1U40A

Ispf with 4-diphosphocytidyl-2c-methyl-d-erythritol
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase Involved in Mevalonate Independent Biosynthesis of Isoprenoids
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1u40A00
2UZHA 3FBAA 1H47A 3F6MA 5B8FA 1GX1A 1U43A 3K14A 3F0FA 1IV2A 2PMPA 3F0EA 3GHZA 1W57A 1H48A 1JN1A 3RE3A 1W55A 1U3PA 3F0DA 1IV4A 3ESJA 1IV3A 1IV1A 3JVHA 1YQNA 1U40A 3IKFA 2AMTA 2GZLA 3EORA 4C8EA 1U3LA 3FPIA 1KNKA 1KNJA 3ERNA 3IKEA 3KE1A 4C81A 3B6NA 1T0AA 4C82A 3IEWA 3Q8HA 3MBMA 3IEQA 1VHAA 3QHDA 3P10A 4C8GA 3F0GA 4C8IA 3ELCA 3T80A 3K2XA 1JY8A 1VH8A 3P0ZA
chains in the Genus database with same CATH superfamily
3CCVF 3WPWA 3N2KA 1X7OA 4X1YB 1DBFA 3RYHA 1IPAA 1KQSF 2I6RA 1TVKB 5EIBD 4X20B 4BT7A 1YHQF 3E22A 2CWJA 2AMTA 2ZODA 5IYZB 4HNAA 1K8AH 1KNJA 4U3JB 4O2AA 5HXUA 3S0YA 4LNUA 4U39A 3LWVC 5IJ9B 4TV9B 2HS0A 4BT3A 3PLAC 1VQ4F 3UT5B 3RYCA 3WJRA 4G4WA 3F0FA 1VQLF 2KTUA 3C9SA 3KJKA 5JH7B 2IQQA 5GONB 3VIUA 2HVYD 3FD5A 5FLXM 1YI2F 1RQ2A 5J2UB 3FFMA 2UYNB 3ESJA 5HP8A 3JVHA 5LOVB 1GO1A 2ZVZA 3VOAA 3VYUC 2QA4F 1W3EX 3S02A 5LP6B 4G4VA 2YYEA 4EI7A 2VAPA 3Q8HA 3J81M 3JASB 1RQ7A 3CG6A 3CC4F 3LWQC 1W5BA 2ZF8A 3D00A 1H47A 2OZBA 1U43A 2H6LA 3K14A 3M1XA 2GLZA 3ZP7A 4YJ2A 2VGNA 3VOBA 5EAZA 4O4LB 2LBXA 1W55A 1YGYA 2HQSC 1SA0B 1IV4A 4G4XA 4ZHWA 3CCLF 1TVKA 3SIVA 3G6EF 1JD1A 3CCJF 3CCQF 5KMGB 1JFFB 2RHHA 5IYZA 1Q81H 5GIPC 2UYKA 3N2GB 4U3JA 1M90H 4RHAA 3G71F 5EB0A 1YITF 1YJ9F 2LBTA 5BMVA 5IJ9A 4TV9A 3HKEB 2OTLF 1NQ3A 3UT5A 3VMFB 5HY1A 1XRGA 3WGNA 3HKDB 4ZI7B 5LA6B 4TUYB 4KWEA 3IKFA 2Z1UA 3WGMA 5CA1B 2ZVYA 3EORA 5EYPA 5IJ0B 2UYNA 5KX5B 1FNJA 5LOVA 3RYFB 4X1IB 3M4SA 3QUWA 3IEWA 2QI2A 3CD6F 2HRYA 1FSZA 5LP6A 2H8CA 1NMUB 2VXYA 4F6RB 4X1KB 3JCMM 3JASA 3CCSF 5C8YA 2Z1FA 2N48A 3ON1A 3HJWC 4PWTA 1UFYA 5FNVB 4B45A 1FFXB 1E7KA 1VQ6F 3F0DA 1W41A 3CB2A 2F9ZC 2CHSA 1S72F 1Q8RA 4O4LA 3CYPB 2PHNA 2WALA 1SA0A 1KNKA 1SZQA 3NMUC 3IKEA 2RHJA 3NVKE 1OFUA 4NUTA 1H7MA 4I4TB 2HRUA 1M1KH 4BW0B 1JFFA 3I55F 2CSLA 3JALA 4R40B 3P0ZA 2UZHA 3HKBB 3N2GA 1Q7YH 2DYYA 3LFOA 3J80M 3MQWA 2UYPA 3HKEA 3RE3A 1XBIA 