5EIBD

Crystal structure of cpap pn2-3 c-terminal loop-helix in complex with darpin-tubulin
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
430
structure length
430
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular basis for CPAP-tubulin interaction in controlling centriolar and ciliary length
pubmed doi rcsb
source organism Synthetic construct
molecule tags Cell cycle
total genus 175
structure length 430
sequence length 430
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
D PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5eibD03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5eibD02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5eibD01
4O4LA 4U3JB 5IYZB 4ZI7A 3JAWB 3M89A 1TUBB 4O2AB 4X1KB 5CA0A 3RYHA 5KX5B 5FNVB 5C8YB 5JCOC 4B46A 2RHLA 4TV9A 4YJ3A 5KMGA 1W5FA 4X20B 3JARA 5LP6C 5JCOA 3JASB 5BMVB 5JVDB 4DRXA 4E6EA 3HKBA 3WGJA 5LP6A 2VAPA 3RB8A 3HKEB 3JALB 3V3TA 4IIJA 4YJ2B 4X1IB 4DXDA 3WGLA 4FFBA 4O4HB 4I4TB 4ZOLA 5ITZA 3N2GB 4LNUA 1TVKA 5EIBD 1FSZA 4O4LB 4F6RA 3VPAA 3RYCA 1Z5WA 3WGNA 3N2KA 2XKAA 3RYHB 5CA0B 5GONA 5LYJA 5J2TA 4O2BB 1RLUA 4O4JA 4TUYA 4I50A 4WBNA 5IJ0A 5EZYA 5EYPA 5LXTA 5JH7A 5J2UA 5LA6B 5IJ9A 5JQGA 2BTOA 2RHJA 4IHJA 3HKDB 3RYIA 2R751 4M8IA 2BTQB 3RYFA 4B45A 3E22A 4HNAA 4ZOLB 5MN5A 5MN6A 5ITZB 4EI9A 3UT5A 4I55A 4X1YA 5CB4B 1JFFA 4F6RB 5LOVA 4ZHQB 4TV8A 1SA0A 3ZIDA 2Q1XA 3HKCB 3JATA 1W5EA 5CA1A 5EIBC 3VOBA 4ZI7B 4U3JA 5IYZA 4O4JB 3JAWA 4TUYB 1TUBA 2R6R1 3VO8A 5KX5A 5FNVA 5C8YA 4TV9B 4YJ3B 5IJ0B 5KMGB 3JARB 3C8LA 4U39A 1W581 1FFXA 5IJ9B 5JQGB 2VAMA 3M8KA 4DRXB 3HKBB 3JASA 5LP6B 4EB6A 5MN4A 5JVDA 1W5BA 4IIJB 3RYFB 3E22B 1RQ7A 2VXYA 3HKEA 3JALA 3CB2A 4X1YB 3R4VA 4FFBB 4YJ2A 4X1IA 1Z5VA 4O4IA 4LNUB 1TVKB 3JATB 4I4TA 2RHHA 3VOAA 4EI8A 3RYCB 3N2KB 3JAKA 3WGKA 1RQ2A 5GONB 4XCQA 5LYJB 5J2TB 2XKBA 3HKCA 2GVIA 1OFUA 4O2AA 4I50B 4O2BA 1FFXB 4X1KA 4WBNB 4KWEA 3ZBPA 5EZYB 5EYPB 5M7EA 5LXTB 4EB6B 5JH7B 5J2UB 4EI7A 4X20A 5LA6A 4IHJB 5BMVA 2Q1YA 3RYIB 2VAWA 4HNAB 3VO9A 3HKDA 4O4IB 3UT5B 4I55B 2BTQA 3ZBQA 1JFFB 5LOVB 4TV8B 1SA0B 4O4HA 3JAKB 5CB4A 4ZHQA 2RHOA 1W5AA 3WGMA 3N2GA 5CA1B 1W59A
chains in the Genus database with same CATH superfamily
4JJ6A 4EYEA 3ZK7A 1QYVA 2VP4A 2XB4A 3ORHA 1GNTA 3IMFA 4CM4B 3TEMA 4Q1AA 3JVVA 2YYEA 3G49A 5KYUA 4N7BA 2A4MA 1NF8A 4BU0A 4UXNA 2FY8A 3V4RA 2E4AA 2YMPA 3ABLC 1R3JC 2IYVA 4B79A 4CKXA 1IURA 2R6GA 1SVSA 2LJ2A 2RBKA 2AIFA 3K0FA 5KTSA 3PUHA 1X8JA 3FYHA 4JA0A 1M2OB 1N0NA 3N0TA 3WV4A 5JQWA 4F9FA 2ZSUA 1MXHA 4MMXB 3FROA 2BFCA 1FJGB 4B7CA 3RR2A 1KIFA 1X39A 4BTLA 1VG1A 3O47A 4Z4EA 3CUEF 4HLQB 3N0XA 4LXUA 2GV9A 1RAAA 3ZMSA 4MWBA 1JIUA 2JFPA 1FBTA 5LA6A 1H42A 3EA4A 1MX9A 3OJOA 1PHPA 2QDXA 5JSZA 3GLRA 5HJ2A 2HSJA 2XF2A 3LSUA 2UZIR 2X77A 2RHGB 3MMSA 2H8EA 1QQ6A 2XNSA 3DKVA 5MFZA 4FW9A 3Q8LA 4Q48A 1J8DA 5IANA 1X7DA 4CG2A 4RTNA 2BFEB 3KOOA 2YIDA 1GPJA 4OLHA 2FQQA 4LDJA 1V54B 1M9NA 1H2FA 2RI0A 3F7NA 5ADWA 1NOJA 3KVOA 4F21A 3EFEA 3CLVA 1ACLA 4QOGA 5F52A 4LC9A 4O2RA 3TPCA 3CC7F 1EN5A 2B5UA 3T4DA 4L85A 3A58B 1CYEA 5KKCA 3RFFA 3IALA 3U0OA 3CS3A 4CIBA 1IUNA 2O1WA 2BE7A 4F04A 2RH8A 2DFNA 2CKDA 4HFMA 4OHCA 1VLJA 1NQWA 5JTTA 3ZY4A 4B6FA 2BGWA 2C9OA 1TCAA 3A7DA 2AVDA 3K9FC 5JAZA 3I1IA 1OV9A 3I9MA 5FA6A 4LZAA 3DV0B 3VAYA 1QLWA 3WWZA 4I6GA 1S8FA 2WPDD 3KEFA 1VQKV 3IUSA 3AJ9A 4M2LA 1C3JA 4UHEA 2W8BB 1ZX1A 3OQIA 4TUYA 2RIPA 2WZCA 3D6AA 2HCFA 3W2EA 4ZU6X 1MVOA 3PD7A 3BMXA 3CF4G 2JJMA 3WKCA 3QBEA 1JHVA 4DR3O 3CONA 5D7NA 4BN4A 1OFUX 2JFXA 1P5RA 4MTCA 4E51A 3U19A 5HRUA 3LH5A 2GPAA 4JD5A 3K05A 4QFBA 2X0LA 1TAEA 4I9WA 4L8JA 3WX0A 2PZGA 2ZIAA 3G80A 3TZEA 3IP6A 1AKVA 3EC7A 4NTZA 3JWHA 5B4VA 4GUNA 2R1UA 5JLAA 2H8CA 5MGBA 3OVMA 3F6YA 2XMSA 1RYZA 1X7XA 2UZHA 4FBGA 1YNOA 1YDWA 2WWTA 1G4AE 3B9PA 2HLDG 1NVPB 1WG8A 8ADHA 3PI6A 1ZK4A 3ADOA 4BGEA 3SPIA 4LDQA 4Z7NB 1EK0A 2BPOA 4FYMA 4ZIRA 2WUFA 3EDRA 4DQXA 2VI5A 3L01A 3T3EA 1WCV1 2P9FA 2RBEA 3CG4A 1QVWA 3DWGA 1VQ8F 2ZXFA 3GH3A 3WDSA 3TW8A 1QVGU 1EFVA 4R01A 4X6YA 3FCSB 3NDJA 4QNNA 1YDHA 4NYIR 2QTOA 3DC2A 1OZFA 3BHNA 2REQB 1THTA 5L3QA 1W4CA 3OH8A 4OU5A 4BEVA 3LCJA 3K6SB 3DBHA 3BEOA 1EWQA 3HKEA 4UW9A 3TCXB 3DEAA 2UYOA 3W05A 2P2LA 2DB3A 3M6IA 3PGJA 5TPWB 1NT4A 3VR1A 1HUQA 1OFUA 2NO5A 4EVRA 1V1RA 3P2MA 3EIOA 4GR9A 1VFPA 4F3KA 2QUIA 3G6EV 1X6VA 3H4VA 5EPEA 2WTUA 2FW7A 4A6XA 4HUQA 1NQTA 5ESDA 1KWKA 5F35A 1Y6JA 2QT1A 2XECA 3R76A 4CLXA 3AHEA 1F5SA 4DJJA 4MHTA 3KXLA 2IWRA 1OI7A 3R8CA 2ADPA 2IWHA 1EUDA 5IS2A 3C1OA 2ZS8A 1B26A 5F2VO 4QPZA 1WDMA 4KQMA 5EEHA 3A27A 4I3FA 2B1QA 4EO9A 4RLQA 4AJ2A 1YA4A 4GYYA 2VTVA 4M1QA 5KWEA 3VOBA 1YO6A 1CX9B 4YJ3B 5KOJB 4XASA 3T52A 4OP2A 5HR5A 4X8HA 3SM9A 3F3MA 3UO3A 2BONA 3HWWA 3MS7A 1LUWA 3HB4X 2GUZA 5A4KA 5HK8A 3NEPX 1KDZA 4B6QA 4DJ5X 1JDBC 1JI3A 3RUAA 4MDYA 4U8HA 2R97A 2JAWA 3PKZA 4FMCF 4DKXA 5EB1B 2GCOB 2I7XA 1A5AB 3WAKA 5I9IA 3NPMA 3RSLA 2IG8A 4XA8A 1SM4A 5EKTA 2M6LA 4LSWA 1EUCB 4C4WC 5A3RA 2REXB 2VO1A 4IIJA 1DBRA 1BDIA 2RNBA 2GBPA 3SR3A 1CQJB 2EFDB 4JI5O 2D8AA 2C1ZA 1K8RA 1I1NA 5EY5B 1QF7A 2XB9A 4C01A 3NP9A 1U2QA 3B6EA 3PGKA 4OAPA 2BJWA 4YIPA 