1VQ9F

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq9F00
2VGMA 3CCUF 5G4UC 3CC4F 5FLXM 3FFMA 3N4YA 2OTLF 1VQLF 1DT9A 5GIOC 3G4SF 3CCJF 4BW0B 3HAXD 3OBYA 1NJIH 4X3MA 5A2QM 2CZWA 1W2BF 1W40A 1VQNF 3SIVA 2OHWA 2OTJF 5GIPC 3G71F 2QI2A 2WALA 1Q86H 2HVYD 1S72F 1CN7A 1M1KH 1YJ9F 1X7PA 3J7AR 3NMUC 1GZ0A 4C4WC 3CCSF 1X7OA 3NK7A 3J80M 2QA4F 1KQSF 1VQ5F 3CCQF 3V7EA 1X52A 3E1YA 3NVKE 5FJ4C 5G4VC 2I6DA 2VGNA 1K73H 3OW2F 4BY9D 1YI2F 3LFOA 2FC3A 3G6EF 1H7MA 3CCEF 3V7QA 1VQOF 4LCKA 1IPAA 1GO0A 3GYQA 1E7KA 3CG6A 2OZBA 3AGKA 3LWRC 2JNBA 3CCRF 3VMFB 1VQ4F 3NVIB 3CCLF 3CXCF 5EO3A 3CMEF 1T0KB 1VQ9F 1NMUB 3OBWA 3VI6A 1YJWF 1VQPF 2KG4A 3PLAC 3JCMM 1YHQF 2QEXF 3CC2F 3O85A 3SIUA 3CCMF 3MCAB 3J81M 1YITF 3JAMM 1QVFF 3CPQA 3CC7F 3HJWC 5IT9M 1W42A 1K9MH 3E20B 1YIJF 1YJNF 3LWOC 4X3LA 1KD1H 3CD6F 3PAFA 1M90H 1VQ6F 1JJ2F 3N4ZA 2LBWA 4NUTA 1XBIA 4TZZA 1ZWZA 1PXWA 1RLGA 1CK2A 1W41A 1KC8H 3I56F 1RA4A 3CPWF 1QVGF 3CMAF 1VQMF 1VQ8F 1Q81H 5EWRA 3LWVC 3WXMB 3IR9A 3RA5A 2ALEA 5GANK 5GINC 1W3EX 1SDSA 2KTUA 3ON1A 2LBXA 3LWQC 3CCVF 1N8RH 1Q7YH 2BO1A 2KTVA 1Q82H 2AIFA 3NK6A 1VQ7F 1VQKF 5GAPK 3RA6A 5DCVA 3LWPC 1GO1A 3I55F 1K8AH
chains in the Genus database with same CATH superfamily
2IAFA 2VGMA 3JARA 3CCUF 5JVDA 3FFMA 2CW4A 5CA1A 2V9YA 2Z1UA 3JVHA 3CCJF 3WJRA 3OBYA 3RYHB 1VH8A 3RYIB 3KJJA 5HXUA 2CZWA 5JVDB 3RYFA 3SIVA 2OTJF 3VYSC 5GIPC 3E22B 3G71F 1W5FA 2QI2A 5EYPA 2ZOVA 4I55A 5AVMA 2ZVYA 3P10A 1Z5WA 3N2KB 5BMVB 1Q86H 1YJ9F 5MN6A 2MQEA 5LYJA 3IEQA 2L26A 1U3LA 1KQSF 3HKBA 3ZP7A 3M4SA 3JARB 2RHHA 3WPWA 2R6R1 3LFOA 3VOBA 3WGJA 4X1IB 3CCEF 2IQQA 2HP3A 4LCKA 5EB1B 1GO0A 1UFYA 1COMA 1E7KA 2OZBA 4TV8A 3AGKA 4ZHVA 5CB4A 1W59A 3ZOPA 3RYFB 3VMFB 3WGKA 5HXZA 1W5BA 3CMEF 5B8FA 5LOVA 2CHTA 5JQGA 3VI6A 5C8YA 5LP6C 4B45A 3PLAC 1YHQF 1DBFA 3TD4A 1TUBB 3HKCB 3SIUA 1QVFF 2Z1TA 1KNJA 5JQGB 1X25A 1ONIA 4YJ3A 2ZF8A 3E20B 4WBNB 2BTOA 2HS3A 1TUBA 2HX0A 3GTZA 3OONA 3K0TA 2NMUA 2F9ZC 1M90H 3JAKA 3F0FA 4X1KB 3MBMA 2ZODA 5LXTA 4YJ2A 4G88A 4TZZA 1RLGA 3JASB 4X20A 3WGLA 4DRXB 1KC8H 4G4YA 