5LYJB 4TV8A 4C4WC 1IV1A 1YQNA 1U40A 2BTQB 2DT4A 4I50A 3TD5A 3HKDA 1U3LA 5LA6A 4ZI7A 3WPXA 3JATB 3ZP4A 3OBWA 4TUYA 5LXTB 3CPWF 3N4YA 2YXZA 1GO0A 5KX5A 3IR9A 5EZYB 5CB4B 3FBAA 5B8FA 3LMEA 3MCQA 2L26A 2VAMA 2BO1A 2QEXF 2HP3A 3F0EA 3D01A 4F6RA 2NMUA 4NQ3A 1CN7A 3E1YA 4X1KA 4ZHQB 5EIBC 3WJPA 5HP7A 3CCMF 1W42A 2HP0B 2K1SA 1FNKA 1PXWA 2R751 5FNVA 3VYSC 4O4HB 3GYQA 1GZ0A 3S03A 3WXMB 4B46A 4C81A 1XHOA 1UI9A 2BTOA 4ZHVA 3P10A 1W581 4C8GA 2R6R1 3D54A 5EB1B 3T80A 2B33A 3WGKA 3CYQA 5HY4A 5JCOC 1KD1H 3RYIA 5JQGB 2OTMA 3JARB 2IG8A 3HKBA 4O2BB 4X3MA 2AIZP 3P4EA 4X1YA 1IV3A 1VQ5F 4BVRA 5JCOA 1JJ2F 4YJ3B 5LYJA 3TD3A 3LDTA 4FFBB 4I55B 4X20A 2Q1YA 4BVTA 1W5EA 4BVQA 3JATA 4C82A 2JNBA 1VQMF 3E20B 3AGKA 5MN4A 2VGMA 1VH8A 3F6MA 2CZWA 2GVIA 5G4VC 1VQPF 3C9UA 3S0HA 4BT5A 1VQ8F 5HWEA 3C9TA 5GANK 3ZOPA 3HAXD 5JH7A 4EI8A 2CW4A 5GONA 1CLIA 5LP6C 4ZHQA 2LBWA 3V4DA 2FGYA 3J7AR 1TUBB 5J2UA 4WBNB 5ITZB 1OAPA 4O4HA 1VQOF 1T0AA 5IT9M 3N2KB 3QHDA 3R0PA 3QTYA 3KJJA 2KG4A 4RQOA 3K2XA 1DT9A 1N8RH 2UYJA 3N4ZA 3FD6A 3E22B 1VK3A 1QU9A 3I7TA 2HS3A 1PF5A 1RA4A 3V7EA 4LNUB 2GZLA 2Z1EA 3G4SF 4IHJB 3HWUA 5JVDB 4M8IA 5GAPK 3K0TA 2RHLA 4NWOB 3CC2F 3IEQA 4FFBA 1Q86H 4I55A 3JAWB 1X52A 1VQNF 5KMGA 3HTNA 1Q82H 5GINC 2LCAA 3HKCB 1ODEA 1Z5VA 2H8EA 3V7QA 1H48A 4EI9A 4BT6A 4TZZA 3VTIC 5FJ4C 3CCUF 1U3PA 1YJWF 2QTPA 1T0KB 5EO3A 2IAFA 4O4IB 3ERNA 5CA0B 3KE1A 4BT2A 3RA6A 3DC2A 3B6NA 5CA1A 1QAHA 5GIOC 1X7PA 5IJ0A 4WBNA 3TD4A 2CHTA 3WGJA 2Q1XA 3RYFA 4X1IA 3WGLA 4BVSA 2HX0A 1GX1A 1W2BF 3LWPC 1K73H 4ZOLB 3VO8A 3S0WA 3V3TA 1JN1A 4B62A 3MDOA 2ZAUA 4DRXB 1FFXA 3FPIA 4G4ZA 1SDSA 3CXCF 4BY9D 3NK6A 5BMVB 1W59A 4IHJA 5JVDA 4EB6B 2ZOVA 3M84A 4C8IA 3VCZA 1YJNF 1KC8H 4G88A 2ALEA 2VAWA 4XCQA 4I4TA 5EWRA 3I56F 2KTVA 3JAWA 3JAKB 1COMA 1IV2A 1R1MA 4ERHA 3HKCA 3LWOC 4O4JB 5EYPB 1VQ9F 5MN5A 5HY0A 3IMPA 3I3FA 2EWCA 1Z5WA 1W40A 3O85A 3VYTC 3L7QA 1VQKF 2P6YA 5HY2A 3OW2F 4ZHYB 5J2TB 5A2QM 2I6DA 4O4IA 5C8YB 1VHAA 5CA0A 5LXTA 3VI6A 2BTUA 3GTZA 2W8BC 3ELCA 2RHOA 3WJQA 2AIFA 2Z1TA 3C8LA 5MN6A 5EZYA 3NK7A 5CB4A 1QVFF 3SIUA 3U0OA 4ZK7A 3NVIB 4ZOLA 3MCAB 1VQ7F 3OBYA 