2JLRA 3LFOA 3SNKA 3HACA 1EQUA 4CMIA 4PQFA 5FULA 4WFQA 3MF4A 3TNYA 2YHIA 2H65A 3NZEA 3QPUA 5CBHA 4LOLA 4MV4A 1KRWA 3N9IA 1HNXO 1AE1A 1VE1A 3DDWA 3I30X 4FMTA 2J3DA 5HDBB 1AOXA 1KAEA 3MFQA 4JU8A 3L07A 1FC0A 2JHFA 3IKMB 3EWNA 4IGGA 4OQZA 4F9EA 2WJAA 1Q0ZA 4E2XA 3ZWAA 3RJTA 4ALLA 1H6DA 3H3FA 1X19A 3PNMA 2OCKA 4NJEA 5F78A 2H5LA 2WP0A 1TEVA 1SUBA 2CXTA 1USUA 4QBTA 1JEYB 2HJ9A 3G4SF 4IO1A 4CL2A 4FFWA 3ZY3A 1JLHA 4ZAYA 2PXCA 4CUKA 2VYFA 3FWPA 2ZAYA 1SESA 5A4IS 1CLIA 4CFZA 2W6PA 4URWR 1BDMA 1Y8AA 5BPFA 1ZRHA 3QMWA 1X14A 1SG6A 2C3OA 2X8BA 1H8EA 4S35A 4C4ZA 4NCIA 1NNUA 2WDZA 4YRGA 1XUOA 2MMGA 1BL8A 1FXUA 3TQCA 2L35A 2EW2A 2QTZA 4I4TF 2ZRCA 1HFJA 2ZRJA 4F3RA 3I6YA 4OPHA 5JV5A 4GX0A 2D0IA 3BUSA 3W2TA 4WKPA 3ZG6A 4D3SA 3L5KA 5HG0A 3PQCA 3AM3A 1TJ3A 3QUCA 2N1MA 4BWGA 1MHTA 5ECDA 2NMUA 2O7VA 3OF3A 3SHFA 1HNZB 2FKAA 3EGWA 1CK4A 5JS7A 3NGMA 4JQZA 3E35A 1BQ3A 3LUKA 4IMJB 2BBSA 3ZHZA 3PFIA 2CGEA 4HJRA 1ZFNA 5AG2A 1NP6A 1Z2OX 4O4HB 3P5SA 1QQBA 1EM8B 1XMOB 5C8YF 3EW9A 5ELLA 1H22A 4UD6A 1A5SB 1KHTA 1XGKA 3FBWA 4FR2A 3FYUA 4BLPA 2D2FA 2Q4PA 2O2GA 5LZ4A 1PK8A 3EEYA 1GNLA 5KDOA 4HAZA 4WXMA 3SYTA 2E1RA 4ATNA 3CUYA 1G6Q1 3GJXC 1G66A 4PZLA 3V32A 2VS1A 3PB3A 5EZYB 1EINA 3FXAA 1G7SA 4LQLA 1PNLA 3JD3A 1JN1A 4F1WA 5K3DA 4X3PA 2EZOA 2CTRA 4DWWA 2EBHX 2J9XB 1N8KA 3MQWA 2WNSA 2I7VA 1EXWA 1Z5NA 1RP7A 2DT5A 1C7QA 3RB8A 4GOXA 3CKLA 5FI1B 4BIZA 3CCEF 1WPXA 3WBFA 3M5DA 1RBZA 1ZM2A 5FBKA 5FT9A 1JJ2U 3SYPA 3B6JA 4Q5IA 4X91A 4JP8A 3L0YA 2QVXX 3LZ6A 1RXVA 3GZTB 4UMFA 1P2SA 3CM0A 4Q4HA 2Q4TA 4F8JA 2CVQA 4GEKA 3TKAA 4B35A 3IAXA 4UHBA 3WYNA 3RRXA 1N1MA 2ZG6A 2F8MA 3HHEA 3JRXA 4KQ6A 1BXGB 4AY5A 3TIGA 5I9NA 1W0KG 1O0SA 1IOLA 5L4LA 1F7UA 4I8DA 4LBEC 1C0IA 1P9WA 4UPDA 1OT5A 1PPJH 1XVAA 2HU8A 3OR6C 3RHFA 1KAMA 1G2PA 4U2CA 1OZGA 4FFMA 4H7FA 3D8BA 1WV0A 4KSYA 4Y3UA 1PZEA 3I5UA 1SXJA 5CH5A 2Q73A 4RJTA 3HV0A 1VQ5V 4MVJD 1R5JA 2PH7A 3IKVA 1TYDE 3LAWA 2BKAA 1IZ7A 5KYYB 4EM6A 1XDCA 1WB5A 3CRRA 2HDNB 4J1TA 1YS7A 3EGEA 1H5QA 3MYYA 3KDPA 4AY4A 1DZ3A 3CZ5A 5ABPA 1BNCA 1H2BA 3R4VA 1OYWA 4JT8A 5J9FA 2CJXA 5HZHA 3BXZA 3QVJA 4Z9BA 1Q7TA 4ZTBA 2YW2A 3P20A 4G6ZA 3ONEA 3ZZMA 2LCFA 2X9LA 3GZJA 5A9GA 2XAUA 1I3OA 4BT6A 1VLQA 5C5DA 5LZ5A 1NVVR 4M36A 2NYVA 1FXVA 4X62B 4DCSA 4ZK7A 1W19A 2ZTLA 4PYKA 1DT9A 4MT8A 1LRJA 3GUCA 1KEEB 1GSOA 3FJYA 4JHLA 1VYVA 3K08A 3G0DA 2OCCC 4BQIA 1V47A 1GUYA 4LDPA 2WABA 4BNGA 4G0WA 4DILA 5KVSA 3WO1A 2AMFA 4NG5A 2V5VA 3D6JA 2PQ0A 3ZIDA 3ELCA 3SZ3A 5FH9A 2VPTA 4Y9TA 5C4IA 2WQ7A 1TJ5A 3T1CA 4QDXA 5KA6A 1TQ6A 1NHWA 3ZIAD 2MINA 4L4UA 4ONEA 4HUTA 4EZIA 1KA9H 4C6SA 2P1RA 3RHZA 4B6OA 1XMIA 4XOUA 3MCAA 4I1YA 4K2AA 4LOHA 2J0SA 2VR1A 1DWUA 3DQPA 2W0XA 4FGUA 3JPWA 2FE1A 1C2TA 4BV2A 2YHSA 1HR0B 4BT5A 3DLAA 3DW1X 2PKEA 4IQ4A 3RVPA 4G4JA 4BB5A 4BMOB 4M7PA 3RIGA 1PWXA 1GKUB 4CMGA 3BRQA 3L6RA 1OILA 4RSRA 5E1MA 3PDUA 5CNJA 5BRNA 2WDPA 4DBLC 3G5UA 4GOLD 4QDUA 4HQOA 3K06A 5GOTA 2P8JA 2PUFA 4I4CA 3QE2A 2WTAA 4I36A 4H3SA 1T3SA 4BO2A 1PNRA 3F7OA 1PDVA 3PX7A 4RDHA 3TK1A 3WLTA 4JYBA 1FQOA 2IYOA 2EAUA 3PX3A 1QHTA 3NIDB 4L9RA 3GLIE 4OHOA 3O3NB 2C7GA 3ZHBA 4Z3KA 4LY6A 4AJEA 2CJPA 5IT9N 2Z9CA 3R0IA 5C46F 4AKEA 1QF9A 2WWWA 2VSQA 5IYDO 2IV3A 4O8ZA 2H4HA 3NJRA 4FHDA 2DQYA 1OWOA 2ZUTA 4BVTA 2X8JA 2IKQA 5ALUA 2OK8A 4MS4A 1YJWF 5I5GA 2Y67A 3DAHA 1H1LB 3OF2A 4ZICA 1MX1A 5EHQA 2OKGA 4G9BA 5H70A 2E6KA 1Z22A 4MVJH 5AK4A 2QWRB 3K6JA 1VPVA 3MCQA 1UK8A 4KV9A 4L7VA 3PJGA 1I4TD 4H6PA 3CR7A 2MQEA 1FX1A 5DN6G 1Z6ZA 2AB0A 4BXOA 4UBJA 3AJAA 1IBMB 2C78A 5A71A 4F4UA 4EQZA 4GPBA 4PS1A 4EB6A 1UM9A 2Y1OA 2QRUA 4PLHA 1IN6A 3L4BC 1YB7A 4UAJA 2VF8A 4XWAA 1TYZA 2HSWA 4ZZ1A 2BR5A 2J30A 4YAEA 5LIPA 1P4GA 4JWTA 4Y2PA 3GGJA 3PXAA 2W6MA 3LCMA 4NQZA 1NOKA 4W1QA 3NVKE 2VEDA 4BQPA 2GJSA 3QF7A 1E4OA 2ZT9B 5I7AA 1U11A 4JJ7A 1BA2A 4NENA 4H18A 5GAJA 5KOIA 4X9XA 4GLOA 2XGOA 5L3EA 5CJJA 1A9QA 1N8SA 3ROFA 3W6NA 1FD9A 2X42A 4W6QA 2JK0A 4URVR 3L8DA 4DV1O 3ILSA 2XKAA 2G4VA 4JI1B 4G28B 1S72V 2UUAB 3ZJ5A 4DABA 1R0WA 4IQFA 3U7GA 2XQGA 2C4MA 2QRQA 4RDIA 3FB4A 1H3NA 2C20A 2FPMA 3MXTA 4XB6B 1XP8A 3G67A 4KHPB 3AP3A 2DH5A 4UULA 2HIMA 2BVNA 1Y7TA 1GA6A 2VK1A 1XCGB 1ND6A 2WT9A 3M6XA 5CXSA 4EG0A 2P91A 4CRWB 5AO9A 3A06A 5JE8A 1TD1A 1IZ3A 4XD7A 2AOVA 5KTTA 1DAPA 3DZIA 2P77A 1MO4A 1XZNA 4P9PA 4C21A 1TT5A 3KBBA 5A06A 1ZLXA 5TARA 2FKXA 1VHLA 2QRZA 5KNLA 4V02A 1B8OA 4LX8A 2GEUA 1FU8A 1VE3A 1EBUA 2FPPA 2QI9C 2V4DA 1CUJA 1DRWA 2QXUA 1V5IA 3BFJA 1AI7A 3QEKA 3EYAA 3V9PA 4DV4O 5CDUA 4XB1A 1VBKA 2JIRA 3MJCA 1AUQA 4MVYA 4W7IA 1BN7A 2Z83A 3H86A 2QD4A 1CZRA 1V11B 1S3SA 4DLSA 3S03A 1SH7A 4Y6OA 3BZBA 3CC4V 4JBNA 3BX1A 3HM2A 4EWLA 3F5FA 2V6IA 2R6HA 3LBNA 5KDLA 3GV0A 2PGLA 4J91A 2OXFA 2PMBA 3QU4A 5LNK1 4P84A 2BOBC 1MQAA 4KQHA 4W5NA 5LJIA 1ZSVA 2MSDB 4P34A 1B3QA 4TROA 1KGSA 4NY1A 2W2QA 5K3BA 2NVBA 3X2QB 3O90A 2KTUA 2C2AA 3WJ7A 2MR6A 4QC2A 1I2MA 2IZ0A 2IS4A 1RM0A 4HGZA 4YAFA 4EY5A 3KCYA 4Y2SA 1H4TA 3KHKA 4RPGA 1SQ5A 3BIWA 3SXUA 3WK8A 4M0PA 3VRHA 2B0CA 3UIEA 3I37X 2YZKA 2ST1A 2YIVX 5IN4A 5JALA 3SHVA 1WABA 4RL6A 4IVNA 5D5PA 3VU9A 1U1EA 1QRRA 1RPTA 2VPWA 2PMCA 4C7UA 2CUKA 2D2IA 5M34A 3ADPA 3K1AA 