A 2OV8A 1ZIOA 3JYLA 1E9EA 2X5OA 4HVTA 4MO2A 4L8JA 2WU1A 1PWHA 3ITEA 3LP6A 3IE2A 2H1VA 3UVEA 4Q4DA 3EARA 3K9LA 3JV7A 4C5BA 1I36A 4N3NA 3W9BA 1DAKA 5IF9A 3VNUA 1P44A 2HK6A 1LKZA 1A76A 2OD2A 1JG6A 5EHNA 3IV9A 5CX1A 3VKFA 1QGUB 2QN2A 3ZQ6A 2R2AA 3CO0S 1B3QA 3ZWOA 3IUYA 2Y71A 1BCRA 3ELYA 4E7PA 3LYBA 2GXSA 2WHRA 2GJAA 2V65A 4NXMB 1XKLA 3REGA 3TLAA 1N1MA 3VM6A 2Q0OC 4E5KA 1QZUA 1VL0A 3CPSA 1X1AA 3DMFA 5DN9A 1F8UA 1XZJA 1XJWA 1IN1A 1P60A 1YJ9V 1E79D 4LX8A 3O65A 1ESEA 1Z6YA 3KYCA 3QP9A 3SEFA 5L4SA 2VT7A 4ARCA 1Z2AA 3EZXA 2YX1A 5BP7A 1L4EA 3L1VA 3RTDA 3GEEA 1HYQA 1SOAA 2XCOA 4IUYA 3HVRA 4YQEA 4NJMB 4ZAWA 3K0SA 2Q46A 2A0XA 3NNNA 1RYBA 2WA4A 3P2OA 2OFOA 3OMXA 1ZPDA 4Y0AA 4BGDA 5PGMA 5I7VA 4D25A 2NACA 3QYFA 1SURA 5J40A 5KCMA 4XGIA 3UY4A 1DU4A 3N8IA 4Y2HA 4Y7DA 1OWPA 1RNLA 1SD2A 1UBGA 1Y3BE 2FLWA 3M89A 5B5EZ 1PJSA 1N8NA 2WYVA 1RWOA 3H2KA 3NZEA 1AUXA 3K2BA 4PC1A 5GP1A 5TQ0B 2C82A 3HWRA 3PZBA 1H3NA 3H1TA 3QLEA 1W88B 2AHOA 2IODA 2FMUA 3G9XA 4JGBA 5FLEX 2DPMA 2ZYAA 3VZRA 3C70A 4U6NA 2I4RA 2ZTVA 4XOUA 4CIXA 4DCCA 3S0YA 4XFDA 3T34A 1TRKA 1QP0A 5CB6A 4ZT7A 5ES4B 3RTBA 3FGOA 4NATA 3N4ZA 1ZH8A 721PA 2QYHA 5DT2A 4TL7A 2DQYA 3LE8A 1OCEA 2DT5A 4DLTA 2H1OA 2L82A 2JZOA 4L72A 4M89A 2F9LA 4BWYA 4QVGA 1IXSB 4WFEA 1VP9A 2YKGA 4C06A 2M1XA 2XGJA 3PRHA 4M0DA 4L7VA 2BMDA 3WNQA 4CKWB 4EY6A 4G4JA 1A88A 3A04A 1TW2A 6Q21A 3MJ4A 4IQ8A 3RBXA 1XOIA 3V3KA 4PWYA 1JDSA 5F1OA 1SCIA 5JFOA 2QKYA 3I45A 1BQ0A 1CNEA 1CEZA 2BONA 2AUNA 3P4YA 3PJEA 4MUNA 3RM3A 3ZYCA 4F45A 2IS1A 4WLEA 3R76A 4JXKA 2Z2ZA 3P5SA 5FL7A 1CY2A 3DEZA 3ABMC 3E22B 1H85A 1TYCA 3FVTA 1QM5A 4O2AA 1U90A 1YHNA 3E9QA 3MTGA 3QTYA 3QV2A 4HQLA 4LQ4A 4E32A 4CNBA 3IXLA 5DEIA 4ENTA 5IHPA 4L15A 3SYTA 4PAGA 2H0AA 1XVUA 4YA6A 1THMA 1K3FA 4ZIRA 3EEFA 5JOQA 1S72F 4W5TA 1NXOA 4PR0A 5ARDA 3DEHA 4GR4A 5ECYA 1A8PA 3IULA 5IDXA 3R4CA 3TOSA 1E98A 1CQJB 3DB2A 5B36A 4FXPA 2KYRA 3LPLA 4H0NA 4NJOA 3T7AA 4OHKA 1L5ZA 4BT2A 2HBZA 3CZAA 1Y98A 1VMKA 2JKYA 2OHJA 4J7UA 1Y8RB 5FXMA 3WISA 2VWHA 1Y6XA 2BGJA 4BYGA 2QWQB 1RPZA 3L92A 5U9CA 4O4JA 1XNGA 2BGNA 2WAXA 3COVA 4URUR 4B48A 2ZUEA 4GZ6A 1UBSB 2WYWA 2K6GA 4PN7A 1Z0JA 3K1YA 1CRLA 3LL7A 2F8SA 4E5UA 1QIKA 2QEXF 3DMHA 3FWNA 1QO0A 1PK8A 1ZN2A 7AT1A 4MSWC 4XJVA 4OGWA 3IKEA 2ZTUA 2GYYA 3OPYB 1NN0A 2NOAA 3ZXXA 4B32A 2ZXWB 2G0NA 3MJRA 1KYVA 4N7RA 1RHKA 1VPDA 5FI3A 2G9IA 1D4OA 2Z9CA 1BS1A 1CRZA 4FI3F 3HCRA 2X2FA 3BS4A 4ZCTA 3HJBA 2OKGA 4E07A 