1J7HA 1ZWZA 2HP0A 3LYBA 3JALB 2V9YA 3PAFA 2OTJF 4DRXA 1YIJF 5DCVA 4IIJB 4LCKA 1CK2A 1NJIH 2OHWA 1JY8A 3DDNA 3CCEF 3RYHB 4BT4A 4EB6A 1RLUA 3BYQA 4TV8B 1QVGF 1RLGA 2PMPA 2MQEA 4I50B 3LWRC 3JAKA 5JQGA 1W5AA 4HNAB 3JARA 4X3LA 3CC7F 4O2AB 3RA5A 3OONA 4O2BA 4O4JA 3S06A 4C8EA 2G9IA 5HXZA 3CMEF 4YJ3A 3KIZA 3RYCB 5J2TA 3CMAF 3F0GA 1QD9A 1XV2A 2FC3A 1K9MH 5G4UC 1W5FA 3GHZA 1W57A 2HS4A 2Z01A 1VQVA 2KGWA 2RB9A 1ONIA 3JAMM 4B5CA 4G4YA 2CVLA 5AVMA 4DXDA 3C9RA 3CCRF 3KHNA 3CPQA 3MBMA 1TUBA 3RYIB 1X25A 4E6EA 3ZO8A 5ITZA 4YJ2B 4IIJA 3K12A
chains in the Genus database with same CATH topology
2UZHA 3FBAA 1H47A 3F6MA 5B8FA 1GX1A 1U43A 3K14A 3F0FA 1IV2A 2PMPA 3F0EA 3GHZA 1W57A 1H48A 1JN1A 3RE3A 1W55A 1U3PA 3F0DA 1IV4A 3ESJA 1IV3A 1IV1A 3JVHA 1YQNA 1U40A 3IKFA 2AMTA 2GZLA 3EORA 4C8EA 1U3LA 3FPIA 1KNKA 1KNJA 3ERNA 3IKEA 3KE1A 4C81A 3B6NA 1T0AA 4C82A 3IEWA 3Q8HA 3MBMA 3IEQA 1VHAA 3QHDA 3P10A 4C8GA 3F0GA 4C8IA 3ELCA 3T80A 3K2XA 1JY8A 1VH8A 3P0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZH A;  3FBA A;  1H47 A;  3F6M A;  5B8F A;  1GX1 A;  1U43 A;  3K14 A;  3F0F A;  1IV2 A;  2PMP A;  3F0E A;  3GHZ A;  1W57 A;  1H48 A;  1JN1 A;  3RE3 A;  1W55 A;  1U3P A;  3F0D A;  1IV4 A;  3ESJ A;  1IV3 A;  1IV1 A;  3JVH A;  1YQN A;  1U40 A;  3IKF A;  2AMT A;  2GZL A;  3EOR A;  4C8E A;  1U3L A;  3FPI A;  1KNK A;  1KNJ A;  3ERN A;  3IKE A;  3KE1 A;  4C81 A;  3B6N A;  1T0A A;  4C82 A;  3IEW A;  3Q8H A;  3MBM A;  3IEQ A;  1VHA A;  3QHD A;  3P10 A;  4C8G A;  3F0G A;  4C8I A;  3ELC A;  3T80 A;  3K2X A;  1JY8 A;  1VH8 A;  3P0Z A; 
#chains in the Genus database with same CATH topology
 3CCV F;  3WPW A;  3N2K A;  1X7O A;  4X1Y B;  1DBF A;  3RYH A;  1IPA A;  1KQS F;  2I6R A;  1TVK B;  5EIB D;  4X20 B;  4BT7 A;  1YHQ F;  3E22 A;  2CWJ A;  2AMT A;  2ZOD A;  5IYZ B;  4HNA A;  1K8A H;  1KNJ A;  4U3J B;  4O2A A;  5HXU A;  3S0Y A;  4LNU A;  4U39 A;  3LWV C;  5IJ9 B;  4TV9 B;  2HS0 A;  4BT3 A;  3PLA C;  1VQ4 F;  3UT5 B;  3RYC A;  3WJR A;  4G4W A;  3F0F A;  1VQL F;  2KTU A;  3C9S A;  3KJK A;  5JH7 B;  2IQQ A;  5GON B;  3VIU A;  2HVY D;  