3ZXXA 1W1UA 5KCMA 3K9SA 2AWOA 3P9XA 5U4XA 2VP2A 1P9RA 2Q5ZA 1JQLB 4IEIA 3O65A 5JPDA 2G1PA 1Y82A 3C5VA 1SC1A 1JIIA 3PFBA 4XJXA 1E1DA 4UVAA 2BBOA 3SMVA 1KYXA 3OEEA 3Q1KA 4TWIA 3FZEA 3KJFA 3HO8A 4F46A 3GVMA 1PT6A 1JIVA 2FPLA 3K2BA 1XL0A 4C87A 2VDOB 4CQJA 1QTRA 2XVYA 4MYDA 3C9UA 1ADBA 3DXXA 2R8PA 4UAGA 1NX6A 3ZVNA 5MGNA 2ABWA 1QO0D 2QLTA 2XLCA 4JI8B 5C1OA 4LNAA 2YDXA 5CGZA 1D6JA 1SBCA 4GPEA 1H5NA 3QUWA 3M49A 5EIOA 1O94C 2ZAMA 4X93A 2D74A 3IULA 2WKRA 2ZE7A 5ITZA 4A8PA 4UB8Z 1OCCB 1TVKA 5F23A 1IV2A 1BHAA 1DC7A 4PTZA 2UUBB 4GC5A 3WHLA 4HAVA 2E85A 3U3OA 3WYGA 3T1OA 5LMNB 1LZLA 2GVNA 1ECFA 1OZAA 3DHWC 3H84A 3F6CA 3KFVA 4IH1A 1N6NA 2DR2A 4UVIA 4XUEA 4B3XA 2BM9A 3N4ZA 1XO1A 4N0QA 4W5OA 4EEXA 3GZNA 3D31A 4X1IA 4R2MA 3REFA 1XP5A 4WNCA 2PO5A 1YD7A 5BQFA 3MJSA 4CKEA 3EQ9A 4J2OA 1WPGA 3QF4A 4I4LA 4QXOA 3VZDA 2ZF8A 2YNMC 3O4IA 2RARA 2NTYC 3ZDQA 1A04A 1BTOA 3LGSA 2PF4E 2PNFA 3DLTA 3EXHC 2QPOA 1JPVA 1XYVA 3ESJA 1FVHA 4UVHA 4W5QA 1I3KA 1U81A 2H2IA 2NPFA 4B2YA 1M2GA 2MJLA 4N12A 2AGAA 1HDOA 1R9JA 4N7RA 1GMGA 1L5HA 2VDWB 1WBJB 4QVGA 2LCQA 4WCFB 4CI9A 5CW1A 2GRUA 4MUKA 3O2JA 2XADA 2LD4A 2GLUA 5ALSA 1ZL2A 5CA1F 4B3MB 3L18A 4E1VA 3G85A 4JEHA 4FOPA 2ZR3A 3UK6A 3H5NA 2ZXWB 4U2GA 1VQ9F 1ZH2A 1RXCA 2Y6UA 4HX5A 2V7BA 2C95A 2QSYA 4JB8A 1AS2A 3KKQA 3RUPA 1BWQA 1O8BA 4KJXA 1UODA 2O7QA 4P31A 1LK0A 1GJRA 2Y0EA 4G8JA 1QLJA 2R3SA 4UE6A 2P4VA 2Q3DA 1HI9A 2AQKA 3TIIA 1MH1A 4ZKEA 2QRJA 4LJ6A 3OTGA 1YJ8A 4QPPA 1ZJZA 4IL5A 4IUDS 4FLFA 4JUIA 4Z5XA 3RT7A 2IDMA 3TD3A 3FNEA 1C4OA 1Y7IA 1FVOA 1NY6A 3BMNB 1FNSA 3IXLA 2V3WA 4MRPA 3CPQA 2RKWA 5BV2P 2VSYA 1K92A 4RVDA 4LZJA 3ZEIA 1BMFA 4F93B 2OHHA 3CR8A 2WM9B 4Z9YA 1TMOA 4F5YA 2BI4A 1QQAA 3DAGA 2Q21A 1ZESA 3P0ZA 1F4MA 4HX2A 1OWMA 2ZRIA 1NTMH 1OLXB 5FCDA 3O73A 4KMOA 4YJKA 1XRJA 3KZKA 3NGLA 4MVJA 4WPGA 1A8UA 4PQYA 2WAXA 5IF9A 5CYPA 1DQNA 5KAMA 1J24A 2V5UA 1MNGA 2ECKA 5JWHA 5CFQA 1E6UA 1JP7A 2P3SA 3HL0A 4B44A 3CT4A 5DP2A 5BORA 1QOPB 1QGUA 3GGDA 4F71A 2WJIA 2AYZA 1I7SB 3AG6A 2YX1A 1VKNA 3PYMA 3O9VA 1PJ8A 4LVNA 1NW3A 4C9BA 3VC2A 3ED5A 4PZDA 4QGBA 2R9VA 2H1CA 1JSRA 3DP7A 1M73E 2XRYA 3C7TA 1EWYA 4RY0A 4OYHA 4P3PA 2NSJA 3N2EA 1FTGA 2P11A 4EW1A 1HT2E 1WBDA 4DMRA 4JTAB 3WYEA 3T7EA 5AUOB 4B74A 1JG1A 1ODLA 4AMYA 2QRPA 4IGEA 1Y63A 2ZVPX 3F5DA 4RD4A 2JLZA 3ZD6A 2D13A 5E0KB 2O0JA 4ZC8A 3ZHUA 2JLVA 4UFNA 3D02A 2HS0A 3DGFC 3GMSA 2EZTA 3JVHA 3SMQA 4OOFA 3HKDA 3ZIAA 1G16A 1SIWA 2OTLF 3AR3A 2KWIA 4B71A 1O4WA 2WLIA 1Z4LA 3GJ6A 3IX7A 1OBVA 2KSDA 1GFIA 2OM6A 4D4GA 1N2JA 1PRYA 2P9EA 2FFRA 3KQPA 3LQ4A 2ZLBA 3ERCA 1QU3A 4YLGA 1DZIA 1D2AA 3BGVA 5EXEA 3ZGOA 2FG6C 4HJXA 2V3CC 3LQYA 4BDTA 1WETA 1K7XB 1Y4DE 3F98A 5L4SA 2POCA 1V7PC 4C7OA 2YN0A 1II8B 3MWDA 3FPHA 1AUOA 1T5HX 3I92A 5GTIZ 5BN3A 3GPDG 2C2KA 2E5LB 4IG4A 4QRHA 1G63A 4MCIA 3PC8C 5BW8A 4DJDC 3LW7A 3I09A 2FZEA 4Y9UA 1QFMA 1XLVA 3IKJA 4I50B 2NZXA 3JTEA 1QFSA 5T4FA 2WF6A 1WVIA 3PXGA 4YRTA 4DW0A 2OZPA 1Z7BA 4J07A 2DOSA 4MDEA 2JK1A 3U10A 3FCXA 4OGQB 3F0EA 5IM4A 4DYVA 5E6SB 3S0HA 4BAGA 1W4AA 4LW8A 1QB7A 2OCGA 3HDGA 3W6PA 4G63A 4MW8A 3FDJA 3IBTA 3ZWNA 1GG8A 5G02A 4HQFA 4QTYA 1OIVA 1Y7HA 3HDJA 1N8NA 1MRSA 5T67A 3GZ4A 2CZCA 3VZQA 3AZOA 2I80A 4GQBA 1AKQA 3NHMA 2YWJA 2HPZA 1MAHA 3D8CA 2O2CA 5AHWA 3FSEA 2F1HA 3T7TA 3I5YA 1IXYA 1RXUA 3TQFA 2FC3A 1OCEA 4BRWA 3C6ZA 3M1XA 3CISA 4QDOA 3A36A 4BO7A 1KOFA 2ZYSA 2FEAA 3RWBA 1FLNA 1Q57A 2FKNA 2J6HA 1GM9A 3AK2A 3GJ5A 4AJ9A 1C4KA 1KS2A 3T6KA 2RHMA 4DANA 4B43A 1I3LA 4YQZA 3CG6A 4ZIBA 2GZ1A 3ZCCA 4BMXA 1W6RA 4O2AB 1YSCA 2BWJA 3NFRA 2DYRB 3MZ0A 1NMXA 1KI4A 4LF5B 1BDBA 3KYIB 1OLUB 4L4XA 2HWYA 4PA4A 1NJ2A 5K3AA 3ZE1B 4EW2A 2Y4NA 4NYKA 2A9FA 3KFXA 4G81A 2W0FC 1K7YA 1DBIA 2RQ6A 1DARA 2AHYA 3PHHA 2H52A 2Q9AA 3RYIA 5MN5A 1JMKC 1ZCBA 2Q1XA 4BP1A 1F06A 2JF0A 4TMFA 5C32A 1QFYA 4FLWA 4H08A 4EI2A 1FVXA 4CWAA 4QGPA 1I14A 2YHAA 1EDDA 2RHCA 1BROA 3NEAA 3KSMA 1ZJYA 2JGDB 1Y1SA 2FPSA 4EEQA 3AWDA 3NBMA 4INAA 3UN1A 1FCJA 3AI3A 4K6MA 4BIUA 2JH8A 2IQQA 1P2FA 4AP9A 1RAEA 3B3QA 3DTVB 5CT4A 1R66A 3GGOA 5FV7A 5I9LA 1I2BA 4M21A 1S01A 1U2SA 1AR4A 1QU9A 3SDBA 1DRVA 1H2EA 4LRTB 4A6DA 3SYLA 4E6PA 4BV9A 3ER8A 3T5BA 3DLBA 5CBGA 4WK2B 1L5ZA 3RWOA 4JI2B 4M6WB 1DRJA 1L8AA 4JJFA 3AVOA 4KLAA 2A1UB 2VQ3A 4CKYA 4DLYA 1XZMA 1SXIA 2GCNA 1QLEB 5E2AA 1QGYA 2PGOA 1NW5A 3F4LA 3Q4GA 4QVIA 1N9GB 3O1JC 4LOIA 3PQ2A 3N0WA 4DR4O 3ER9A 2Z1FA 4E03A 1QR6A 3BB1A 3U16A 5JYEA 2NAFA 2QTGA 4WMLA 2V7QG 3SR0A 4LOJA 4GMKA 3V1NA 2CNLA 3A1SA 1L5GB 3W4IA 2OC9A 4D2IA 4DCUA 3RVBA 3ECCA 1KYYA 1YA8A 2EWCA 4Q39A 5ALQA 4DIEA 1HNNA 4AN4A 3U1VA 3AZPA 5GJWC 3H19A 1X74A 4YUWA 5BSGA 4RE6A 2C82A 2WMOB 1P7VA 2ZE5A 5CVCA 1NXTA 4QT4A 4XWWA 1B8NA 1PF5A 1XBIA 3DXFA 2CWWA 2AD5A 3ETHA 3FF4A 2PX8A 1K73H 1QG4A 3HQ4O 3IHWA 5EJGA 1CQPA 1AF4A 4D74A 1PFQA 3OJXA 3P8ZA 3TXXA 1LTHR 3VOUA 3ZO8A 3WGYA 1GUDA 3CCVV 5JMTA 3R3VA 1PXWA 1PIWA 4IJVA 2XZOA 4JENA 3L1VA 2EGUA 1C14A 3TIFA 2V6JA 2J5KA 5T57A 1OCZB 2LBXA 2Y99A 2ZANA 2OV8A 3AEKB 4JI3O 4PA9A 1QCYA 4EB8A 1DRKA 4EJMA 4G25A 3PRJA 1BXKA 4WFAV 4FILA 3WGZA 3FLBA 1KJ8A 3U48A 3TSOA 4QFCA 4MAFA 2X1MA 3FCEA 4RQTA 3DDZX 1T2DA 2ZI5A 2HP8A 1ZOSA 