4U3JB 2EWCA 2UYNA 2W8BC 3WXMB 2ALEA 2AMTA 4R40B 4I50A 2IG8A 3C9UA 3JAWA 2LBXA 4IHJA 3CCVF 3N2KA 3U0OA 3UT5B 1QU9A 4ZHQA 5HY1A 4X1YB 4HNAB 3VYTC 2B33A 3D54A 4EI7A 3MCQA 5FLXM 4EI8A 1IV1A 2Q1YA 4O4LA 3RE3A 3G4SF 4BW0B 3S06A 3WGNA 5LP6A 1OFUA 3V3TA 3C8LA 3VTIC 4BT6A 5CA1B 3F0DA 3FD6A 2WALA 4ERHA 4O4IB 3P4EA 3LMEA 3RYIA 5IJ0A 3QHDA 3D01A 4U39A 1W581 3VIUA 3NK7A 1W5EA 2RHJA 3CCQF 1VQ5F 1X52A 3E1YA 5KX5A 3ESJA 2I6DA 1W55A 2VGNA 5G4VC 4I4TA 4IIJA 4LNUA 2FC3A 5LYJB 4O4HB 3G6EF 1VHAA 3TD3A 2Z1EA 1TVKA 1QAHA 1FSZA 2JNBA 1T0AA 3FBAA 4LNUB 1QD9A 5JH7B 3NVIB 3CCLF 5EO3A 5IYZA 3C9TA 3LDTA 1IV3A 3OBWA 3JASA 1FFXA 2RHOA 1VQPF 4NQ3A 4TV8B 1YQNA 2H8EA 3S0YA 3N2GA 4BT2A 3CC2F 3O85A 3JALA 1SA0B 3JAMM 3KHNA 1FNKA 3CPQA 5HP7A 5ITZA 1K9MH 1KNKA 4BVTA 4EB6A 1NQ3A 4ZHWA 3S02A 2HP0A 1KD1H 2Z1FA 5KMGB 1SZQA 4X20B 3PAFA 5J2UB 1TVKB 2ZAUA 1JJ2F 4YJ3B 4BVRA 4XCQA 1IV4A 2Z01A 4NWOB 4C8EA 4EI9A 3MQWA 1XBIA 5KMGA 3QTYA 5LOVB 2CWJA 4DXDA 5J2UA 5C8YB 1CLIA 1RA4A 2DT4A 1Q8RA 4O2AB 3CMAF 4IHJB 1VQMF 3RYCA 1VQ8F 4X1KA 3WGMA 3LWVC 3RA5A 3FD5A 5GANK 4X1YA 4FFBB 5GINC 4O4JB 1W3EX 5FNVB 4ZI7A 2KGWA 5HWEA 5HY2A 2VAPA 2BO1A 3CYPB 3ZO8A 2BTQB 2UYNB 4I50B 3QUWA 2PHNA 5GAPK 2HS4A 3I7TA 1VQKF 1W57A 3I55F 5LP6B 3ELCA 3HKBB 2CVLA 4C81A 5G4UC 2OTLF 4TV9B 1DT9A 3EORA 5EIBD 2CHSA 4B62A 1OAPA 3DC2A 5BMVA 1NJIH 2RB9A 5A2QM 3F0GA 1W40A 2GZLA 2OHWA 4TV9A 3JAWB 5GONB 1Z5VA 2HVYD 2VAMA 1M1KH 5HP8A 1X7PA 1GZ0A 4C4WC 4X1IA 3CCSF 5EYPB 3IMPA 4C8IA 1JFFB 3NVKE 1VK3A 3K2XA 5ITZB 2Q1XA 3ERNA 3HKEB 1YI2F 5IJ0B 1H7MA 2FGYA 1H48A 3V7QA 1IPAA 5EAZA 2G9IA 3GYQA 3JAKB 1JD1A 4O2BB 3CCRF 1U3PA 4B46A 1VQVA 3S03A 1NMUB 4B5CA 1RLUA 1YJWF 4G4VA 4TUYA 2KG4A 5CB4B 3S0WA 3JCMM 2QEXF 5JH7A 3GHZA 1FNJA 1XRGA 3J81M 4BVQA 3CC7F 1W5AA 2UYKA 3LYBA 3HJWC 5IT9M 5J2TA 3S0HA 4BVSA 5LA6A 1YIJF 1YJNF 2LCAA 2UYPA 3UT5A 4RHAA 5EZYB 3KJKA 2YXZA 5EIBC 3F0EA 2P6YA 2QTPA 1RQ2A 1PXWA 1JY8A 4O4JA 3D00A 3HKDB 1W41A 4O4LB 3I56F 1R1MA 1U43A 5IJ9A 4KWEA 2HQSC 3B6NA 2BTUA 3RYHA 5HY0A 4G4XA 2AIZP 1Q81H 3IR9A 3KIZA 3FPIA 1J7HA 3E22A 