1RFYA 3W78A 1G21E 1KMHB 3OY2A 3T9AA 4UCRA 1KY3A 1NAIA 2RJOA 2XITA 4GBMA 1W49A 4A36A 1NDQA 2YY6A 2IUYA 4X6YA 5C51B 4XB1A 1SHLA 1CFZA 4MEAA 4G8DA 3AGKA 2Q29A 3M70A 4AY3A 5CBKA 2F8MA 1XZDA 4GG1A 4IQ4A 4AJIA 1GG2A 2Z2YA 4UE6A 2WU3A 4PHTA 1CUAA 2I4TA 2DYYA 3TRJA 1XRNA 3HY4A 1JLKA 1H2ZA 4FLZA 1UBUS 1XQ1A 3I83A 4I1UA 4PC7A 5IJAA 3VPSA 4CS4A 4Z1MD 5H1YA 1SHUX 5EL0A 2Z04A 2JEZA 4BVFA 2P6OA 2PXHA 3WAJA 1GOTA 1NVDA 4PA4A 1V6AA 1D5AA 1UKCA 3KWLA 2FDRA 3OY7A 3TD4A 1FKAO 3HABA 4NDAA 4UTZA 6REQA 2BM9A 4M3NA 4TXHA 2HR1A 1Z6GA 4HDRB 2WUGA 5KVCA 1Z83A 2WHQA 3TVYA 2YTZA 1SVLA 2N48A 2I71A 3EWSA 3IEMA 2FSHA 5KX5F 4QYWA 1S0VA 2GERA 4XQGA 4AQDA 3F9CA 1GA6A 1T1GA 2PSFA 1UJBA 1A9SA 3AEKA 4LJ5A 4XJSA 1ZK0A 3C7DB 3QXJA 4V03A 3BRQA 3IJ5A 3IVCA 3LT4A 3N5KA 4HZ3A 5G0WA 3V3TA 4K88A 3UWPA 4BL5A 1FRFS 1YE8A 4YXWA 1P74A 4TV9B 1SBYA 1Z0ZA 2FV8A 3SX4A 4BCCA 4DL9A 2JDIG 2WTUA 1MNQA 4WXYB 4DT1B 1WCV1 3K6JA 3VOAA 3V4SA 1DFGA 3CHXA 1SUSA 3I56F 2E4UA 2JJ8A 2Q8NA 2R7NA 2WAOA 3OPYA 5CFQA 1JKFA 1YHZA 4NK4A 1XAHA 3H5AA 3Q41A 3ELUA 4LZNA 3I0ZA 1Z2CA 4RA6B 3COYA 1PR0A 2G5CA 4BFUA 2DECA 3ORYA 2W11A 4Z99A 1FW6A 2AN9A 2VRWA 3HEMA 1TAQA 1E69A 4WWHA 5C0OE 3TXXA 2YIMA 1NSFA 2ZATA 4BNVA 1BEUB 2AUMA 4YI3A 1W5AA 3B8HA 3R7FA 2DYRB 1QYVA 3SBDA 3CCEF 1L4YA 4WK0B 2L19A 2OCLA 1E20A 4DNFA 2ZKOA 1MGOA 1QHEA 3ZJZA 4QGGA 3VZSA 3ZWDA 3PLRA 3KCYA 3MYYA 1YJWV 1EJBA 1Z4QA 3QU5A 1BWQA 1AQNA 4WRRA 5JAIA 3ADCA 2JF0A 4X3MA 2Q4TA 4ESEA 1QGAA 4LY3A 5KNLA 3T4ZA 1RTTA 1V8PA 2JGMA 2JGLA 2XCQA 4TQ9A 4LZOA 1AILA 5LHIA 4YYZA 4H7IA 2XZPA 2XVMA 4R9SA 5H68A 4YCMA 1RM1C 1KU6A 3F2VA 3RE3A 2LFSA 2P6JA 1N36B 1GGMA 3C87A 3DDWA 3HS3A 3I2IA 3N7UA 2H8CA 1G21B 2UXDO 1M75A 2VRBA 2ZRLA 3TQIA 1QVFU 4K3AA 1HSOA 4G5QA 1UPAA 2ZI9A 4KGXA 2BR3A 1M1ZA 2HRQA 4GLXA 1NWHA 4J41A 5KTYA 1OFIA 1EUZA 1K7EB 3MJTA 4H7EA 4I6JA 4J7ZA 1KORA 1SH7A 4I55F 4WX2B 5E7IA 5K3EA 2I91A 4DV2B 5AUOB 4CKWA 1Z4MA 3P5BA 4LWOA 4L16A 3CEHA 4LDPA 4JU8A 2XV1A 3JD4A 2VSQA 4P31A 5F35A 3S5JA 3WBFA 4S05A 1QPGA 1ZH2A 4LDNA 3DXRA 4YV1A 3RG8A 4Z1VA 3IUNA 2EAUA 1M74A 1P9NA 3FHOA 5DE3A 1V7ZA 4CM8A 4BGEA 3JQDA 3CMAF 4YDSA 3F4BA 4N0PA 3VHXA 4RY9A 1OZGA 2JLRA 4TWAA 1M0EA 1MG5A 1J8QA 1YQQA 4TN1A 4HCJA 2QUJA 4Q15A 4QUGA 1Y42X 4NAHA 1QLNA 3RV4A 4ATNA 1ZD4A 4N48A 4DDHA 2PDAA 4FFMA 5T8KA 4PEVA 1HTTA 3CV3A 4BVQA 2H9IA 2IXTA 2IHKA 3H1IH 5AOVA 4ARAA 5JO0A 2L2QA 5BNFA 4Z7NB 4KXWA 4QUJA 5H59A 1JDZA 4OCZA 3ZRWA 1HF3A 