3GLFE 3PC7A 1KKCA 2UYHA 2VCYA 4B7UA 4TTVA 1GL6A 4PCVA 3M1YA 3HM9A 4ILEA 1ESZA 2QAJA 4QWMA 4ADSG 4U1RA 5FOTA 1J2EA 2YINC 1IB0A 2DUUA 4EH1A 4DG9A 3LWBA 1OBOA 4AP5A 3U5TA 3UGJA 1QFXA 4GO1A 5TMBA 4WBXC 3CG0A 3GFQA 3B52X 1UAYA 1Z5OA 4II7A 3P0RA 3N86A 4WWHA 5L95A 5FEMA 5T6MA 2ECOA 4L6CA 3UMGA 3SYNA 4YJGA 3OJEA 2A58A 1FA9A 1DIAA 3T15A 2WZDA 3HVIA 4KQKA 2FMFA 2LO1A 5K3SA 2FN9A 5ARBA 4KWCA 1U0RA 3CSDA 5HWEA 4JTCB 2I1LA 1RI3A 1XQ8A 4AF6A 4HQLA 1XTRA 1XFAA 4W8HA 2DCMA 2XAAA 1W36D 4ZJPA 2VP3A 2HK8A 3H7AA 5FPPA 3DOIA 4EX6A 2M2IA 3IDAA 3DBIA 2QN2A 2DXIA 1KE2A 4B34A 2HRRA 1W4ZA 2QNBA 2EG9A 3P9IA 4X94A 3QMPA 1IM2A 1Y6XA 1D5NA 4A9AA 5TF4A 4U3JB 3K16A 2GAIA 3IAM6 2K7FA 5DNUA 4B4WA 3HP7A 2XXAB 2REBA 3R20A 1YKSA 3LUAA 3V7YA 3R7WA 2FB9A 4GSKA 2HHAA 3ROGA 2EDCA 4WJLA 2G04A 1GQYA 3BGSA 4AK9A 4JC8A 2W43A 1FIUA 3OKAA 4OXRA 5CBPA 2YRWA 2XCSB 2FP4A 2DPXA 5KC8A 5DM2A 1WMDA 1DDIA 1IU9A 1ZN2A 3M3DA 4FLTA 1CR1A 4PGMA 3AMVA 4Z8YA 4WY5A 4LX0A 3TQQA 4CLRB 2JFUA 2QU8A 1N2SA 1H93A 2QJFA 4Q4AB 4TT3A 2BBTA 5AXDA 1H4VB 1B0UA 4ZHQF 3LUBA 1SHLA 1XWWA 3VHXA 5FAKA 2Y76A 2F43B 3W5BA 3E83A 2VSFA 2IZ5A 4FGSA 1WOYA 4N40A 3M7IA 4Y9SA 5IT0A 2O9JA 1SVUA 1UXGA 3F46A 2VH2A 2VUHB 4HVTA 3W3ZB 1P61B 3W7UA 4UTRA 4NBUA 5CA0B 2PX3A 4F06A 1VG9B 5I4IA 2VK2A 5FNZA 5DNAA 3R5KA 2BKEA 3FPBA 1L6RA 3HI6A 4KLZA 3Q5DA 3R1IA 4H0FA 4MR9A 4J6FA 1CRQA 3QRWA 4ZMBA 5DV9A 2VA8A 2PZFA 1I8TA 2WYWA 1WUJS 1LQUA 3U3KA 3BA1A 3FRHA 1Z5PA 1TIKA 4OXYA 5JJKA 2IZ6A 1H7MA 4D8UA 1QQTA 2XTZA 3AOEC 4G26A 4KXNA 4ZYWA 1Z4OA 4MCHA 1GG2A 1IIRA 1IG3A 1GPAA 3B3FA 1ONNA 1XEFA 2YUIA 2PR2A 3KHNA 3U60B 2IXDA 4IWNA 4XYLA 3E3OA 4LUCA 2C9BA 1CR6A 5CB4F 2Q5JA 1YRBA 2DFVA 5KJ1A 4MARA 3H0KA 3AQ4A 1V5GA 2EFEB 1UP6A 1ZN8A 4UOEA 5JVDB 3PHGA 3NUZA 4LFBB 2CLKB 1XNQB 1ORQC 2Z5VA 1SPBS 3KEMA 3EGIA 1N4DA 5T8KC 3UO8B 1MSWD 3PRKE 4P36A 3C4VA 2GEFA 2XYPA 5TJ9A 3GYQA 1PSDA 3GFGA 1WA8A 1FS0G 3SSMA 3LPCA 5FP0A 1B93A 1QHSA 4B33A 1HE5A 2G1AA 1VQPV 2HW8A 1FFSA 2WU3A 1XTPA 1A97A 2IPOA 3T61A 5D6NA 1ZNXA 1XELA 3CCUF 4IEFB 1LV7A 3JAWA 2FW6A 1F2UA 5K9ZA 4KWHA 1T36A 4YXWD 1S9HA 2X5KO 4PC7A 4PZZA 4EHDA 3W2FA 3TTTA 4PHFA 5ICGA 2FVYA 5DNEA 5AM3A 4U4AA 3QO5A 3NXSA 2IAFA 4INJA 5JG7A 1IONA 2XDAA 1GGNA 1AP5A 4R51A 1ANKA 4OF4A 3FAVB 2QENA 2Z04A 4F3TA 3NH9A 4KVFA 3FVVA 2Q27A 4PICA 1UMDB 3FGZA 3RC8A 4PGHA 2YUTA 3O2SB 4DSAA 2B8TA 1H85A 3IPLA 3PRYA 1JR3E 2BEUB 3PNKA 2VNJA 1AN0A 4F4LA 4MVJM 1YITV 4MVRA 3DXYA 2TMKA 3H0EA 3VZCA 4UB6Z 2R9IA 4NYMQ 4Q3DA 4F6RB 1O87A 3NCTA 4GAEA 4FTWA 1DBVO 4A4DA 1L7RA 2OWOA 1Y4UA 2YRFA 4R1OA 2AX3A 5D85A 5K1PA 1NJIH 2VJMA 3QELB 2YWFA 3P9PA 3AM1A 2NUPB 3UQZA 3HSKA 4MIYA 1YEWA 3K96A 2WKSA 3DPUA 1YGYA 3AX6A 4J3JA 4CMEA 5GP1A 1T4GA 1XUQA 3VU1A 2WF8A 3PGVA 5E4JA 1ZZEA 4BN5A 3ZX6A 4H37A 1F8YA 2G40A 2YZ7A 2AHOA 2V45A 4NLLA 5GQSA 2IUFA 1GU0A 2IHYA 5DMHA 3WHKA 2O8VA 2I1WA 2NZYA 1GGHA 5CLLA 3OX4A 4RUKA 2Y1FA 3M3PA 5E1DA 5BZBA 3FBAA 3QIVA 4K8ZA 3FTEA 3VYUC 1SUSA 1P2TA 1T4BA 1GFSA 3LRXA 1HP8A 2VNKA 3I28A 4QJIA 2A9OA 3FWHA 5CX1B 1UPXA 5ALWA 3GH1A 1IPFA 4DMLA 2ZP1A 3ZE2B 4C0SA 3KLOA 2CLHB 5ALMA 5B57C 5REQB 4NQ3A 3W1EA 3LP8A 2LIPA 3WQRA 3TLMA 1SIUA 1MNQA 1Z6GA 1DUIA 2C29D 2ORED 2XNHA 2IZZA 4OH7A 3W5UA 4BP3A 3OZIA 1ESMA 5EN4A 2VSOA 4Y1FA 3NETA 4NBKA 2OZBA 3VPGA 3RVLA 1H9AA 4RA6B 4XD7D 2D5BA 2CYAA 4A7PA 2G0AA 1RU3A 3DTTA 4WDQA 2R8XA 1SGWA 4BRSA 1S96A 2G77B 3KSRA 4MTGA 4UCSA 3SQNA 2QRNA 3A10A 5I7HA 2X7HA 1Z2DA 3C8ZA 2BFBB 3P0EA 2JFZA 5DTQA 1M1YE 4IF6A 1NR1A 3WNQA 3A4TA 5BYAA 4K26A 1QCZA 2O05A 3WLEA 2CW5A 1UUFA 1P2GA 3E9RA 5BR1A 2JI7A 4GW3A 3BERA 1VIAA 3D3QA 4OSOA 3AUAA 3PFCA 1BS9A 2GUWA 4C76A 2R5NA 4TQAA 3WL5A 4ZOQI 3K2QA 4QICA 3FOFC 2GD0A 3KPVA 3CCRF 2P2CA 3WSWA 1Y6ZA 4KQJA 3CEIA 3ASNB 4L75A 5F21A 4JFAA 4UUJC 1JLRA 4FD3A 4AZ0B 1Q7RA 2AN4A 3HJRA 3L8FA 3R24A 4Y1GA 2RJZA 4PV1B 1MIOB 1YS9A 4P4TA 3AZQA 3FWNA 4IFEA 2J9RA 2JFQA 1O95C 3DFIA 5ES4B 1UAAA 3WK4A 3WB0A 4TS4A 2VDVE 4PPYA 3AG3B 4DQDA 1E7MA 1F8GA 3BA8A 2KTVA 2YXPX 1YTFD 4R8KA 3VO8A 3MJ4A 3UC9A 2A7XA 1PU2A 7ADHA 2Y05A 1DFGA 3ZU5A 5B6PA 4CUJA 1E1NA 3GNSA 1DF4A 1G5QA 4JBIA 4LNUB 3F90A 4R3UC 3RADC 4YQEA 4LFAB 3DGEC 2CK3A 1H1TA 3SJ7A 5F7JA 5ILOA 3JYPA 2C8LA 2QX7A 1VDZA 4OB6A 1COZA 2KM1A 2P9JA 1P44A 3R0QA 3OEED 4C03A 1P0QA 3DR3A 3M1IA 3KKLA 3CE6A 5DIFA 3R6LA 1H2YA 4IRMA 4NARA 3Q41A 4PPFA 3WKEA 3EEBA 4KMSA 1ZVQA 3B8NA 4JGGA 2PLFA 3ZV6A 3KEOA 4Q3LA 4UEKA 2FQ1A 1WDLA 1NU6A 7ABPA 1R73A 4QJ5A 5JHGB 2FCRA 5C8YA 4ZANA 4RMGA 5B2ZA 1QIHA 4P4SA 3L7OA 2DETA 3HBLA 3VR5D 1DCFA 1UMBA 1U9CA 4OJMX 1JE1A 3HJGA 4ZVKA 3ZXIA 1FP1D 4EI7A 3B85A 3COSA 2AR0A 1ZU5A 1TGOA 1QD9A 5CA3A 3WWPA 1DCTA 4Y2QA 4D5GA 3UHJA 3L4BA 3ZWYA 3KSZO 5FBRB 2ZBUA 5CLIA 2C1EA 2LDBA 1V6SA 4D45A 2ZIXA 4W4KA 1N6KA 4IUYA 4IQ8A 1W40A 1E4YA 2QV0A 3P5BA 1NI4A 5L40A 2ZYAA 1LV8A 5TS3A 2RC5A 4MLDA 4BKUA 4J1SA 5BSUA 4PN3A 1UMCA 4HEA1 4XLLA 4E12A 1SKMA 5F7OA 5JATA 3GVHA 4BU1A 3MWYW 5KSPA 5C18A 1KH3A 3NT4A 3SDSA 5E6RA 2YFYA 5DCYA 1URFA 2WA4A 1UZAA 5CAEA 1YVEI 4NK4A 4HN9A 1IY2A 2BZ1A 3V80A 1KC8H 4P92A 5HMMA 4V0LA 1IBLO 2Q1TA 3RD5A 2QLMA 3A0BZ 3R6DA 4Z7QB 1M6NA 2G67A 3ADKA 4HWKA 