3FD5 A;  5FLX M;  1YI2 F;  1RQ2 A;  5J2U B;  3FFM A;  2UYN B;  3ESJ A;  5HP8 A;  3JVH A;  5LOV B;  1GO1 A;  2ZVZ A;  3VOA A;  3VYU C;  2QA4 F;  1W3E X;  3S02 A;  5LP6 B;  4G4V A;  2YYE A;  4EI7 A;  2VAP A;  3Q8H A;  3J81 M;  3JAS B;  1RQ7 A;  3CG6 A;  3CC4 F;  3LWQ C;  1W5B A;  2ZF8 A;  3D00 A;  1H47 A;  2OZB A;  1U43 A;  2H6L A;  3K14 A;  3M1X A;  2GLZ A;  3ZP7 A;  4YJ2 A;  2VGN A;  3VOB A;  5EAZ A;  4O4L B;  2LBX A;  1W55 A;  1YGY A;  2HQS C;  1SA0 B;  1IV4 A;  4G4X A;  4ZHW A;  3CCL F;  1TVK A;  3SIV A;  3G6E F;  1JD1 A;  3CCJ F;  3CCQ F;  5KMG B;  1JFF B;  2RHH A;  5IYZ A;  1Q81 H;  5GIP C;  2UYK A;  3N2G B;  4U3J A;  1M90 H;  4RHA A;  3G71 F;  5EB0 A;  1YIT F;  1YJ9 F;  2LBT A;  5BMV A;  5IJ9 A;  4TV9 A;  3HKE B;  2OTL F;  1NQ3 A;  3UT5 A;  3VMF B;  5HY1 A;  1XRG A;  3WGN A;  3HKD B;  4ZI7 B;  5LA6 B;  4TUY B;  4KWE A;  3IKF A;  2Z1U A;  3WGM A;  5CA1 B;  2ZVY A;  3EOR A;  5EYP A;  5IJ0 B;  2UYN A;  5KX5 B;  1FNJ A;  5LOV A;  3RYF B;  4X1I B;  3M4S A;  3QUW A;  3IEW A;  2QI2 A;  3CD6 F;  2HRY A;  1FSZ A;  5LP6 A;  2H8C A;  1NMU B;  2VXY A;  4F6R B;  4X1K B;  3JCM M;  3JAS A;  3CCS F;  5C8Y A;  2Z1F A;  2N48 A;  3ON1 A;  3HJW C;  4PWT A;  1UFY A;  5FNV B;  4B45 A;  1FFX B;  1E7K A;  1VQ6 F;  3F0D A;  1W41 A;  3CB2 A;  2F9Z C;  2CHS A;  1S72 F;  1Q8R A;  4O4L A;  3CYP B;  2PHN A;  2WAL A;  1SA0 A;  1KNK A;  1SZQ A;  3NMU C;  3IKE A;  2RHJ A;  3NVK E;  1OFU A;  4NUT A;  1H7M A;  4I4T B;  2HRU A;  1M1K H;  4BW0 B;  1JFF A;  3I55 F;  2CSL A;  3JAL A;  4R40 B;  3P0Z A;  2UZH A;  3HKB B;  3N2G A;  1Q7Y H;  2DYY A;  3LFO A;  3J80 M;  3MQW A;  2UYP A;  3HKE A;  3RE3 A;  1XBI A;  5LYJ B;  4TV8 A;  4C4W C;  1IV1 A;  1YQN A;  1U40 A;  2BTQ B;  2DT4 A;  4I50 A;  3TD5 A;  3HKD A;  1U3L A;  5LA6 A;  4ZI7 A;  3WPX A;  3JAT B;  3ZP4 A;  3OBW A;  4TUY A;  5LXT B;  3CPW F;  3N4Y A;  2YXZ A;  1GO0 A;  5KX5 A;  3IR9 A;  5EZY B;  5CB4 B;  3FBA A;  5B8F A;  3LME A;  3MCQ A;  2L26 A;  2VAM A;  2BO1 A;  2QEX F;  2HP3 A;  3F0E A;  3D01 A;  4F6R A;  2NMU A;  4NQ3 A;  1CN7 A;  3E1Y A;  4X1K A;  4ZHQ B;  