1GL6A 4AJ2A 4CKXA 5T4FA 4FKBA 1MJFA 4RD4A 5HRCA 2E4XA 2ZYVX 5ERYA 1AS2A 2ZPTX 3FOWA 5TARA 3GLIE 4I6EA 1S0UA 2WLKA 4HZUB 4ITVA 3WRVA 3BK1A 1X7HA 2RK6A 1U7DA 2QGNA 4TLCA 4HAYA 2BF7A 4M9CA 3B8EA 2MSEB 2AFVA 4Q4AA 4UHEA 3EZGA 2Y4TA 3VUEA 3DT8A 1JIKA 4R8SA 2VPTA 1P6QA 2O6LA 2VDRB 4FKMA 4QDUA 5FQNA 3W04A 4BUJA 1Y9DA 3EVDA 1Z2EA 3QKRB 2TMKA 4N9QA 4HS9A 5A6VA 2ZJ3A 4UTXA 3IEWA 3UAGA 5GONA 1IH8A 4E5SA 3L9DA 1DWQA 1Z74A 2BLLA 3QFSA 1WLEA 3V2UA 3QXGA 1UANA 5L3CA 3A2MA 3BF8A 3BCHA 1BW9B 2R96A 2WB2A 3ROEA 1K4CC 3PKZA 4D98A 1Q90D 1JFFA 1QLJA 4II2A 5I51A 5IXYA 4TMYA 4LIPD 5CX1B 1GNRA 5ALVA 1YC2A 1NUQA 2H18A 4GW3A 3N2ZB 3L7DA 2XAQA 2C2WA 3BE6A 5J2TF 3AF4A 2GK3A 1ISHA 1UDBA 3ANNA 5FBZA 4NBNA 3JYCA 2GCEA 2GFIA 2OVFA 4RVDA 2YUIA 4OI2A 2GZSA 1GLGA 2YXEA 2IPNA 5BSWA 5K0GA 2I99A 2P40A 3FF4A 4M22A 2ODEA 4QBTA 1MNAA 1YCDA 3NTLA 5CM9C 5A3JA 4ZZ2A 1CQIB 3TQCA 6PFKA 3CG4A 1QO9A 4PHHA 3GH3A 4RYLA 4ENWA 3PD1A 1D7AA 5DM4A 2FJPA 2WJVA 3L05A 1N7IA 3CN7A 1RSZA 2JDIA 3W8EA 5KTPA 2DHRA 2KB1A 3ABLB 3B7PA 3DTVD 4Y1EA 4XRRA 1Z37A 2EKPA 5IEJA 1JJFA 1FYVA 4MUBA 4DSNA 2IYUA 4LBZA 3ROKA 1I94O 3CCMV 3NWBA 3RUFA 4DEXA 1HG0A 3LA8A 3I8SA 3O5AA 2QN6A 1XDBA 3C8DA 1XI2A 4OMCA 2XRMA 5GTHZ 4L51A 1P80A 3KALA 3OZSA 3CT6A 3MVEA 1G59A 3PP8A 3ZLTA 2IAFA 3PA8A 4G88A 1RTKA 3STXA 3PD7A 1BMQA 3QKSA 4N8EA 3OT4A 4OXYA 4PNZA 4B1FA 1HZZC 1Z33A 2JJMA 3W7AA 3Q5GA 5FPPA 3ZQKA 3ZDCA 2I9KA 4DCOA 4RTPA 3HU1A 2G88A 3BABA 1XXHB 1NJ6A 4UHFA 4CM6A 1XA3A 3D4NA 421PA 1E3SA 4JVOA 5IZ4A 2J6IA 1O94C 5JWOA 5ADUS 5CLFA 2BHLA 3RC1A 1ZJ4A 2H1HA 1A4IA 4V0MA 5DGTA 4OUKX 4WKGA 5J2UF 2E89A 4FILA 4EHNA 3MJEA 4AKHA 5EUCA 1GZ7A 1M6EX 4X3PA 2DERA 1VSVA 3WGTA 2XUOA 4JEMA 3L1KA 3D54D 1QGYA 4IMRA 1XQVA 5LYYA 1XCPA 2QTTA 1NJGA 4BC1A 1LPSA 3FFTA 3HJTA 4MQEB 5G4LA 4AWXA 1K3EA 3NS7A 3UICA 1W88A 3FYUC 2JS3A 3RGBA 4HS4A 4O8CA 4YMTA 5FDFA 3OE7G 1O96A 2QB5A 4Q21A 4BVJA 3HR4A 1ZVMA 2QLLA 4GU5A 4P4SB 5LLDA 1I6MA 4G1FA 1XZ8A 3HCBA 2IXFA 2QI9F 3K9CA 4KLAA 4JJ4A 5GWXA 2BKAA 4Z49A 3ZHZA 1XLUA 1CJMA 4TSFG 2Z1MA 4RKFA 1E2MA 1RABA 1M1KW 4GUNA 1WA8A 3PS9A 4CM9A 1TMOA 2EYQA 1F0YA 3PEWA 2HK8A 3P32A 3JQAD 1IOZA 1SXIA 1DOZA 3D64A 2A1IA 3P94A 3RFXA 2K2QB 1L8AA 5AW2A 4RPHA 2AHYA 1RMYA 1ZKDA 4LMPA 4LI0A 1IBKO 2NUTB 4O02B 5T7BA 2H4WA 3SJQC 2PVSA 4FD3A 2GZHA 3W9YA 2IP4A 2H9AA 3G0OA 4RK7A 3IT1A 4RADA 3QYPA 1YF3A 1VL6A 3NIFB 2IYRA 2PIAA 3QK7A 4RHXA 4B8ZA 1TKCA 1OYOA 4DJTA 5KUTA 