4C7KA 3TUJC 1KJNA 3WBKA 2BDUA 1VQ7V 4EFDA 3UA4A 4P1ZA 1XMXA 3VA7A 2XMZA 4FIPC 2ZBQA 4Z0HO 3KJGA 1M54A 1LRKA 3B2NA 4P81A 3CTMA 5HQ3A 3HGTA 1MEJA 1H9CA 6CHYA 4FJ2A 4R9VA 3GJ0A 1H2SB 2ZRLA 3SBDA 3UHOA 1ML4A 1UJNA 1QANA 5T3UA 1Y9AA 5BT8A 3EOAI 1DIHA 4CCYA 2J3IA 1NN5A 2IM9A 2EZPA 1Z56C 1Z63A 2QTCA 4OGGA 4YPOA 4WV3A 1KDOA 2CXXA 4BVAA 3JCMM 4TLBA 1XKQA 3NANA 5DB4A 1CUWA 3M83A 1WDKA 1OXVA 3LQRA 4TTQA 2H11A 4NBVA 1WEHA 4M1MA 1DTOA 2YC4C 1KVUA 1P3Y1 5DPMA 1SOWA 2O06A 2VPPA 3KJJA 1BMFD 4AJ1A 2BT4A 1HYEA 4PTYA 1BQ0A 4B1FA 3KTFA 5J2UB 4BIMA 3GLGA 2QI9F 4FM0A 3PPYA 2ZYIA 2I6RA 4KUGA 1JY8A 8GPBA 1SQPH 4KE7A 1L7PA 3L8ZA 1KDPA 2VP9A 2GF2A 3RAEC 2Q6LA 3OLWA 3ICPA 1ND5A 1KXZA 3WLSA 5LQSA 4GP6A 3CGWA 3RRYA 4ESVA 2OYQA 1UANA 4LCBA 1RBMA 2E0IA 2H5IA 3EUFA 3MUNA 5ADUS 4H7JA 1YDMA 2RAFA 1Q3EA 1KJQA 2H4WA 3H9VA 3QY9A 1I94O 5KDDA 1LD3A 5DM60 5B7QA 2DE0X 1E9VA 4M1ZA 3U9SA 4OQEA 1J97A 2PUGA 4HB0A 4PO8A 3EW7A 4KXUA 3KQWA 4QJ4A 4R4JA 1EX1A 4NVPA 4J0HA 3CRW1 3KT0A 2ECQA 3WY9A 3RGBA 2G7ZA 3VR5H 1V55C 2PSFA 4A92A 1AR1B 1ZD8A 2JNWA 3KHSA 3U7IA 3GF4A 3O4GA 4GE0A 1M0EA 2BDEA 4WBNF 1L8LA 3PDWA 4M37A 1KH1A 2AFRA 3B1VA 1ZNYA 2I4RA 3FSGA 5AW0A 1W73A 2L17A 2J33A 4PQEA 3RC1A 5LHGA 1NU1H 3EQZA 4JI6O 4JVNA 1N5DA 2GFQA 4ENPA 4J7JA 2CNNA 4Y6RA 1NVGA 1KFBB 1QJ4A 3RJMA 3IRUA 1KERA 4JL6A 3EBLA 2PY5A 4HDOB 3ND6A 3Q88A 4QBIA 4BNMA 3P19A 3WK5A 1ZCZA 1E3WB 4TL6A 4H15A 1NJGA 4E11A 4KPEC 4O3FA 1I4LD 2Q67A 4BZQA 4KPFC 4HXYA 4EHLA 5K8TA 1BS2A 2BZSA 4EHBA 3CPSA 1YL5A 1MP0A 3WXBA 5HMLA 4NI5A 1EFPA 5EGSA 2EZ8A 3D4IA 4D80A 1PL7A 4XQ0A 1SAYA 2GKSA 3KALA 3RT1A 2F8SA 3I9V1 3P52A 1WDTA 3H2GA 4XQCA 3EGOA 4YXWA 1YR2A 3OOYA 2C31A 3CX4A 3HBFA 1P7YA 3ZV7A 3ST7A 2GO1A 1CEEA 3GT4A 1XB2A 4EAAA 4NWIA 3RE1A 1YR8A 2PXHA 1CQIA 4LISA 5ED0A 1KSJA 4GLBA 4RANA 5IAEA 1KI3A 5EMMA 4BNIA 2G5GX 4EPWA 5LFAA 4IJMA 2WSYB 5CIQA 4LGYA 1P0CA 4I1SA 5FOVA 3EVAA 2YNMA 1OXMA 1KP2A 1IWOA 2RONA 1N2XA 2PH3A 3BSWA 2FEOA 3LXXA 4PGAA 3MHHC 3A6HA 3ETEA 4NYJQ 2XMPA 4DDTA 1KGDA 1GRVA 1GCIA 1L4GA 5C7YA 2QPAA 4OOEA 5HZGA 3QTTA 2OO5A 3EOBI 1CDZA 2YZNA 4D4LA 1UEXC 3CCJF 2CVOA 2HFJA 4JCCA 3U13A 3ZHCA 3CB2A 3U3MA 3BXFA 1NBWB 1RQ2A 3TEFA 2QQGA 4A0GA 2FEPA 2XUIA 1J99A 2BUAA 1E9EA 1Q6HA 1Q43A 9ATCA 2HLHA 4MZDA 1W88B 4LH6A 3P4YA 2PBRA 2PVPA 2KG7B 3FVTA 2PLNA 3GRCA 1E1CB 4E6EA 1L4KA 4V0ME 3TM5A 5EWMB 2G08A 1KIAA 2ACVA 4YRJA 4MQEB 1MJGA 4N3NA 4I0XA 1Z2GA 4FZJA 4D4IA 4YCSA 5TQ0B 1DAFA 3N8HA 4TKUB 4DNXA 4MV8A 1C9EA 5CFMA 3RV4A 2DYKA 2Y0CA 3OCXA 3OBWA 3WQQA 1NLUA 2GCEA 1RPNA 3U80A 2I67A 5A4JA 2AUTA 3KIPA 1I3CA 2BL4A 3A6DA 4PYOA 5KZMB 4JUBA 3I64A 5F3WB 5ERYA 3UJBA 1ODFA 3KELA 1TC2A 4ESOA 3W5JA 4BFCA 4P2ZA 4A1OA 5BN5B 2YV4A 1T35A 4E2WA 1H2WA 4MQ6A 3QJGA 1R0SA 3FPJA 4DC9A 1M90H 4WZAB 1CUSA 3ANNA 3EVTA 2JVJA 4RVUA 3OQHA 1QE3A 5HFMA 3RLFA 5FBHA 2IYTA 3ORFA 1E9SA 3TD6A 5H4GA 2PL9A 4RVOA 2BM8A 1N75A 1AO3A 3MBOA 5KTMA 4RF5A 2FJUA 4CCAA 1L7BA 4QE3A 2X0FA 3E70C 4UUBA 1NLZA 1DC8A 1SUFA 1AJQA 4LE1A 4M46A 3QXGA 4KWIA 3HCOA 4QXAA 2AFHB 4OQXA 1IM8A 2B9VA 4ZOLB 5HGJA 3G88A 2NNLD 4CIYA 1UKAA 4C4PA 1H0HA 1PGQA 5EHXA 1GGFA 2CNOA 1KZYC 2ZIGA 3CCCA 1Z35A 1KBQA 4H6WA 2CHQA 4ZV9A 4YJ2F 4L87A 3TTUA 3PUIA 3QE4A 1ATIA 3HPLC 4Y18A 3JVDA 3BEHA 3TTXA 2I3AA 3R9XB 3EXFB 1IK6A 3TLKA 2ASEA 4JIGA 2WU1A 1A1VA 2CVFA 5E79Z 2X2OA 3AG2B 1SQ0A 2NUBA 2PXAA 3GK3A 4LV5B 1CZUA 2YYAA 2Y1CA 1PJTA 4YT2A 3JAMA 4MEBA 5LXTF 5JCOC 3OMLA 4BMDA 4P08A 4DMMA 2GS9A 4G5XA 1U0JA 2PS0A 1KL7A 4FDUA 1IXZA 3AEQA 2BY4A 1B04A 3I1YA 3YASA 2AYXA 3HH8A 2HKOA 2AE2A 2ZI4A 3IBGA 1W76A 3CXCU 2GXSA 1D2DA 1K5HA 5ALFA 1CEZA 4ZC1A 1Z4KA 1PJSA 3RC9A 3PGLA 5HF9A 1TZBA 1P84F 4H3KB 3R0PA 1TRKA 3IAS1 4HNSA 2L0XA 3FBGA 2IEBA 5JQGB 5HY4A 2ISQA 2FLWA 2OBLA 2NN4A 1ZEMA 4YIKA 3PITA 3G89A 4EDHA 3ABTA 3BXXA 2JI8A 2A1IA 4P86A 5AI0A 1YWGO 4AROA 2JIMA 2PK3A 3MNFA 1RRVA 4UPEA 2QORA 3QWIA 1VE5A 1PG5A 4C7MA 4NYMR 4JAVA 3IEMA 4NNPA 1YJ9F 3OM8A 4X1KB 2EJWA 4OMFG 2ZOVA 2R8YA 5AQEA 1C50A 2DHQA 3H5RA 1V37A 1QPBA 2LQTA 3CWQA 1OBFO 2C5SA 4U0KA 1NBMG 3KKYA 4LF4B 1VM6A 3KKNA 5TS2A 3D8UA 4F96A 5JMPA 2AT1A 4CS3A 4RSMA 1AXEA 1BYIA 3CMEV 3FPSA 3IAAA 4CTOA 2ZSDA 2V03A 4PIVA 3EWSA 1JPUA 1LX7A 1WUHS 4CV1A 3OO0A 2D00A 2YVKA 1U28C 5KNDA 1E60A 3A37A 3O8QB 1GPLA 3PLRA 1U4OA 2Z6UA 3WQBA 3OOHA 2OQRA 2WYIA 5EAIA 4AJHA 4BNVA 1NQUA 2BMVA 1U2RA 4Z53A 1OAKA 2JARA 3L70H 3VR5A 5AOCA 2Y69C 1TO2E 2DECA 2RGBA 2ATVA 3O4HA 1AQIA 5HKBA 4KAJA 4M0LA 1NASA 2P5SA 4FFBA 4PLTA 2LP7A 3BY6A 2V7PA 1YE5A 3DHYA 1EFRD 1S1CA 1HURA 4FDVA 4EY8A 4KP4A 1WSDA 1THGA 1UQRA 3UJ3X 1PVOA 4X61A 1W8IA 5B3KA 2F9LA 1E9CA 3RU3A 3OY2A 2EKBA 1XA3A 4ABTA 4C2TA 2UXCB 3AFMA 1SZJG 3C3KA 2VT7A 3KC2A 4G2NA 4DJAA 4RCVA 2R6R1 3ZGXA 4D6XA 3TLJA 2Y3IA 2VWKA 5IBPA 2DHCA 4KYVA 3W2IA 4PLZA 4PC6A 3ZWQA 1L8OA 2E37A 3C8DA 4P80A 4CHTA 4TWAA 2SBTA 3I45A 1I3MA 3N8IA 3FHTA 5I8ZA 3AEZA 4NP6A 3VC1A 4CEIA 3DQZA 3QTBA 1C30B 2BCGY 2BSXA 4XBFA 3LYBA 1Q16A 3EMKA 5JEEA 1OAOA 2HCRA 3WLLA 1JFFB 5LOVB 4RTJA 1H9BA 2X5XA 2Q4EA 2W6CX 1UP4A 1DKUA 1KI9A 1H8EG 3PUXA 4MQ5A 5HW0A 3P3PA 4CXMA 4K6GA 2C03A 3BQMB 4YP1A 1I0HA 1NDQA 4H1HA 3ONNA 4TT3D 1Z5GA 