1SDSA 5GONA 2KTUA 4WBNA 2K1SA 3VCZA 4ZHYB 2KTVA 5EZYA 1Q82H 3NK6A 1VQ7F 3RA6A 2UZHA 3LWPC 1GO1A 3C9SA 3KE1A 1IV2A 3I3FA 4ZK7A 2I6RA 4BT3A 3CC4F 4YJ2B 4BT4A 3N4YA 3Q8HA 4DRXA 1VQLF 2OTMA 5GIOC 2ZVZA 3HAXD 3TD5A 4O4IA 4ZOLA 3V4DA 2GLZA 4X3MA 4O2BA 1W2BF 3K14A 1VQNF 5FNVA 4ZI7B 5JCOA 1JFFA 1S72F 1CN7A 3IEWA 2R751 3HKEA 3P0ZA 3J7AR 1H47A 3NMUC 2VXYA 3CB2A 3R0PA 1UI9A 2H6LA 2DYYA 3T80A 1X7OA 3J80M 2QA4F 3V7EA 3M1XA 1GX1A 5FJ4C 2RHLA 1K73H 3OW2F 4BY9D 4F6RB 1YGYA 1VQOF 3CYQA 4RQOA 3IKFA 5EB0A 5KX5B 1ODEA 3CG6A 4TUYB 3IKEA 3K12A 4I4TB 4IIJB 3WJPA 4C8GA 3LWRC 4F6RA 1VQ4F 2GVIA 4O4HA 3CXCF 1SA0A 3F6MA 5LXTB 1VQ9F 3WJQA 1T0KB 4I55B 3C9RA 3WPXA 5IJ9B 1XV2A 4EB6B 1JN1A 2HP0B 4E6EA 2UYJA 3VO8A 4C82A 1XHOA 2PMPA 3CCMF 3MCAB 3JATA 1YITF 4FFBA 3VOAA 1FFXB 1W42A 1RQ7A 5JCOC 3ZP4A 1PF5A 4G4WA 3N2GB 3LWOC 4X3LA 4BT5A 3CD6F 2VAWA 3HKDA 4HNAA 2H8CA 1VQ6F 2CSLA 5J2TB 4G4ZA 3VYUC 3N4ZA 2LBWA 3RYCB 5LA6B 4NUTA 2LBTA 3HWUA 2HRUA 3M84A 1ZWZA 5IYZB 1CK2A 1QVGF 3CPWF 3L7QA 2HS0A 3MDOA 1U40A 4ZOLB 3HKCA 4BT7A 5EWRA 5HY4A 3JALB 4ZHQB 3JATB 5MN5A 3BYQA 5CA0B 3ON1A 4O2AA 3LWQC 2HRYA 1N8RH 1Q7YH 4U3JA 3DDNA 3HTNA 2AIFA 5DCVA 4M8IA 2N48A 4PWTA 1K8AH 5CA0A 5MN4A 2YYEA
chains in the Genus database with same CATH topology
2VGMA 3CCUF 5G4UC 3CC4F 5FLXM 3FFMA 4EI8A 3N4YA 2OTLF 1VQLF 1DT9A 5GIOC 3G4SF 3CCJF 4BW0B 3HAXD 3OBYA 3V3TA 1NJIH 5HXUA 2GLZA 4X3MA 5A2QM 2CZWA 1W2BF 1W40A 1VQNF 3SIVA 2OHWA 2OTJF 5GIPC 3G71F 2QI2A 2WALA 1Q86H 2HVYD 1S72F 1CN7A 1M1KH 1YJ9F 1X7PA 3J7AR 3NMUC 1GZ0A 4C4WC 3CCSF 1X7OA 3NK7A 3J80M 2QA4F 1KQSF 1VQ5F 3CCQF 3V7EA 1X52A 3E1YA 3NVKE 5FJ4C 5G4VC 2I6DA 2VGNA 1K73H 3OW2F 4BY9D 1YI2F 3LFOA 2FC3A 3G6EF 1H7MA 2FGYA 3CCEF 3V7QA 1VQOF 4LCKA 1IPAA 1GO0A 3GYQA 1E7KA 3CG6A 2OZBA 3AGKA 3LWRC 2JNBA 3CCRF 3VMFB 1VQ4F 5HXZA 3NVIB 3CCLF 3CXCF 5EO3A 3CMEF 1T0KB 1VQ9F 1NMUB 3OBWA 3VI6A 1YJWF 1VQPF 4NQ3A 2KG4A 3PLAC 3JCMM 1YHQF 2QEXF 3CC2F 3O85A 3SIUA 3CCMF 3MCAB 3J81M 4BVQA 3JAMM 1YITF 1QVFF 3CPQA 3CC7F 3HJWC 5IT9M 1W42A 1K9MH 4BVTA 3E20B 4BVSA 1YIJF 1YJNF 