1GVNB 5LC1A 2GOYA 4CDNA 4Z9AA 5JG7A 4FYXA 5I7WA 2ROQA 2GPBA 1NQWA 3LNCA 3EVAA 3PNPA 4B5KA 1RLGA 2A5DA 1VIVA 3HZOA 3LT0A 4KODA 5DK4A 3EIXA 3HH8A 4K9PA 4ZVOA 4KOEC 3ZGLA 3FUCA 3IO5A 3T7EA 2VP6A 3RPEA 4D43A 1VXOA 3ABLC 3IAS1 4CQNA 2VAMA 2Q5EA 2BGUA 2VZ9A 3M5WA 3L7QA 4JJ8A 2DWUA 1KZHA 5D1NA 3HC7A 3S2ZA 4BNJA 4XKJA 2EP8A 3N0XA 1EN5A 4FHZA 4K9OA 4QUDA 5B7NA 4F91B 2DR3A 1NRJB 4H35A 3JQBC 3U4CA 3MHHC 3BDAA 1RXWA 4Z4IA 4MVRA 3DDZX 4IIDA 5ESRA 3DMYA 2C3PA 1VP3A 4CIYA 5BRJA 2XDWA 4AZ0B 2ZIZA 3NUQA 2ZWOA 5DZSA 1JHMA 4D4LA 2PL1A 2RKBA 4BEJA 4F3RA 2YHIB 2YN0A 3RC7A 3ZKWB 4D3SA 4D97A 2AI2A 4FMTA 5IJWA 1UJMA 2AC7A 1BNCA 4CKBA 1OPXA 1F8XA 4CR8A 4ZHVA 3L1HA 1QNMA 3GBPA 1C8LA 2GTHA 5C1PA 1OX4A 2G40A 1KGSA 1SC4A 5FOSA 1U3UA 3DSQA 3N05A 1SPXA 3K09A 1NM5C 2D2XA 3MMZA 4HWTA 4NAUA 3X44A 2CNDA 1FZTA 1ECFA 1P5FA 3AWIA 3USZA 1FDWA 2CHUA 2C4MA 3CTMA 1JQ0A 4PXAA 2A1UB 3HFJA 5I8PA 3I9LA 1FRNA 4I50B 3MTDA 4DLLA 1KU9A 1A77A 3CH7A 2VP4A 3D6AA 2CHEA 3PXXA 4QPDA 1H2HA 2GEKA 2H51A 3L49A 3Q6NA 3O8RA 1JA9A 4NKGB 1N2OA 2GWRA 4MKXA 5HCUA 5EWJB 3ZHBA 2JVDA 1Q7EA 1V35A 5CRIA 2HRUA 1AB5A 3MTQA 3TX6A 3FGZA 4YUAA 4ZDKA 4MW3A 1Z22A 1GAQA 2FZVA 2RKWA 3NH6A 5FBRB 1X7OA 1I3NA 4IQFA 1NJIW 3IXQA 3M1AA 1Y80A 4UVIA 1SG9A 3NM4A 1EFPA 4BKMA 3S03A 1CZRA 4XWGA 4QSHA 2ERXA 5ED0A 2FN8A 4CKCB 1PG2A 3H2BA 4CFYA 3VI3B 1VE1A 3QTBA 2UYHA 3AIIA 4QDJA 3KJZA 4ZVLA 2ZNJA 2TECE 3R4VA 4DMUB 4UB6Z 3AXSA 1QLHA 3B1ZA 2FUG6 5JWRA 2DUMA 2IW3A 3LCMA 5FTLA 1TZKA 3D8RA 3LVFO 3BSSA 1JPVA 3ND5A 1ZBDA 2OXRA 5H16A 4QGAA 3AB3A 2BIFA 3V42A 1GZ5A 2QYOA 1SK9A 3H17A 5KCZA 3SP1A 4BX0A 5I48A 3MNFA 4K40A 2I2WA 3DZIA 1GTJ1 4RTJA 2PKRA 3OSUA 4FQ7A 3L75H 2DP4E 1UXIA 1VBFA 4MKIA 4RELA 4Q9JA 1CUCA 2QI9C 5JJBA 4KPUA 4ZCPA 4OPHA 4KSBA 5B37A 3AY0A 2JDID 1FP2A 4N0EA 1CT9A 3JW8A 3VZQA 2DFVA 5IJ0B 2FEPA 3SQNA 2HJDA 4GL2A 3KPYA 3QVGA 5CA3A 1PYOA 4WZAB 4BX3A 4KR0A 4GKBA 3SYLA 3A06A 3MCTA 5JJEB 4DANA 1AJEA 3B1WA 4UM7A 2XZLA 2HCFA 4K9DA 1JTVA 3VR1A 3NBFA 4CCAA 3DZ8A 1WOYA 4MR9A 5T4EA 4W4LA 2JAXA 4B3BA 3F96A 1YL7A 2C83A 4K8XA 4IDOA 5CH8A 1EP2B 4RS4A 4YPFA 4OFBA 2I55A 1KMNA 4YY3O 1NBIA 4FEYA 2LQTA 3I37X 1W0CA 4LA4A 3O31A 3EFBA 2IHTA 3PQ5A 4PC3A 4PRKA 4IUBS 5B7PA 4U7TB 2H59A 5KHLB 5JCXA 2GO1A 1QLEC 1T4BA 4CKEA 1T0HB 3V7WA 1WY7A 3N2KA 2Z1EA 2CXXA 5KVAA 5TLSA 1W2BF 2P78A 3U11A 1ECJA 3DV0A 3I30X 3JQ9C 4WSOA 1Z63A 1TVMA 2C9MA 4I1OA 1S3FA 3ZS8A 2PVCA 3EASA 3MBMA 3GB9A 5ELLA 