2PV0A 2MK3A 2CDNA 3RFVA 5HP7A 3B9RA 2P9GA 1KPIA 4IIUA 3C3WA 1YHYA 2QN3A 4POAA 2B3TA 5E8RA 2E82A 2FMIA 2J85A 5HXZA 2W0MA 1V1JA 4DLKA 5D3MA 4IJWA 4XW2A 3QVKA 3EHBB 5P21A 4QBFA 2ACEA 3UZUA 2QLBA 1WXXA 3WG9A 1SCIA 4JI7B 1AD2A 3STUA 1EFKA 2IXTA 2PZSA 4BO4A 1E5QA 1U96A 1PW5A 1ZK1A 3I8XA 2ZOSA 4CM6A 3AEUB 3HS3A 3KEQA 1U4SA 1XZQA 4UCUA 3GAFA 2QR4A 3ZU3A 4Q7MB 5GONF 3DYVA 3HV2A 1LSSA 1GG5A 1X7YB 5LYJA 3C45A 4PNZA 3QOYA 1PK7A 3IMPA 5LWHA 4B0OA 1DOZA 2WSIA 3C6YA 2XAJA 2BIFA 3K5OA 4M1TA 1YF2A 4QO7A 3HU3A 4EG3A 5FPHA 2J32A 2WTXA 2X3UA 5EFOA 4EECA 1ICEA 1FJXA 1KYOF 3RREA 3KTDA 1JX9A 3P10A 3BPZA 4FYYA 2Q9CA 4M1KA 2X0JA 5IUJC 3VKHA 4NFYA 1E1LA 2Z6VA 1EEXB 3BMCB 4OQ4A 3QWBA 1ZTEA 3IDSA 3UAGA 1H2LA 4XIFA 5JW6A 2CSUA 1SEVA 3ROZA 3ZEAA 5K0JA 3NDRA 5GGYA 4PA6A 1DWPA 2QB5A 4TMYA 5CDFE 4X3CA 2AR9A 3U1BA 2OMKA 3QG5A 3DBVO 3RUEA 1TM5E 1XVTA 2FEXA 2HJDA 4DRXA 4JTDB 4N18A 2IHUA 2IU4A 1B6SA 1XLTA 5AVWA 3OD5A 1P80A 2LTAA 1PR4A 3Q4HB 1PHRA 1FF9A 2E18A 5LU9A 2FMUA 3C1UA 3E8GA 4EY4A 3ZKAA 3G2MA 4PLGA 3GP5A 3AQIA 1PQ4A 3BFVA 1YZLA 4KNVA 5A9SB 1P3JA 2BE9A 1XJCA 4FWBA 1O7JA 4XAQA 3VM6A 3JSXA 4M0KA 2R79A 1WXHA 4HQRA 4WLOA 3TX2A 4EITA 4WFEA 4EMUA 4Y98A 2PS3A 2BOVA 1EVYA 3R7LA 3AY6A 3K94A 4KDFA 2FSFA 1I6MA 4C6HA 4PG6A 2WVAA 5E9JA 2J6CA 4TSRA 2UYKA 2E76B 2ERYA 4NZPA 3GHHA 1HG0A 3VYSB 1ILEA 2JHGA 1UBOS 3RUFA 1G9SA 4O02B 1ZHHA 3AKDA 3P97A 1MSDA 1DNPA 3ZBHA 3BFRA 2EX1A 2ONCA 1T9CA 4MV3A 5AJXA 5KNCD 1ZU4A 4K6HA 4PDMA 3IVXA 3G9UA 1OCRB 3FNRA 1CC1S 2DPMA 3F3KA 2O8FA 2DQ0A 4HEQA 3KZXA 4WZBB 2GAJA 4RHYA 2WRZA 5TQVA 2H1VA 3VJLA 5EJEA 3KJQA 4JEIA 4TZTA 1SZTA 4YMUA 1BMTA 4G0YA 3VR4D 2WA1A 1WEKA 1G3UA 2PMPA 5GMOA 3LNMB 2J46A 4HF7A 4DUYB 3ZDBA 2YYZA 3L0BA 4EKDA 4RA9A 5EWJA 1E3EA 2ONYA 5JYBA 2DQSA 1Z8NA 1MX3A 3GVCA 4YRPA 5CEEA 4G1MB 4ZOAA 4EFLA 4YCNA 2VUSA 2QW0X 5IDYA 2BF7A 3GLQA 3CMAV 1C1DA 2EQ5A 3L6BA 1UT8A 1SQ6A 3CRAA 5DGDA 3BMQB 1HRKA 4YAIA 1KP3A 3GROA 3W7BA 4KN9S 1OH7A 1J2TA 3QEBZ 2IXEA 1PSZA 4KKXB 4GLLA 3I56V 2IUYA 2OUKA 3PXUA 4B08A 3ZX4A 4AKHA 2ZUDA 5KYXA 2WZBA 1KQPA 1PEAA 3H9GA 2IS2A 4XM2A 4FZRA 1AQNA 4LPSA 5JJLA 1DBSA 3M33A 5HUHA 2MR5A 3UFXB 4MKFA 5C7LO 3NOXA 1QXSA 4RXMA 1PQPA 3V4LA 1HE2A 5H6QA 1CP3A 2X58A 5IYBO 3DDOA 4KI0A 4KXXA 4P9OA 3KYCB 1HT3A 1QONA 3WLHA 4BVRA 3OICA 2PRIA 1VJ0A 2H8PC 2J41A 2EIJC 1NP7A 2SHKA 2UXNA 1SF9A 2JJ2D 4OX9O 4MRMB 4QT0A 4JLOA 4FD2A 4MHSA 4A15A 4JA2A 2IYAA 4TLDA 2YC2C 2IHKA 2GBGA 2XQKA 3WIOA 3PE3A 2WPDG 3C6QA 3EZ7A 3C7KA 3DL0A 5J4VA 2XGGA 3T7CA 2G36A 4HMPA 3SPHA 5EJ6A 4Z51A 3K70C 4NX2A 2QJ1A 4RU1A 3ZD9A 4GKAA 4ZMSA 1SXHA 1CG6A 4KFCA 3NIBA 3ENNA 3OEHA 1RBQA 5U4QA 1NLYA 3CKMA 1Q0TA 1ZDMA 5IX8A 3IURA 1GH6A 5K0ZA 3PEVA 1IY9A 3I1JA 2KE5A 3P9NA 1MJGM 1T0IA 3MYRA 4TRRA 1EUYA 4KEAA 2C00A 4H7DA 3KE1A 1OXSC 4OJKA 1LVGA 2OEPA 4DSNA 1FX0B 4GKJO 4JUDX 3H11A 4QATA 5EJ7A 2AFIE 4EFMA 1X3SA 3VSDA 2PIAA 4XSHA 4YHHO 3CZ4A 3H5OA 3H75A 1CPYA 4ZARA 4TV8F 3JR7A 3RWMB 1GO2A 1UC8A 4F9TA 3KSAC 4G4YA 2CK3D 3NUGA 5KNCH 4AW9A 4ZP1A 2MMCA 5J2TA 2ZRQA 3NAMA 5AESA 2FZWA 3ZCXA 1OJHA 4LEIA 3FG9A 5JH7A 1P91A 4QO8A 4BECA 1MMMA 1C3XA 2AX4A 3CLHA 4GQAA 5JEDA 2HP0B 4MSWC 4BB0A 3EC2A 2I4LA 4B3TB 3VR4H 1DFIA 1Z3CA 3M8KA 4EF4A 4JVLA 1UT6A 2HTFA 4LWSA 4KZPA 3K8ZA 4RL4A 4OBWA 1MB4A 1ZGBA 1ZUNB 1PS0A 1DOAA 4IXMA 4US0R 3A2FA 1IOVA 1EXNA 3RW9A 3TQTA 1DTSA 1ZN7A 4X20A 3NC0C 3FB8C 4LECA 5JO0A 3WL8A 4LVCA 4PSUA 3ZEDA 1UINA 3BRCA 3DR5A 4C20A 3NVKI 5AJZA 3WAJA 4ZQGA 4HZUA 4D6TH 3K9GA 3COPA 4MV6A 1Y5LA 3KZ1E 1TMKA 5IH7A 4BFYA 3IKTA 3DSRA 2F9ZC 1RQXA 1GQ2A 1R6TA 2GFHA 3SLKA 3IVRA 4UJ3A 3N2KA 1E59A 2ENWA 4G5YA 3LY9A 2D7DA 4DLWA 2JD2A 3TXAA 1JQ3A 5DO9A 2WYHA 2F1JA 3SGLA 2X86A 2I91A 3AI7A 4JASB 4YPVA 3PVSA 1BCSA 4FX5A 4MW2A 2JD0A 5K4AA 2QUAA 2IPMA 1JU3A 2B92A 2GWHA 2ZI7A 4QOIA 4FEGA 3ASYA 4DNPA 1NYTA 4EBBA 3AYZB 1JT2A 4MDHA 3O31A 1YV9A 3JAMM 4IV8A 1BFDA 4V0NA 4V39A 2XCLA 1E32A 1GL7A 3SKVA 3REQA 5B1HA 2HHHO 1X7WB 3HYTA 1N32O 3WIBA 5KYWB 1SVLA 3U4IA 3IESA 4G67A 5B37A 3RF6A 1FOEB 1DO2A 3BZWA 3CRQA 6NULA 1M83A 4MI6A 5TF0A 1H6AA 1JHMA 2JGNA 1SG0A 4OVKA 3ND9A 4FZVA 2NU6B 3RQIA 2FWIA 1FNDA 3C8HA 2AG0A 3ROXA 4GX2A 3LC2O 1W85A 3G59A 3UENA 4AHCA 3R66A 1NQ5A 3VBCA 4DV7O 5CFPA 4RKYA 1TUIA 4YVFA 1LX6A 4QUHA 4N7JA 2NSYA 2BI8A 1HDIA 3BTVA 4GZMA 4OTZA 3WHPA 2XBUA 1NPYA 4C7BA 3RROA 3UT5A 5K3EA 5IYZF 2ZBGA 2QI2A 4QD3A 1NQOA 2TSYB 5CITA 5EXXA 2XWQA 1EFRA 1DTWA 2OHXA 3NEJA 1CW2B 4BNWA 3EIHA 1QHNA 2YWHA 3BXEA 1LUAA 4EHFA 2H0RA 4M89A 3ZMZA 4HRXA 3ZMVA 4EFEA 5ALDA 1KO7A 1XDGA 5GTHZ 1TFRA 2OGTA 4EPXA 2MSKA 2L42A 3TGLA 4JH0A 1GGJA 2Y27A 2IUSA 2C07A 1KMNA 4LKRA 1AKUA 1EK5A 4OKNA 2FUG1 3ZJ4A 3RDPA 2VTBB 4G56A 1M66A 3KU1A 4RH3A 3HP1A 5JNVA 1TA8A 2HRQA 2JH9A 4GH5A 4MITA 4WXEA 3RFCA 4PLVA 4PHZA 2VQEB 1KQSF 3TE6A 3SJCC 1VH8A 1I3NA 1A88A 1DG3A 2DLCX 3D0QA 4RS3A 1ZEJA 3SEQA 5DYIA 3A28A 1Q86W 3PLNA 4L5JA 2ZM6O 2FZGA 1N6OA 2BFFB 3QUTA 3CCSF 2O2EA 4BKRA 1Y3DE 4ZGGA 1N2IA 3V1TC 5MDHA 1TYAE 4ND6A 4ECAA 2HWXA 2O23A 2PKQP 3V33A 2BJHA 2Z4SA 3SHQA 4MS3B 1ZW6A 4F38A 3D4BA 3ZGLA 4HCJA 4EB0A 1DAEA 2W2NA 4XSVA 4RVHA 5CFLA 1RS0A 4YMLA 4NR1A 4WFBV 1PV4A 4XI9A 