3LWOC 4X3LA 1KD1H 3CD6F 2F9ZC 3PAFA 1M90H 1VQ6F 1JJ2F 4BVRA 3N4ZA 4XCQA 2LBWA 4NUTA 4EI9A 1XBIA 1ZWZA 1PXWA 4TZZA 1RLGA 3D00A 1CK2A 1W41A 1KC8H 3I56F 1RA4A 3CPWF 1QVGF 3CMAF 1VQMF 1VQ8F 5HY0A 1Q81H 5EWRA 5HY4A 3LWVC 3WXMB 3IR9A 3RA5A 2ALEA 5GANK 5GINC 1W3EX 1SDSA 2KTUA 3ON1A 2LBXA 5HY2A 5HWEA 3LWQC 3CCVF 1N8RH 1Q7YH 2BO1A 2KTVA 1Q82H 2AIFA 5HY1A 3NK6A 1VQ7F 1VQKF 5GAPK 3RA6A 5DCVA 3LWPC 1GO1A 3I55F 1K8AH 4EI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGM A;  3CCU F;  5G4U C;  3CC4 F;  5FLX M;  3FFM A;  3N4Y A;  2OTL F;  1VQL F;  1DT9 A;  5GIO C;  3G4S F;  3CCJ F;  4BW0 B;  3HAX D;  3OBY A;  1NJI H;  4X3M A;  5A2Q M;  2CZW A;  1W2B F;  1W40 A;  1VQN F;  3SIV A;  2OHW A;  2OTJ F;  5GIP C;  3G71 F;  2QI2 A;  2WAL A;  1Q86 H;  2HVY D;  1S72 F;  1CN7 A;  1M1K H;  1YJ9 F;  1X7P A;  3J7A R;  3NMU C;  1GZ0 A;  4C4W C;  3CCS F;  1X7O A;  3NK7 A;  3J80 M;  2QA4 F;  1KQS F;  1VQ5 F;  3CCQ F;  3V7E A;  1X52 A;  3E1Y A;  3NVK E;  5FJ4 C;  5G4V C;  2I6D A;  2VGN A;  1K73 H;  3OW2 F;  4BY9 D;  1YI2 F;  3LFO A;  2FC3 A;  3G6E F;  1H7M A;  3CCE F;  3V7Q A;  1VQO F;  4LCK A;  1IPA A;  1GO0 A;  3GYQ A;  1E7K A;  3CG6 A;  2OZB A;  3AGK A;  3LWR C;  2JNB A;  3CCR F;  3VMF B;  1VQ4 F;  3NVI B;  3CCL F;  3CXC F;  5EO3 A;  3CME F;  1T0K B;  1VQ9 F;  1NMU B;  3OBW A;  3VI6 A;  1YJW F;  1VQP F;  2KG4 A;  3PLA C;  3JCM M;  1YHQ F;  2QEX F;  3CC2 F;  3O85 A;  3SIU A;  3CCM F;  3MCA B;  3J81 M;  1YIT F;  3JAM M;  1QVF F;  3CPQ A;  3CC7 F;  3HJW C;  5IT9 M;  1W42 A;  1K9M H;  3E20 B;  1YIJ F;  1YJN F;  3LWO C;  4X3L A;  1KD1 H;  3CD6 F;  3PAF A;  1M90 H;  1VQ6 F;  1JJ2 F;  3N4Z A;  2LBW A;  4NUT A;  1XBI A;  4TZZ A;  1ZWZ A;  1PXW A;  1RLG A;  1CK2 A;  1W41 A;  1KC8 H;  3I56 F;  1RA4 A;  3CPW F;  1QVG F;  3CMA F;  1VQM F;  1VQ8 F;  1Q81 H;  5EWR A;  3LWV C;  3WXM B;  3IR9 A;  3RA5 A;  2ALE A;  5GAN K;  5GIN C;  1W3E X;  1SDS A;  2KTU A;  3ON1 A;  2LBX A;  3LWQ C;  3CCV F;  1N8R H;  1Q7Y H;  2BO1 A;  2KTV A;  1Q82 H;  2AIF A;  3NK6 A;  1VQ7 F;  1VQK F;  5GAP K;  3RA6 A;  5DCV A;  3LWP C;  1GO1 A;  3I55 F;  1K8A H; 