3GLGB 4QEKA 4L1KA 1HDEA 1XTQA 1ZGHA 3HPQA 3NAQA 1W6RA 3MBKA 3VYSB 3EIQA 5GGYA 4HDQB 4JEUA 2YXZA 1HMPA 1UFOA 4URXR 1ADJA 1DAHA 4GRAA 4TLBA 3TNYA 3WMRA 4W4KA 3HHPA 3OAAA 2VTBB 3FBAA 3U3OA 4LC1A 1L7VC 3C8ZA 1SUAA 4PYQA 2AOVA 4N49A 2AFHE 5EWLA 1FY2A 3H1JH 2A3RA 5IDVA 2J5KA 4S0XA 1E6CA 3T9EA 5JSZB 1NR1A 2C88A 3RNOA 1GUAA 2IH1C 2CVQA 1NIJA 1Y74A 5C34B 3BA8A 1NLZA 4EITA 1VJGA 2AZ2A 4JI5O 1YZUA 1CPYA 3ZI0A 4R2KA 1ZM9A 4OBEA 3T5GA 2PPLA 4F71A 3K08A 3K5MA 4C8IA 1U9ZA 2ZT7A 1KRXA 1N0IA 1D0VA 3NHJA 5JAZA 3FHTA 2P9BA 3ZJYA 1T29A 3G7SA 4M83A 2OBYA 4ABMA 2XE8A 3GVPA 1U02A 1Z35A 3HU5A 1NR5A 2G76A 1ODIA 3B6IA 3G2KA 4RSGA 3SBXA 5IG2A 5CD1A 5CB4A 2Q9BA 3BERA 3KR1A 4Q66C 3W7VA 2HHCA 2LZ0A 2OL4A 3STWA 1ZD2P 3A6HA 3T3DA 1BOOA 1HNNA 1H0HA 1BMFD 3ENWA 3K0BA 2EKLA 2ZB2A 3NBKA 3FTCA 3O2SB 3PQ4A 4MMXB 4UVDA 5DTJA 1SXJA 4C04A 1LDNA 1C7JA 2YCBA 3ETHA 2NXWA 4JLOA 2X42A 4RGYA 4NLLA 1AKUA 1PYDA 2W8BA 4AN4A 3KETA 3K04A 5U1PA 3UJ3X 3U4MA 5CBPB 1U8XX 4OHYA 4IHAA 2GD2A 5TGDA 4YAGA 2Y99A 2XUMA 1PGOA 3BORA 3LX6A 4FM0A 1RC0A 3D3IA 3FMFA 4RFSB 5KYKA 2FN3A 3H9GA 1W75A 1HV8A 1SBQA 1KEPA 3VX4A 4PN3A 3EX7C 4GM4A 5CYPA 5AVOA 3WDLA 3O3OB 3A8TA 3RC9A 3FNGA 1DCKA 3QOFA 1UMCB 4GYYA 2PS9A 1AHPA 1W581 1B43A 5AVUA 1I13A 3OD1A 3NDJA 1I4LD 2KBEA 2ZWPA 2NG1A 3NATA 1R5NA 1EZ1A 4XE5A 3L6OO 3ETNA 4GRIA 3MILA 2XMZA 5DW0A 1C0PA 1AQIA 2HMSA 4MPDA 5EXSA 2XSZA 4PA9A 4MINA 1J0EA 5EQFA 5EMKA 5JJ5A 3PLNA 1XNRO 4QGBA 3TJTA 1GPBA 2PGDA 2G6BA 2VCHA 2OGUA 4QYIB 2O6HA 3PEEA 3KXDA 5CU7A 3I23A 4DLWA 3AKZA 4DCMA 4B34A 3U7IA 4EG1A 3P30A 1PZXA 1M0TA 4K1XA 4ZO6A 2IH3C 5HILA 5ITSA 1RXYA 4MVCA 2N75A 2JKZA 1XNHA 2KTUA 3PFNA 4GI3A 2XYVA 1OWMA 1XK6A 4BUZA 4JBHA 3QOWA 1V2HE 3TI9A 1ESZA 3BA1A 2JGKA 1MH9A 1NTZH 2VQFO 4L0DA 3FF1A 1ZWIC 4PPGA 1V5IA 2DFNA 2Z8XA 2OPHA 3IELA 1EEHA 5BR1A 1O94A 1S1MA 3P4XA 5L6MB 3CUTA 1RACA 3DWIA 3TL6A 4IT5A 2QSAA 4HWSA 1QE3A 4RZUA 3OIYA 2NV2B 4G84A 2EKZA 1ND5A 1RYEA 4R2WA 1DLBA 1SY7A 5J1TB 3V4ZA 1XHEA 4ZQCB 1L4BA 3T0GA 1SMKA 4BFZA 1KQOA 2QT9A 4H0FA 5GQSA 3W2TA 5CA0A 1XQ9A 2C2MA 4BGIA 5B5SA 3TUZC 2O19A 2CV2A 5CIQA 3CCJF 4B6JA 2OM2A 2EX4A 4PTYA 4RDCA 3ZWWA 5HIJA 2O7RA 5F51A 5EIOA 4L5YA 4F4HA 4MUGA 3ZW7A 1WV0A 3QPVA 3IP5A 4B4UA 4EKDA 3I0MA 4HTFB 4AL4A 4E70A 3VX3A 2HF9A 1GU7A 5HFLA 1ZC3A 2N47A 2C0CA 3CLRD 3OM0A 3V34A 2OE2A 4I1VA 5FTNA 2XXAA 1Z7BA 1Y9EA 3GFFA 3FYIB 3SQDA 4TUYA 4C22A 4HI0E 2BH9A 1K2WA 4XIIA 5HYVA 3MB8A 3E0QA 