3JARA 3DGEA 4TVKA 2HP3A 1TJYA 2FPGB 2NO0A 1JEDA 4E08A 4DW8A 1XNGA 2NQ2C 2JIZD 4G0OA 4HRYA 4RV4A 3FRIA 2W4MA 4F2PA 2Y1DA 4OEHA 5IWAB 2QNIA 2O50A 1BJTA 2XB6A 4ED9A 4IFBA 3IXQA 3KR1A 1G5RA 2YV3A 2IYWA 3SLRA 1EFTA 4CV3A 5DNVA 3FSGD 5B1BB 1JV2B 1KXJA 4KFUA 5IAGA 1AQYA 2OCHA 1UI9A 3HFRA 4RKQA 4DCVA 1H2HA 5M2QA 5BQ5A 2D2CB 2ITDC 5LIRA 3RAFC 4QM7A 2J0UA 3R6TA 4P58A 3OQMA 4CBVA 1XL1A 1O94D 2YHBA 2N04A 5TMPA 5BYBA 2GN0A 1RWXA 3Q8KA 2LR0A 3P9YA 3N53A 4H4DA 3SX0A 2J8ZA 1IB6A 1OX4A 3FR8A 4DNQA 5DGXA 4ZJZA 2ATCA 4RZHA 2QJWA 5IP5A 3CZ9A 3CFYA 6LDHA 4TTRA 3L8HA 4MR7A 2P3LA 4DQUA 5AHRA 4RHAA 8LDHA 1TTHA 4V03A 4ZYXA 1CY2A 3KQTA 3PC6A 3VMFB 1H69A 2K6GA 3AGKA 1PZHA 1ESNA 1KZ6A 3R0XA 1OBHA 2YQ4A 4JC4A 2IHNA 1EBFA 1R4NA 3M0EA 3NVIB 3BCCH 5IBCA 4D4MA 1VPWA 1KEVA 3U6BA 4PE5B 2YMMA 4ZCMA 2WWHA 1P8AA 2FMXA 1RM1B 1HTBA 4D9NA 4CUZA 4EF5A 2V4MA 1XROA 4XGKA 4S0XA 2XX3A 2E87A 5BYKA 1H2MA 4RE5A 2YNMD 4XVRA 5L3SA 1G5HA 2Q4RA 1SVIA 2W4QA 4G9EA 3HWX1 3AG4C 1T0UA 3QTYA 2OECA 3LWVC 3ZD8A 2A5DA 3JYCA 3TJZA 3UO2A 5AP9A 2G4CA 3BGDA 1YCFA 4GSLA 4MP8A 2CEKA 4C0HA 3GL9A 1GT91 3VPSA 4QLBA 2Q1SA 3G13A 3RTEA 3WYFA 2Z5GA 2VGMA 3HJCA 5FQOA 2HCTA 2IBZH 2GOYA 3IUBA 2QQFA 5AI8A 2ZTVA 5AOAA 4J3FA 2J3MA 1P81A 2VYCA 1II9A 3PL1A 5BWBA 2QX8A 2JBWA 1R1BA 1BAPA 1XTZA 4MVJG 1HYGA 1ZGGA 1DJQA 5I48A 3ZHTA 2ZSEA 5FI3A 1CXZA 4X44A 3GQBB 4TKZA 1SCUB 2ZVDA 5KNCA 4DO2A 2V6GA 3ROEA 1K68A 2HRUA 1J0CA 5LMUO 3SS9X 3LLUA 4K0KB 1HMYA 2RHDA 2DKFA 4LYAA 1VJRA 1X1AA 1OAAA 4CT5A 1TZJA 2Q1WA 3FF1A 4OQNA 1EE1A 4BKOA 3TOXA 2VDRB 5JDIC 1KAHA 2HZ7A 3GFSA 3VR4A 5DI3B 3RFRA 4NCNA 3LC7O 1GN6A 4G37A 1CSEE 1Q82H 4CM5A 1KYIA 5KMGA 1A27A 4WINA 3DDUA 4C82A 4HNVA 3QPCA 4TQ9A 2CMKA 2EKQA 1NMQA 1Y74A 3KIZA 4B3SB 3TOSA 1G1AA 4PR0A 1NHGA 1JE0A 4PZUA 2OV4A 1ZWKA 4AG6A 4TYYA 1RMQA 1I2AA 3WRVA 3W8NA 1IPAA 1VXRA 1AXGA 1YC2A 3E8MA 3SQMA 2KSQA 4EZBA 4XIJA 3EPKA 3LNNA 5BWCA 4ZU1X 3F9IA 2OOKA 4NULA 3GEGA 1LNSA 4FGWA 5EXTA 3CNNA 5DHFA 1KZ1A 3ZIAG 3UK7A 2QK4A 5KOYA 1JLMA 4QM6A 4MKGA 3L7DA 5IBQA 2E3JA 1N5JA 3KZNA 1X4TA 1HDYA 2FPIA 3L8MA 1V16A 1N8RW 4KO2S 4DR2O 4DEYA 1N7HA 4ZOCA 3AVTA 5FWYB 2A78A 2WJ6A 3FD5A 2OV6A 4ZQHA 5JC8A 2QTBA 4G0NA 4MWOA 4HVLA 2V7WA 3UAWA 4GOOD 2QTTA 3W8EA 2W58A 4IZIA 1TVCA 4XGNA 2ACWA 3KVYA 4QNRA 3NHJA 4MA0A 2QRKA 1WQ1R 2QRHA 1VE9A 5LGNA 1YDXA 1KEKA 1M56C 4E2FA 2WA2A 4KGDA 3ZUPA 2O8BA 1ORVA 3LP5A 3QVWA 2JJ2A 2BSKA 3FUXA 4UM7A 1TA0A 2DP4E 1PUXA 4JT2A 3ZDFA 5F3DA 3T12A 3T5GA 2DERA 3KNZA 1OLSA 3MT7A 2WUDA 4QKQA 4OP1A 3UNXA 4ARIA 3PQ7A 5EJAA 3ZDEA 2H08A 1D4AA 4R2HA 1Z26A 5AJTA 5JADA 2I71A 4LDRA 3D6MA 3C15C 1TEZA 3CNHA 3BMOA 3VX4A 5ALRA 1PP4A 1TK3A 4MLPA 1UZMA 4RH1A 4N54A 1UCFA 5A62A 5ARDA 1QC5A 2CVZA 2ZEJA 3QWAA 5AKEA 4P4NA 3TD5A 3E8HA 3TAUA 4DJTA 1BWSA 2R44A 1MABG 4QBGB 4NTYA 1EZZA 2GLZA 3ZHOA 1JLLA 5IG2A 3R5XA 5I9MA 5DRYA 1DXOA 5EVJA 5TGZA 4Y2TA 3D1JA 1KC1A 3NHZA 3V4PB 3NBUA 5J1TB 1TF2A 3HHPA 3LYLA 2ZVJA 4HRVA 121PA 3N8KA 3G4SV 1CIVA 1PI3A 2EIXA 2CV1A 4F92B 2XITA 4LH7A 5TDHA 5DU2A 3G2NA 1K9MW 1YZGA 2H9YA 1NRIA 2GEKA 5EUBA 3NI2A 1PGNA 3BIOA 4I4TA 2REOA 4UJ5A 3LG2A 4FHCA 4BT3A 2XVMA 2HBQA 3TTVA 1X80B 1FP4B 4E5PA 3VZPA 1GT6A 3CCLF 1JJBA 1PLLA 3O74A 2NT4A 2PSDA 2D0OB 5FNVB 3H9JA 1ZM3A 2Q0XA 3D3WA 3DLHA 5KNDD 2J6IA 1A8QA 4R68A 2DF8A 2QTMA 1XU7A 1COWG 4KQIA 3RT9A 2EINC 1SCDA 4MXDA 3GFTA 5IAAA 1ZCJA 4JV5B 4ICIA 4FGLA 3WGHA 3U44A 1E9AA 1M7GA 4WNAB 1M6YA 4ZO6A 3NTVA 3MTJA 5IEJA 5GZ6A 2ZUEA 1M5TA 2EL9A 2D2EA 4QXMA 1LBSA 3EAFA 2NSLA 2X6QA 1K6MA 4NVRA 4QGAA 1K6JA 4OHRA 2C2MA 3M9XA 3U4HA 3TQRA 3G23A 3IMGA 4Q9NA 4XDJA 4KXQA 1JXMA 1P1CA 4I1VA 2UXDB 3DZHA 3C9RA 3GPCA 5G40A 4FYPA 1IXSB 2FFQA 2WJGA 4OXNA 2J3HA 1HZZC 4DCCA 3E9ZA 4DEVA 3H05A 3TNLA 1DIGA 3RG2A 1MPXA 3TAXA 1WCIA 3TI9A 4CMHA 3CF2A 3ZV5A 1FS6A 2V4UA 1OUMA 4R0NA 2EX4A 3JD0A 2WQZA 4Z0TA 4A0QA 1YUMA 2GK4A 3DZFA 4ZV4A 2OFXA 3EXIA 1U0BB 5GADl 3SZRA 4G4XA 1B74A 3HKCB 1YIDA 5DOZA 3BORA 4GXRA 3AP1A 1A1SA 2DBRA 4OREX 4Y1RA 1AKNA 1VZ2A 1GIAA 5JSHA 3BL8A 5JCJA 4QQ8A 3LUTB 1RI1A 4LF7O 4PAWA 4WN9B 3HP4A 1W93A 2C4WA 1TUEA 1UM8A 1SOVA 3CCEV 4PBSA 3DZGA 5E2IA 2W4IA 5HOEA 4FW8A 3LSYA 1JNYA 2XE7A 3L4JA 2A5LA 2VH5R 2WD8A 3NV7A 4PDVA 4YBRA 2Z2ZA 4OXKA 4L95C 3FNBA 1M5UA 3GLSA 3G2OA 2O8EB 3H4MA 3MS2A 2E5FA 5D86A 1Z5ZA 2YXYA 4ESHA 4H33A 1XEXB 5LJLA 5B1AB 2AG8A 3OW2F 1ZVKA 2ZJ4A 2HMSA 4OUDB 3I12A 2X7JA 2IZ1A 2YWEA 2I22A 4MKIA 3C3YA 5DTEA 4IIFA 3IT2A 1E5XA 2F64A 3A3NA 3ONWA 1QHIA 3U7FB 1VL6A 3PU6A 1C1XB 1B6RA 4OXSA 3KT3A 1QGZA 1VL8A 5B3SB 3ZXUB 1T6YA 1X70A 3O1IC 1TZMA 4NK5A 2ZU6A 3KEGA 3A0RB 1L0LH 2G5PA 3RC3A 1Q95A 4HWPA 1NRXA 3Q6MA 5JNTA 3VUFA 2UUCB 5GVRA 2D1TA 1Y42X 1J9GA 5G4VC 3N70A 2IYNA 1MDFA 4DR1O 4YV0A 1S4QA 2C96A 3W9BA 5IHXA 1QNFA 2GRAA 3L7CA 5JASA 4JUFA 1M8JA 1MB0A 3GJ4A 2X0DA 1LF0A 3E4DA 4MVWA 1APBA 5FTLA 4BUJA 3AG1B 3FCAA 2CLCX 4N3CA 2QUKA 1YB4A 2VAXA 9ABPA 5HKOA 4A91A 4A27A 1K1EA 4PN7A 4FZ1A 5D7BA 2VHCA 4TS9A 3THXA 1KU0A 1HDGO 5KNDH 2HPVA 3QU7A 4XDHA 3AERB 4RZ3A 4YAWA 2CMFA 5CEFA 4L2IA 1NVMB 1KZHA 1S2OA 1FYJA 3T5TA 1A7UA 2PUAA 4WBNA 5CBKA 4BQOA 3VH1A 1KEZA 2WIGA 4UCWA 4L02A 1YCGA 3BWBA 1V8ZA 