#chains in the Genus database with same CATH topology
 2IAF A;  2VGM A;  3JAR A;  3CCU F;  5JVD A;  3FFM A;  2CW4 A;  5CA1 A;  2V9Y A;  2Z1U A;  3JVH A;  3CCJ F;  3WJR A;  3OBY A;  3RYH B;  1VH8 A;  3RYI B;  3KJJ A;  5HXU A;  2CZW A;  5JVD B;  3RYF A;  3SIV A;  2OTJ F;  3VYS C;  5GIP C;  3E22 B;  3G71 F;  1W5F A;  2QI2 A;  5EYP A;  2ZOV A;  4I55 A;  5AVM A;  2ZVY A;  3P10 A;  1Z5W A;  3N2K B;  5BMV B;  1Q86 H;  1YJ9 F;  5MN6 A;  2MQE A;  5LYJ A;  3IEQ A;  2L26 A;  1U3L A;  1KQS F;  3HKB A;  3ZP7 A;  3M4S A;  3JAR B;  2RHH A;  3WPW A;  2R6R 1;  3LFO A;  3VOB A;  3WGJ A;  4X1I B;  3CCE F;  2IQQ A;  2HP3 A;  4LCK A;  5EB1 B;  1GO0 A;  1UFY A;  1COM A;  1E7K A;  2OZB A;  4TV8 A;  3AGK A;  4ZHV A;  5CB4 A;  1W59 A;  3ZOP A;  3RYF B;  3VMF B;  3WGK A;  5HXZ A;  1W5B A;  3CME F;  5B8F A;  5LOV A;  2CHT A;  5JQG A;  3VI6 A;  5C8Y A;  5LP6 C;  4B45 A;  3PLA C;  1YHQ F;  1DBF A;  3TD4 A;  1TUB B;  3HKC B;  3SIU A;  1QVF F;  2Z1T A;  1KNJ A;  5JQG B;  1X25 A;  1ONI A;  4YJ3 A;  2ZF8 A;  3E20 B;  4WBN B;  2BTO A;  2HS3 A;  1TUB A;  2HX0 A;  3GTZ A;  3OON A;  3K0T A;  2NMU A;  2F9Z C;  1M90 H;  3JAK A;  3F0F A;  4X1K B;  3MBM A;  2ZOD A;  5LXT A;  4YJ2 A;  4G88 A;  4TZZ A;  1RLG A;  3JAS B;  4X20 A;  3WGL A;  4DRX B;  1KC8 H;  4G4Y A;  4U3J B;  2EWC A;  2UYN A;  2W8B C;  3WXM B;  2ALE A;  2AMT A;  4R40 B;  4I50 A;  2IG8 A;  3C9U A;  3JAW A;  2LBX A;  4IHJ A;  3CCV F;  3N2K A;  3U0O A;  3UT5 B;  1QU9 A;  4ZHQ A;  5HY1 A;  4X1Y B;  4HNA B;  3VYT C;  2B33 A;  3D54 A;  4EI7 A;  3MCQ A;  5FLX M;  4EI8 A;  1IV1 A;  2Q1Y A;  4O4L A;  3RE3 A;  3G4S F;  4BW0 B;  3S06 A;  3WGN A;  5LP6 A;  1OFU A;  3V3T A;  3C8L A;  3VTI C;  4BT6 A;  5CA1 B;  3F0D A;  3FD6 A;  2WAL A;  4ERH A;  4O4I B;  3P4E A;  3LME A;  3RYI A;  5IJ0 A;  3QHD A;  3D01 A;  4U39 A;  1W58 1;  3VIU A;  3NK7 A;  1W5E A;  2RHJ A;  3CCQ F;  1VQ5 F;  1X52 A;  3E1Y A;  5KX5 A;  3ESJ A;  2I6D A;  1W55 A;  2VGN A;  5G4V C;  