1DIBA 3NWEA 4MR7A 4UTPA 2ON6A 1L8LA 4LOHA 4R5MA 3VC3A 2X3UA 1NQ5A 4OQNA 4CV3A 2FGKA 3L7CA 1GT6A 4PPNA 4W8OA 3IHWA 4I19A 3R44A 1ICIA 1NXSA 2W0FC 3L6UA 1JZTA 3KQOA 1FLAA 3BMQA 3V6MA 5DYNA 2R4QA 1HPLA 1R8SA 4FE7A 4KGDA 3F7MA 5E7JA 5K7SA 2B3DA 2FR0A 3TLJA 4BWVA 4BU0A 2HRYA 2EARA 1F0NA 1OPRA 2HMTA 1JA0A 2P4QA 4Q9AA 4DF3A 1M2FA 3U44B 2B2CA 2IJGX 4FPPA 5LP6A 2VQEO 3QMPA 4P3PA 3PNLA 4G0VA 4RDXA 3FPIA 1R9GA 3CF6R 3ORQA 1QOQB 2BCEA 1YVUA 3PVZA 4A5OA 2E1RA 4XQEA 3N8GA 3WWOA 3L4SO 3G2NA 2IYLD 4EY4A 1DEOA 3NYIA 2CE2X 3ZDDA 4YIOA 2EZUA 3GT3A 3RSCA 1AV6A 1QIJA 1C4WA 1H2EA 3D5QA 1CVLA 3FIUA 4HMPA 3BC1A 4J16C 4R7ZA 3LLCA 3JQ7A 1ULSA 3BSFA 4WFJA 5JANA 4GYJA 1AGNA 3H9UA 1WPQA 4JP2A 1T9AA 5IUKC 4D9IA 4ID3A 3JS5A 4H37A 3H5RA 3AUSA 1C7RA 4ENQA 1Q86H 1VECA 2ZRAA 3EF1A 3EJ6A 4G25A 5CH3A 2WPDA 3QELB 1UC8A 5K3FB 1JE0A 3LA6A 4CVNA 1T5DX 2IZ7A 1HLDA 4WFFA 1IXMA 3KJFA 2QNBA 3NKFA 4KXFB 3PEFA 2DPLA 3JQ7B 4UKDA 4QDKA 2XI4A 1DT9A 1X7PA 3D3JA 3I8OA 3V55A 5DGHA 1XJ0A 1ITZA 2MSKA 3FMPB 1A5SB 1ZVKA 4BOYA 4FXOA 1E92A 2DEUA 1HZZA 1W34A 3M34A 3ASNC 5DEOA 4OX9B 4KJZA 4PX2A 5AW8A 1LSOA 4KL1A 4H6PA 2OGTA 3DXZA 4O4HA 3JRXA 4H3HB 1CW2B 3RJTA 1RR6A 2VPPA 3D3KA 3A31A 3UH0A 4BT4A 2FUG1 2F1HA 1JI0A 4EFMA 3B9BA 4B7UA 1JR6A 3T0IA 1X8XA 1BMDA 2X7XA 3MWEB 4LKRA 3TQOA 4D3ZA 3HDTA 3HJGA 5HFJA 4JHXA 1YRBA 1JHXA 1DZ3A 1PJRA 2Z3WA 3ABUA 2JCBA 4PS0A 5B7QA 1JDVA 4L2IA 5EIAA 4KLCA 5TGZA 5IASA 2WQ6A 1XNRB 1P4GA 3NASA 5L7YA 1FSZA 4DV6B 2IYZA 3EQ8A 3IP9A 4JP5A 4UVGA 1W3EX 3LRPA 5IK2A 4URVR 1NTMH 4GX0A 1G20E 1YBMA 1RKUA 1XHFA 4QOEA 2MSDB 4UV8A 1UP6A 1I2CA 2FPGA 4G89A 5KSOA 4MDEA 2JH3A 4GUAA 4PLTA 1MG1A 1N2HA 4LFAO 4MTCA 5DNCA 2GNPA 3Q7EA 1HZJA 4X20B 1E1LA 1QZTA 1BHAA 3KZIZ 4K3UA 1IHOA 1WKVA 2ZRJA 3QLTA 4PQRA 2TYSB 4DUZO 1EBFA 2PYLA 3ESXA 4MICA 4BVKA 4Z4HA 2M7WA 1K5QA 2WJ3A 3FLBA 2PX4A 4C76A 3ZX6A 5K4HA 3F4LA 4QJBA 1BIFA 2AFRA 3B7GA 2E76B 2JFVA 4RDHA 2MSNA 1N0NA 2ZIWB 3BYQA 4PZDA 1EHYA 1EI9A 1RWWA 2QV7A 1U8AA 1EGVB 1AI5A 3B40A 1KSJA 2D4HA 1VKNA 3D81A 4OXKA 5IP5A 3P45A 2D2EA 2PFKA 3I0NA 3LCRA 2J7KA 3U9SA 1ENVA 2YBDA 4B3FX 2HSGA 1JOYA 3IMEA 3ORSA 4N18A 4FZ1A 1PNVA 2PKWA 1QQCA 1YUNA 4YJ3B 2P3OA 4IIGA 1XQ6A 3TDMA 2RGGA 1SC3A 2CHQA 2NO7A 3MMNA 4FC7A 1PR4A 5LWHA 3F7TA 4AIIA 1OX6A 4N5IX 3VR5D 1KBZA 4LJRA 1DAOA 3PZRA 3QGMA 3WGOA 4ALKA 5E6RA 4Z3KA 5LKRA 3N2GB 1AGRA 2H17A 2QAJA 2WLTA 3O73A 4PM4A 1JY8A 4Q1VA 1WU8A 1DT3A 4PV1B 1LPNA 1U0LA 