5EIB C;  3WJP A;  5HP7 A;  3CCM F;  1W42 A;  2HP0 B;  2K1S A;  1FNK A;  1PXW A;  2R75 1;  5FNV A;  3VYS C;  4O4H B;  3GYQ A;  1GZ0 A;  3S03 A;  3WXM B;  4B46 A;  4C81 A;  1XHO A;  1UI9 A;  2BTO A;  4ZHV A;  3P10 A;  1W58 1;  4C8G A;  2R6R 1;  3D54 A;  5EB1 B;  3T80 A;  2B33 A;  3WGK A;  3CYQ A;  5HY4 A;  5JCO C;  1KD1 H;  3RYI A;  5JQG B;  2OTM A;  3JAR B;  2IG8 A;  3HKB A;  4O2B B;  4X3M A;  2AIZ P;  3P4E A;  4X1Y A;  1IV3 A;  1VQ5 F;  4BVR A;  5JCO A;  1JJ2 F;  4YJ3 B;  5LYJ A;  3TD3 A;  3LDT A;  4FFB B;  4I55 B;  4X20 A;  2Q1Y A;  4BVT A;  1W5E A;  4BVQ A;  3JAT A;  4C82 A;  2JNB A;  1VQM F;  3E20 B;  3AGK A;  5MN4 A;  2VGM A;  1VH8 A;  3F6M A;  2CZW A;  2GVI A;  5G4V C;  1VQP F;  3C9U A;  3S0H A;  4BT5 A;  1VQ8 F;  5HWE A;  3C9T A;  5GAN K;  3ZOP A;  3HAX D;  5JH7 A;  4EI8 A;  2CW4 A;  5GON A;  1CLI A;  5LP6 C;  4ZHQ A;  2LBW A;  3V4D A;  2FGY A;  3J7A R;  1TUB B;  5J2U A;  4WBN B;  5ITZ B;  1OAP A;  4O4H A;  1VQO F;  1T0A A;  5IT9 M;  3N2K B;  3QHD A;  3R0P A;  3QTY A;  3KJJ A;  2KG4 A;  4RQO A;  3K2X A;  1DT9 A;  1N8R H;  2UYJ A;  3N4Z A;  3FD6 A;  3E22 B;  1VK3 A;  1QU9 A;  3I7T A;  2HS3 A;  1PF5 A;  1RA4 A;  3V7E A;  4LNU B;  2GZL A;  2Z1E A;  3G4S F;  4IHJ B;  3HWU A;  5JVD B;  4M8I A;  5GAP K;  3K0T A;  2RHL A;  4NWO B;  3CC2 F;  3IEQ A;  4FFB A;  1Q86 H;  4I55 A;  3JAW B;  1X52 A;  1VQN F;  5KMG A;  3HTN A;  1Q82 H;  5GIN C;  2LCA A;  3HKC B;  1ODE A;  1Z5V A;  2H8E A;  3V7Q A;  1H48 A;  4EI9 A;  4BT6 A;  4TZZ A;  3VTI C;  5FJ4 C;  3CCU F;  1U3P A;  1YJW F;  2QTP A;  1T0K B;  5EO3 A;  2IAF A;  4O4I B;  3ERN A;  5CA0 B;  3KE1 A;  4BT2 A;  3RA6 A;  3DC2 A;  3B6N A;  5CA1 A;  1QAH A;  5GIO C;  1X7P A;  5IJ0 A;  4WBN A;  3TD4 A;  2CHT A;  3WGJ A;  2Q1X A;  3RYF A;  4X1I A;  3WGL A;  4BVS A;  2HX0 A;  1GX1 A;  1W2B F;  3LWP C;  1K73 H;  4ZOL B;  3VO8 A;  3S0W A;  3V3T A;  1JN1 A;  4B62 A;  3MDO A;  2ZAU A;  4DRX B;  1FFX A;  3FPI A;  4G4Z A;  1SDS A;  3CXC F;  4BY9 D;  3NK6 A;  5BMV B;  1W59 A;  4IHJ A;  5JVD A;  4EB6 B;  2ZOV A;  3M84 A;  4C8I A;  3VCZ A;  1YJN F;  1KC8 