4NXNO 2OMEA 1R6UA 1AZTA 1NJ1A 1FJHA 2JIZA 1NXOA 4TLLB 2HJRA 1CV2A 3E9MA 4J9YB 5AW9A 5BOVA 4X1YB 3OZGA 2UYJA 1CJTC 3RVQA 1XVIA 3GY0A 4N82A 1UJBA 1VI6A 5IEBA 3K9HA 2P3OA 1RLIA 2FGYA 2J3JA 3LS2A 4DXWA 2O5CA 1HQCA 4AO6A 3A1NA 5YASA 1YR9A 3HUFA 3OTOB 4J16C 3T80A 3LOQA 1Z36A 4L8VA 4QYTA 2WM3A 3PENA 3AR6A 5KVQA 1O94A 1ZAKA 5IUNC 2OZKA 1U3CA 4YJDA 1UOPA 2HWKA 2I6SA 1GCUA 3EZXA 1J5EB 3OHSX 3OWHA 2Q5IA 4GZRB 2EBOA 4RAIA 4M0UA 2DUWA 4M0MA 2QR5A 3K1TA 4HGPA 2NYAA 3UJHA 1XNHA 3OCJA 1CUBA 1XX6A 1X0VA 4MRNA 3IGAC 5ENVA 2YASA 3MCVA 1JHPA 2WFAA 1R8JA 4Q4JA 3CV3A 3JALA 3IC5A 1TAQA 1XI1A 1G8JA 3ROMA 5FPSA 4UEOA 4JELA 3ZWPA 1D09A 1S5PA 3QFRA 2JHAA 3HYLA 1S3JA 1XRLA 2OXRA 4E3WA 4A0SA 2EF1A 3L74H 1U9JA 2OPHA 1JXOA 1FDTA 1T5TA 2Q1YA 3RABA 4IVQA 3NTQA 3X1JA 1IEXA 1V7ZA 2FN3A 1V2GA 3G71F 4NDZA 3D5EA 4ZHWA 3OM1A 4JROA 2Q46A 2EERA 1FXKB 3AB3A 2AF4C 3EXHA 2O2XA 4M7WA 1NKDA 3AESA 3KQHA 4BASA 1JHRA 4YC7A 3M2TA 2FL4A 5IY5B 1DK1A 2W90A 2C2YA 1AGYA 2PAAA 3FPKA 1X7ZB 3SC2A 5CD9A 1E62A 3E23A 3UA3A 4EI9A 1NV9A 3DL2A 1M3SA 3GWKC 4HVAA 2I33A 3MBIA 3QWHA 1YMVA 1PZNA 4EK9A 3E22B 1ZIPA 5G2OA 2IEAA 2ZAIA 3SIUA 4ENQA 4CMAA 5TE9A 5GZ1A 1C4WA 3CZQA 4GF5A 3WSTA 4FEEA 1GTSA 4U8GA 2VRWA 3ZRWA 4BVEA 4NJMB 4DLXA 1LSOA 1JEEA 3B1JA 4LC0A 1WW8A 4GUAA 1F2TA 1TTPB 1ZXBA 1BCCH 4X95A 3ICQB 4RSGA 4ND8A 2FMHA 4L28A 4EUKA 4PO3X 3WLIA 5DDIP 4RQAA 1KMCA 4MINA 4ARAA 4DNFA 2JI6A 3P2JA 1TA4A 2H1RA 2FVXA 2VBGA 4QPKA 2GXUA 2PUWA 4LFCB 3WB2A 2EX3A 2HHJA 1Q22A 4HS4A 3CEMA 1NURA 2Q8VA 2LRHA 3V1LA 1DSSG 3ABIA 4L8LA 4QE9A 2IH3C 3NATA 2Q3EA 1UFYA 1RCTE 3IYLW 1H4QA 3NTUA 4B85A 4JI4O 4ZRDA 4AWAA 2C7QA 1M1NB 2CLDX 1DPGA 1YDGA 1S7CA 3INNA 1WY5A 4L9AA 5FWXB 1C41A 2ZZMA 1UL1X 4L5BA 5AVKA 4K1LA 3TQHA 3ESXA 3BH6A 1RHUA 5JRZA 2B4QA 1BD3A 4J1QA 4J7XA 1Z6PA 3NC1C 4DLBA 1TK2A 3VZRA 821PA 2X7XA 4NXMO 3IVAA 4ZPXA 5BYJA 2R1TB 1RWQA 1XXHE 3OX1A 3ZCPA 4BGVA 3OEHD 4ZRMA 1VG8A 1P1KA 3F9RA 4FSHA 3IQFA 3L6UA 1SQXH 2Q7HA 1OI2A 4P4UA 2OFWA 4HS9A 3QW4B 1HNWB 2L26A 1NUPA 4Q03A 4TRMA 4F1KA 1PL6A 5LXTA 2WT4A 3KAQA 1UFVA 3EULA 1NDUA 3BJEA 3FOEC 2JVKA 1NJ5A 2PX2A 1KU9A 4KR7A 2C8VA 2DRIA 4QECA 3PCTA 3IMEA 4MTFA 5LVAA 2NZ8A 3IQHX 2CXOA 4GM1A 2H1LA 4UCXA 1KZ7B 3CSXA 2I03A 2UYQA 2R5WA 1N4AA 4M98A 5AVYA 3NTOA 3GGSA 2FE4A 1GNVA 4IYHA 1ZMBA 4OL9A 3UMYA 3WMFA 3A3PA 3H7IA 5BSTA 1TJPB 4E5VA 5L3DA 4B17A 3OPYI 1Z4PX 4KVZA 1Q83A 3CVXA 5AKZA 1NMYA 3LKVA 4GPAA 3DKIA 1JAZA 3F5WC 4GZ6A 3IT0A 2AJDA 1G21E 4XPIB 4EIWA 1ITZA 4AYXA 1PYDA 5F9FA 3HYSA 4P3OA 3ZOPA 1NKSA 4JOBA 3GOQA 4GX1A 1IHOA 4WACA 4YP0A 2O2SA 3X44A 1IPHA 1PBNA 2POQX 4OAOA 4O4IF 2RGGA 3TX6A 2HV8A 1WR8A 4J8PA 3D0RA 4G01B 5K0CA 2W2VA 3CINA 2JCSA 1SUWA 3O94A 2HVJC 1W7AA 1DEKA 4J0JA 3PFHA 4D25A 3PC8A 1Y8RB 2YVUA 3LP6A 1N0UA 1G8GA 4GBJA 3LWNA 3HLKA 2ZB2A 4EMTA 1B0AA 1Q81W 2ZIMA 1Q0QA 5JZSA 2VQSA 2IL1A 5FYQA 4HAXA 4W5WA 2Y8EA 1XV2A 2N47A 1G4YB 1TZKA 1XZJA 4D8XA 3KUUA 5A2QN 4AQDA 2EFHB 2ZATA 1TQ2A 4FUQA 4GYWA 4YCJA 3VQXA 2XH8A 4G0PA 1QZXA 4CR7A 1E0AA 3AUUA 1JNXX 4HV4A 2TYSB 2CD9A 1MF7A 3TVYA 2HIHA 3R3ZA 5LR6A 1JH9A 2WHXA 4LDAA 1D03A 4AURA 1SR8A 4HGRA 4DR6B 1N4CA 3U1TA 2RCVA 1K08A 3K0HA 2QTVA 3MUEA 2O7SA 3HDHA 3L04A 5IARA 2QTAA 1UJ2A 3ESBA 4PQRA 2WIFA 3CS5A 3UUEA 1U3VA 2VEOA 2I99A 1OCOB 4M4SA 2OXTA 4AJJA 1E89A 3LPAA 4KK3A 3FTNA 2HMYB 5DYTA 4PHCA 3WNVA 3CUWA 3C43A 2IP4A 5NLLA 5HM6A 3D00A 3CTPA 3WWOA 1FYWA 1GA4A 3O8RA 1ADJA 1RABA 5IKMA 1WMFA 1JDVA 3SOPA 2QMOA 1TOAA 3JR3A 3BH0A 2AI1A 4L0MA 2LCIA 3KDSE 4O4LB 3S2EA 5EE9A 2ZBVA 2VHEA 2X9NA 1VQMF 1DXHA 2DY1A 4J7KA 3FB1A 4K3VA 2D2VA 4KX3A 3I0NA 2X23A 2C2HA 4UREA 5CA1A 5JAOA 3DC5A 1OXTA 2NACA 1K06A 4E88A 3K3WA 3RV3A 1SY7A 4H3HB 1N6IA 1DEOA 5A5FA 4WKOA 3WYBA 3AGPA 2XHBA 5FV4A 2JLUA 3FWZA 3SPXA 5AM4A 4X8AA 2CHEA 3E9CA 5EC1C 2IYEA 2ZSHA 2AR7A 2HQOA 3DBLA 2HUNA 3FDZA 2AMLA 4YMHA 1VL0A 4DV3B 3D2BA 5JS6A 3DOUA 1B14A 5JJEB 3R3XA 1LA2A 3GX1A 2NXCA 4KIWA 1FNJA 2PSJA 5IN5A 1BMQA 5DT2A 2JIPA 1UAGA 2JEZA 1VQ9V 2AH5A 5AXCA 1O95D 5IJWA 3KJKA 3OOJA 4RORA 1K5DA 1JAYA 5KUMA 2OC4A 2RFLA 5F7ZA 3JVUA 4LF8B 1Q0SA 3GA0A 3GFFA 3B20A 4JDUA 3PJEA 4I19A 4LJRA 2BCCH 4XJTA 4K9KA 2PKRA 1X1CA 3D7NA 1TM2A 2O8DA 1UZLA 3ECAA 1D1PA 3DWEX 4TL7A 1C81A 1ICIA 1EG7A 4C4SA 1DG9A 2CSLA 3K92A 4J0IA 3BT7A 2ADQB 3N27A 1BVYF 3P9KA 2YDEA 4YJFA 3QPVA 3L6EA 1KYZA 3B89A 4CT4B 2R65A 3PUJA 2VAWA 3W04A 2HF9A 4GHWA 1WU8A 1XAHA 4DM7A 2X15A 1WW2A 4LCJA 3IH5A 4Q34A 1ZITA 1PJQA 5EJIA 3ZQJA 1XA0A 5K8UA 5E4TA 1J2YA 4IJKA 3VZBA 4OPMA 3UWKA 4DDUA 3IV9A 4OXIA 2O5VA 4KXMA 1CQXA 2CC2A 3N2GB 4M38A 1IM5A 1FFCA 3RSCA 4KQCA 3QY0A 3GUYA 3MD0A 1ZJJA 4D57A 3BDIA 3PNQA 2XRMA 4M60A 4MWTA 3VHLB 5KJEA 3C9SA 2SKCA 3KQLA 3C0KA 4CKWA 5H5NA 4RQFA 2JG3A 3IMCA 4YFVA 3ON1A 5KTNA 4P3YA 5KU1A 2QE7D 3ZDAA 1TCUA 4ARZB 4KNWA 3Q3GE 4MYRA 1L5OA 3H5AA 3QEJA 3QTLA 1PGOA 3VTZA 1ISMA 1SC9A 1W57A 5A6VA 4UHFA 3L8CA 4OYYA 2D1SA 2PD4A 4WFIA 2YICA 4FQ5A 4WW0A 3LY8A 3IBFA 4S1OA 2DFTA 4ZU3A 3DFMA 4CU5A 3ZZ0A 1D9XA 1NF2A 4KK4A 1P62B 2QWXA 1V6CA 4AECA 2ZFUA 3PJFA 3FPCA 3RIMA 1QLNA 2OXCA 3OBIA 4KACA 1ECJA 3NVMB 5CK4A 3OZTA 3SJBC 4OBXA 2IZ7A 2OTLV 2QP9X 4JMPA 1KKMA