4DV4B 2OA0A 5IJ9A 3DD1A 1W4LA 3GBVA 4ZQIA 3UPTA 3A3YA 2BL4A 3H1FA 2EJWA 1Q7YW 1DBQA 1KI6A 4P4GA 5DNAA 5ALOA 4UTNA 5FR1A 4NS4A 5G4KB 3TXSA 2BKLA 3ZH2A 1HT2E 3EA0A 1BVHA 4GLJA 3FKQA 2AWOA 2BMAA 2O8VA 1DUIA 3U10A 2VHJA 2YHSA 1T8RA 1W5BA 2QTVB 1EGAA 4JI0O 4FGZA 4MULA 4XVHA 1FIUA 1YB1A 1QBGA 1WVIA 3ASNB 1YHQF 1UBTS 5K3FA 3DM5A 3U4AA 2JA1A 4JXXA 4RK0A 3CCJV 2AYYA 4WE3A 3JQGA 1Q8IA 4KR9A 2D2VA 2LPMA 3HJFA 1P75A 1RPRA 1JKJA 1FXWA 2ZAYA 1VHTA 3MFYA 1MFZA 4MTGA 4GNKA 4X85A 5G4VC 1IIBA 4ZCSA 2W93A 1Q3EA 3TXYA 5IUNC 4I5SA 4L87A 3GYGA 1C3VA 3ZMZA 2GTIA 3K9GA 2A0KA 2WWWA 4B3MO 5EHGA 1E1QD 3WYAA 4QPKA 4KWIA 1FS6A 5KB3A 4PSAA 4EQ6B 3DGFC 2PT7A 4GI5A 4LRUA 3N8NA 1L6IA 5I7UA 4LF9O 3EF0A 2BFEB 4UXNA 4FEGA 4IJUA 5HF6A 1BE0A 1H69A 4U2EA 3F6EX 2WVAA 5IWAB 2ESRA 4UHKA 1FJ2A 5KWVA 4H3SA 4Z4CA 4FYPA 1A82A 2HJGA 4RACA 1UIMA 4RQBA 2DBQA 5BN1A 4WCFC 5BUZA 3GI1A 1B8NA 2RGRA 3C2QA 1HL7A 1PFGA 4QULA 4JI3B 4EEKA 5BQPA 4MRPA 3AQIA 1L5LA 3GNLA 4DR7B 5TVGA 3WRXA 3CX4A 4AJ9A 4EYSA 2KWIA 3E8XA 2ZUUA 3PWSA 2NZWA 3HB0A 2QXYA 3FB5C 2QJFA 2W6ID 2BFCB 1YAJA 1BROA 4OPAA 4XWKA 4CEIB 4ER7A 1GKUB 2Q6TA 1W9MA 4UMDA 3WSTA 2PWBA 4CCSA 1BDMA 2P3QA 2GAOA 4OK3A 4Q7MB 3AVWA 3GMDA 3KR0A 4PSUA 1QVZA 1RI3A 1QK3A 3TPFA 1EJ2A 2W37A 1Y7TA 4GLFA 5F7OA 1LGYA 1B3RA 2VTBA 3KVRA 5CG1A 3JQ6A 4DXDA 1I6KA 3AHIA 2BBOA 4XA8A 5DASA 1QQTA 1L4MA 2WQZA 3HFGA 3CZQA 4KH1A 3CZMA 4CDMA 1BSVA 4YUWA 1AG9A 1R0WA 3OFND 2IEGA 2WUFA 4BMSA 2LD4A 7ABPA 1YB4A 2OBBA 1QLEB 1Z39A 4V0RA 1MHPA 2J6CA 1J49A 2VTDA 5J63A 1DDOA 1SXPA 2HWWA 4YRIA 5HFMA 2YQZA 4MDHA 3UCEA 1T3GA 3CUYA 4NZPA 1OA1A 2B7LA 3CUEF 4HEHA 3W5VA 4MROA 3QLVC 1UPCA 2VPYA 4F5EA 1BX3A 4I1RA 3E5NA 4GD3Q 2PSDA 4M21A 1E7RA 2H1IA 1T6ZA 2V7XA 4G37A 4M9RA 4HDSB 4J4TA 3W6NA 1L7EA 1Z38A 1NY6A 2FN9A 5A03A 3OIWA 5B7GA 1ODEA 1D03A 4K6GA 3A27A 2P6MA 3KR9A 2UUOA 5A5FA 5J23A 3EDOA 1QO0D 1B06A 2O7VA 1FUKA 2EATA 2V03A 1T0BA 5DRTA 4UM9B 4UBIA 3X1JA 1UAGA 3KZNA 2XAAA 1GSIA 1S2DA 3LOUA 4TSKA 3R41A 4UMVA 1BXRA 1M1YB 1ZWLA 3SOPA 1U7TA 2EW8A 2B8WA 2QY9A 4BO2A 2QX9A 4DIFA 1H6BA 4RLSA 2GHQA 1CUIA 5DX1A 4BATA 4CEIA 2RAPA 4GPIB 2R6HA 5TE9A 1KP9A 4C4PA 3K2EA 3RA5A 4N54A 3MELA 4ERNA 2IEIA 1RWPA 4JOSA 3ZRSA 3DE1X 2O4UX 3S8MA 2EFGA 3FUTA 4DKXA 2YY5A 4HAZA 4QXPA 3VMMA 3WXMA 2GAJA 4ZAFA 1CZOA 5JRDS 4HQFA 3KELA 1QU3A 3V8BA 1JLLB 4R16A 3ZV5A 1RWVA 1UBOS 4OQFA 4YJHA 3AINA 1UFQA 3ENKA 2BC9A 3RYCB 3W3AA 2VP3A 2XHZA 4LOLA 4EHKA 