4I4T A;  4IIJ A;  4LNU A;  2FC3 A;  5LYJ B;  4O4H B;  3G6E F;  1VHA A;  3TD3 A;  2Z1E A;  1TVK A;  1QAH A;  1FSZ A;  2JNB A;  1T0A A;  3FBA A;  4LNU B;  1QD9 A;  5JH7 B;  3NVI B;  3CCL F;  5EO3 A;  5IYZ A;  3C9T A;  3LDT A;  1IV3 A;  3OBW A;  3JAS A;  1FFX A;  2RHO A;  1VQP F;  4NQ3 A;  4TV8 B;  1YQN A;  2H8E A;  3S0Y A;  3N2G A;  4BT2 A;  3CC2 F;  3O85 A;  3JAL A;  1SA0 B;  3JAM M;  3KHN A;  1FNK A;  3CPQ A;  5HP7 A;  5ITZ A;  1K9M H;  1KNK A;  4BVT A;  4EB6 A;  1NQ3 A;  4ZHW A;  3S02 A;  2HP0 A;  1KD1 H;  2Z1F A;  5KMG B;  1SZQ A;  4X20 B;  3PAF A;  5J2U B;  1TVK B;  2ZAU A;  1JJ2 F;  4YJ3 B;  4BVR A;  4XCQ A;  1IV4 A;  2Z01 A;  4NWO B;  4C8E A;  4EI9 A;  3MQW A;  1XBI A;  5KMG A;  3QTY A;  5LOV B;  2CWJ A;  4DXD A;  5J2U A;  5C8Y B;  1CLI A;  1RA4 A;  2DT4 A;  1Q8R A;  4O2A B;  3CMA F;  4IHJ B;  1VQM F;  3RYC A;  1VQ8 F;  4X1K A;  3WGM A;  3LWV C;  3RA5 A;  3FD5 A;  5GAN K;  4X1Y A;  4FFB B;  5GIN C;  4O4J B;  1W3E X;  5FNV B;  4ZI7 A;  2KGW A;  5HWE A;  5HY2 A;  2VAP A;  2BO1 A;  3CYP B;  3ZO8 A;  2BTQ B;  2UYN B;  4I50 B;  3QUW A;  2PHN A;  5GAP K;  2HS4 A;  3I7T A;  1VQK F;  1W57 A;  3I55 F;  5LP6 B;  3ELC A;  3HKB B;  2CVL A;  4C81 A;  5G4U C;  2OTL F;  4TV9 B;  1DT9 A;  3EOR A;  5EIB D;  2CHS A;  4B62 A;  1OAP A;  3DC2 A;  5BMV A;  1NJI H;  2RB9 A;  5A2Q M;  3F0G A;  1W40 A;  2GZL A;  2OHW A;  4TV9 A;  3JAW B;  5GON B;  1Z5V A;  2HVY D;  2VAM A;  1M1K H;  5HP8 A;  1X7P A;  1GZ0 A;  4C4W C;  4X1I A;  3CCS F;  5EYP B;  3IMP A;  4C8I A;  1JFF B;  3NVK E;  1VK3 A;  3K2X A;  5ITZ B;  2Q1X A;  3ERN A;  3HKE B;  1YI2 F;  5IJ0 B;  1H7M A;  2FGY A;  1H48 A;  3V7Q A;  1IPA A;  5EAZ A;  2G9I A;  3GYQ A;  3JAK B;  1JD1 A;  4O2B B;  3CCR F;  1U3P A;  4B46 A;  1VQV A;  3S03 A;  1NMU B;  4B5C A;  1RLU A;  1YJW F;  4G4V A;  4TUY A;  2KG4 A;  5CB4 B;  3S0W A;  3JCM M;  2QEX F;  5JH7 A;  3GHZ A;  1FNJ A;  1XRG A;  3J81 M;  4BVQ A;  3CC7 F;  1W5A A;  2UYK A;  3LYB A;  3HJW C;  5IT9 M;  5J2T A;  3S0H A;  4BVS A;  5LA6 A;  1YIJ F;  1YJN F;  