H;  4G88 A;  2ALE A;  2VAW A;  4XCQ A;  4I4T A;  5EWR A;  3I56 F;  2KTV A;  3JAW A;  3JAK B;  1COM A;  1IV2 A;  1R1M A;  4ERH A;  3HKC A;  3LWO C;  4O4J B;  5EYP B;  1VQ9 F;  5MN5 A;  5HY0 A;  3IMP A;  3I3F A;  2EWC A;  1Z5W A;  1W40 A;  3O85 A;  3VYT C;  3L7Q A;  1VQK F;  2P6Y A;  5HY2 A;  3OW2 F;  4ZHY B;  5J2T B;  5A2Q M;  2I6D A;  4O4I A;  5C8Y B;  1VHA A;  5CA0 A;  5LXT A;  3VI6 A;  2BTU A;  3GTZ A;  2W8B C;  3ELC A;  2RHO A;  3WJQ A;  2AIF A;  2Z1T A;  3C8L A;  5MN6 A;  5EZY A;  3NK7 A;  5CB4 A;  1QVF F;  3SIU A;  3U0O A;  4ZK7 A;  3NVI B;  4ZOL A;  3MCA B;  1VQ7 F;  3OBY A;  1J7H A;  1ZWZ A;  2HP0 A;  3LYB A;  3JAL B;  2V9Y A;  3PAF A;  2OTJ F;  4DRX A;  1YIJ F;  5DCV A;  4IIJ B;  4LCK A;  1CK2 A;  1NJI H;  2OHW A;  1JY8 A;  3DDN A;  3CCE F;  3RYH B;  4BT4 A;  4EB6 A;  1RLU A;  3BYQ A;  4TV8 B;  1QVG F;  1RLG A;  2PMP A;  2MQE A;  4I50 B;  3LWR C;  3JAK A;  5JQG A;  1W5A A;  4HNA B;  3JAR A;  4X3L A;  3CC7 F;  4O2A B;  3RA5 A;  3OON A;  4O2B A;  4O4J A;  3S06 A;  4C8E A;  2G9I A;  5HXZ A;  3CME F;  4YJ3 A;  3KIZ A;  3RYC B;  5J2T A;  3CMA F;  3F0G A;  1QD9 A;  1XV2 A;  2FC3 A;  1K9M H;  5G4U C;  1W5F A;  3GHZ A;  1W57 A;  2HS4 A;  2Z01 A;  1VQV A;  2KGW A;  2RB9 A;  1ONI A;  3JAM M;  4B5C A;  4G4Y A;  2CVL A;  5AVM A;  4DXD A;  3C9R A;  3CCR F;  3KHN A;  3CPQ A;  3MBM A;  1TUB A;  3RYI B;  1X25 A;  4E6E A;  3ZO8 A;  5ITZ A;  4YJ2 B;  4IIJ A;  3K12 A; 
#chains in the Genus database with same CATH homology
 2UZH A;  3FBA A;  1H47 A;  3F6M A;  5B8F A;  1GX1 A;  1U43 A;  3K14 A;  3F0F A;  1IV2 A;  2PMP A;  3F0E A;  3GHZ A;  1W57 A;  1H48 A;  1JN1 A;  3RE3 A;  1W55 A;  1U3P A;  3F0D A;  1IV4 A;  3ESJ A;  1IV3 A;  1IV1 A;  3JVH A;  1YQN A;  1U40 A;  3IKF A;  2AMT A;  2GZL A;  3EOR A;  4C8E A;  1U3L A;  3FPI A;  1KNK A;  1KNJ A;  3ERN A;  3IKE A;  3KE1 A;  4C81 A;  3B6N A;  1T0A A;  4C82 A;  3IEW A;  3Q8H A;  3MBM A;  3IEQ A;  1VHA A;  3QHD A;  3P10 A;  4C8G A;  3F0G A;  4C8I A;  3ELC A;  3T80 A;  3K2X A;  1JY8 A;  1VH8 A;  3P0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...