3C3CA 1UMCA 2CLSA 2W2KB 2G08A 1E61A 4BKPA 2FL4A 2BCJQ 1PJAA 2QRLA 2CXUA 1MA3A 4BVAA 1FDTA 3O03A 4W5RA 1N3IA 3R7LA 2V6MA 4B74A 4RFSA 4XTRA 3H1HH 4BO6A 4UARA 1IWBB 5ADVA 3RIXA 1XSEA 3BWCA 3C6KA 1YZQA 2G5TA 3DVAA 1YE5A 1A95A 2PA0A 1AKYA 1GL7A 2IHBA 5B1DA 1IV3A 4CM1A 1LF0A 2PV7A 3KDAA 4IL5A 1G291 3E8SA 4KMRA 3Q2IA 1EFPB 2DBVO 2KLHA 3RCBA 5LPNA 3OVMA 1P0MA 3A9VA 5ALLA 1LI7A 5MN4A 1I7NA 3NALA 1G1AA 3AYZB 3H4MA 4LXIA 1KVUA 3TLEA 4AMZA 2PF4E 2NLOA 1A4RA 2XNSA 4DSAA 4TVSA 3CX3A 3OU2A 1UI9A 2Z2KA 2P0EA 1H6CA 5IXJA 5JI3E 2OWOA 3NRJA 4BGUA 2X8AA 4FCVA 3AZOA 4C4WC 2EFDB 3EDYA 3F7YC 3OF3A 4GP7A 3CCUV 3H0EA 2Q62A 5D3KA 2CUNA 2YIDA 3OZBA 1QAQA 1OXSC 3ZCCA 3AUFA 3R0ZA 2Q7EA 1M9NA 4V3BA 3SZRA 4HVLA 2O0JA 3X1WA 2PRYA 1U0SY 1UC9A 2IDZA 3PUXA 4QVKA 2FB9A 2J0UA 4WZAE 3AILA 4BWFB 3JARB 3I9FA 3FDFA 1M56B 1Z7WA 4LF9B 2NQTA 3G2MA 3I9MA 1ETUA 3IPYA 2HF8A 2HY7A 3N5CA 1VQ6V 1OX4B 3I1YA 2A0UA 3STHA 2J9FA 1RHQA 5GVRA 1VIMA 4IMIB 3CD6V 1NRXA 4YASA 3FROA 2VF7A 4AQ7A 4X8AA 3TCXB 2WLLB 3JX9A 1DBPA 1XU4A 3FTQA 5JRZA 3GPIA 2I7VA 5KHKA 3JQBA 1QNFA 2DC1A 1Q1GA 1RLUA 1E1DA 1SVWA 3M2TA 4BQNA 1KXJA 5JD4A 3TFOA 5HGXA 1YZYA 2H57A 3BB1A 2VHCA 4P8RA 2K4MA 5IBQA 1XQ8A 4BFLA 3DAHA 1CB0A 1YHYA 3BEOA 1NJSA 3V1UA 1CLUA 3OPYI 5CVUA 1VK3A 1JG3A 5FEMA 3C8HA 2RB5A 2WU8A 3W2IA 4W5HA 5DI3A 4AYTA 3H6KA 4FFBB 3YASA 4PINA 4KNWA 5EGSA 1N9GB 5I7AA 1YFLA 3FZNA 1W9HA 1RPOA 2EJVA 1N1DA 4L3WA 4LVUA 2XWSA 2QRZA 5HCNA 5BSTA 3T7DA 2Q69A 3BRWA 4F6EA 3TB4A 3ES9A 5HKAA 2IOQA 2CSXA 2NSDA 1AV7A 2ZDGA 3CVUA 1YMVA 5L3SA 2QS9A 1EUCA 4D82A 3U4QB 1PE0A 2E87A 2JJ1A 4JAAA 2B1IA 1GGFA 2FHPA 3ON5A 4J10A 2IK8A 2WF5A 5TT0A 2VEDA 4WZAA 1U63A 3CWZA 3TW8B 4W63A 3SYPA 1DADA 3USCS 3GRPA 3GEBA 3RAFC 1XTVA 3F98A 4DCUA 1D09A 5BPFA 3ZJ5A 1OLSA 4DV1O 4NWOB 2E4YA 4LXUA 4WFQA 3X2QB 1LPBB 1VKHA 2MMCA 1I3OA 1RJFA 2HDNB 1OXUA 5ALQA 3B51X 1DIOB 3H11B 4JT8A 4JYAB 3E8BA 3CCRF 2PSJA 3V9AA 3A3NA 2BFWA 1IV1A 3CJHA 1KC8W 2ZK7A 3UHPA 2O48X 4X7RA 3T8YA 1VYTA 3O4IA 5CB0A 2HQSC 5FBKA 1CC1S 3GGDA 2AXTZ 1N32B 1CKEA 1Q3KA 4YLGA 5FTKA 5H0IA 4QQKA 2UXNA 2WLJA 4DR1O 1T26A 3KEGA 2OP1A 4FS8A 4E7OA 4YMLA 4RVGA 3I04A 3FI9A 4U9UA 2UZIR 1XRPA 2X1MA 4UNIA 3VYTB 4G5SA 4I1PA 3UJ8A 1NTRA 3WA6A 4CLRA 2CGNA 3H4VA 4JVLA 4MV8A 3HDVA 1P7WA 3WJQA 3OQ6A 4DCVA 3Q72A 3TBHA 3WGVA 1MLDA 2OWEA 3M4YA 4PBSA 4UC0A 4F06A 5BWCA 1WSWA 4MUIA 4NOJA 2CF6A 4NBSA 4TROA 3UWDA 3HBJA 1AO0A 2ZF8A 4PVCA 1GTZA 5TV2A</