2LCA A;  2UYP A;  3UT5 A;  4RHA A;  5EZY B;  3KJK A;  2YXZ A;  5EIB C;  3F0E A;  2P6Y A;  2QTP A;  1RQ2 A;  1PXW A;  1JY8 A;  4O4J A;  3D00 A;  3HKD B;  1W41 A;  4O4L B;  3I56 F;  1R1M A;  1U43 A;  5IJ9 A;  4KWE A;  2HQS C;  3B6N A;  2BTU A;  3RYH A;  5HY0 A;  4G4X A;  2AIZ P;  1Q81 H;  3IR9 A;  3KIZ A;  3FPI A;  1J7H A;  3E22 A;  1SDS A;  5GON A;  2KTU A;  4WBN A;  2K1S A;  3VCZ A;  4ZHY B;  2KTV A;  5EZY A;  1Q82 H;  3NK6 A;  1VQ7 F;  3RA6 A;  2UZH A;  3LWP C;  1GO1 A;  3C9S A;  3KE1 A;  1IV2 A;  3I3F A;  4ZK7 A;  2I6R A;  4BT3 A;  3CC4 F;  4YJ2 B;  4BT4 A;  3N4Y A;  3Q8H A;  4DRX A;  1VQL F;  2OTM A;  5GIO C;  2ZVZ A;  3HAX D;  3TD5 A;  4O4I A;  4ZOL A;  3V4D A;  2GLZ A;  4X3M A;  4O2B A;  1W2B F;  3K14 A;  1VQN F;  5FNV A;  4ZI7 B;  5JCO A;  1JFF A;  1S72 F;  1CN7 A;  3IEW A;  2R75 1;  3HKE A;  3P0Z A;  3J7A R;  1H47 A;  3NMU C;  2VXY A;  3CB2 A;  3R0P A;  1UI9 A;  2H6L A;  2DYY A;  3T80 A;  1X7O A;  3J80 M;  2QA4 F;  3V7E A;  3M1X A;  1GX1 A;  5FJ4 C;  2RHL A;  1K73 H;  3OW2 F;  4BY9 D;  4F6R B;  1YGY A;  1VQO F;  3CYQ A;  4RQO A;  3IKF A;  5EB0 A;  5KX5 B;  1ODE A;  3CG6 A;  4TUY B;  3IKE A;  3K12 A;  4I4T B;  4IIJ B;  3WJP A;  4C8G A;  3LWR C;  4F6R A;  1VQ4 F;  2GVI A;  4O4H A;  3CXC F;  1SA0 A;  3F6M A;  5LXT B;  1VQ9 F;  3WJQ A;  1T0K B;  4I55 B;  3C9R A;  3WPX A;  5IJ9 B;  1XV2 A;  4EB6 B;  1JN1 A;  2HP0 B;  4E6E A;  2UYJ A;  3VO8 A;  4C82 A;  1XHO A;  2PMP A;  3CCM F;  3MCA B;  3JAT A;  1YIT F;  4FFB A;  3VOA A;  1FFX B;  1W42 A;  1RQ7 A;  5JCO C;  3ZP4 A;  1PF5 A;  4G4W A;  3N2G B;  3LWO C;  4X3L A;  4BT5 A;  3CD6 F;  2VAW A;  3HKD A;  4HNA A;  2H8C A;  1VQ6 F;  2CSL A;  5J2T B;  4G4Z A;  3VYU C;  3N4Z A;  2LBW A;  3RYC B;  5LA6 B;  4NUT A;  2LBT A;  3HWU A;  2HRU A;  3M84 A;  1ZWZ A;  5IYZ B;  1CK2 A;  1QVG F;  3CPW F;  3L7Q A;  2HS0 A;  3MDO A;  1U40 A;  4ZOL B;  3HKC A;  4BT7 A;  5EWR A;  5HY4 A;  3JAL B;  4ZHQ B;  3JAT B;  5MN5 A;  3BYQ A;  5CA0 B;  3ON1 A;  4O2A A;  3LWQ C;  2HRY A;  1N8R H;  1Q7Y H;  4U3J A;  3DDN A;  3HTN A;  2AIF A;  5DCV A;  4M8I A;  2N48 A;  4PWT A;  1K8A H;  5CA0 A;  5MN4 A;  2YYE A; 
#chains in the Genus database with same CATH homology
 2VGM A;  3CCU F;  5G4U C;  3CC4 F;  5FLX M;  3FFM A;  4EI8 A;  3N4Y A;  2OTL F;  1VQL F;  1DT9 A;  5GIO C;  3G4S F;  3CCJ F;  4BW0 B;  3HAX D;  3OBY A;  3V3T A;  1NJI H;  5HXU A;  2GLZ A;  4X3M A;  5A2Q M;  2CZW A;  1W2B F;  1W40 A;  1VQN F;  3SIV A;  2OHW A;  2OTJ F;  5GIP C;  3G71 F;  2QI2 A;  2WAL A;  1Q86 H;  2HVY D;  1S72 F;  1CN7 A;  1M1K H;  1YJ9 F;  1X7P A;  3J7A R;  3NMU C;  1GZ0 A;  4C4W C;  3CCS F;  1X7O A;  3NK7 A;  3J80 M;  2QA4 F;  1KQS F;  1VQ5 F;  3CCQ F;  3V7E A;  1X52 A;  3E1Y A;  3NVK E;  5FJ4 C;  5G4V C;  2I6D A;  2VGN A;  1K73 H;  3OW2 F;  4BY9 D;  1YI2 F;  3LFO A;  2FC3 A;  3G6E F;  1H7M A;  2FGY A;  3CCE F;  3V7Q A;  1VQO F;  4LCK A;  1IPA A;  1GO0 A;  3GYQ A;  1E7K A;  3CG6 A;  2OZB A;  3AGK A;  3LWR C;  2JNB A;  3CCR F;  3VMF B;  1VQ4 F;  5HXZ A;  3NVI B;  3CCL F;  3CXC F;  5EO3 A;  3CME F;  1T0K B;  1VQ9 F;  1NMU B;  3OBW A;  3VI6 A;  1YJW F;  1VQP F;  4NQ3 A;  2KG4 A;  3PLA C;  3JCM M;  1YHQ F;  2QEX F;  3CC2 F;  3O85 A;  3SIU A;  3CCM F;  3MCA B;  3J81 M;  4BVQ A;  3JAM M;  1YIT F;  1QVF F;  3CPQ A;  3CC7 F;  3HJW C;  5IT9 M;  1W42 A;  1K9M H;  4BVT A;  3E20 B;  4BVS A;  1YIJ F;  1YJN F;  3LWO C;  4X3L A;  1KD1 H;  3CD6 F;  2F9Z C;  3PAF A;  1M90 H;  1VQ6 F;  1JJ2 F;  4BVR A;  3N4Z A;  4XCQ A;  2LBW A;  4NUT A;  4EI9 A;  1XBI A;  1ZWZ A;  1PXW A;  4TZZ A;  1RLG A;  3D00 A;  1CK2 A;  1W41 A;  1KC8 H;  3I56 F;  1RA4 A;  3CPW F;  1QVG F;  3CMA F;  1VQM F;  1VQ8 F;  5HY0 A;  1Q81 H;  5EWR A;  5HY4 A;  3LWV C;  3WXM B;  3IR9 A;  3RA5 A;  2ALE A;  5GAN K;  5GIN C;  1W3E X;  1SDS A;  2KTU A;  3ON1 A;  2LBX A;  5HY2 A;  5HWE A;  3LWQ C;  3CCV F;  1N8R H;  1Q7Y H;  2BO1 A;  2KTV A;  1Q82 H;  2AIF A;  5HY1 A;  3NK6 A;  1VQ7 F;  1VQK F;  5GAP K;  3RA6 A;  5DCV A;  3LWP C;  1GO1 A;  3I55 F;  1K8A H;  4EI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...