1VQ9F

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq9F00
1VQNF 3IR9A 2VGMA 3V7QA 2LBXA 4BW0B 3NK6A 1PXWA 3N4YA 3J80M 4NUTA 3VMFB 3RA6A 3CCMF 5G4UC 1W40A 1K9MH 3CCQF 3HJWC 1VQ5F 5EWRA 3FFMA 3CC4F 3CCEF 4TZZA 5EO3A 1W42A 2VGNA 2CZWA 2WALA 3NK7A 3CMAF 1VQPF 1YIJF 1RLGA 1IPAA 1T0KB 1W2BF 3V7EA 3CCRF 3LWVC 1VQ4F 2OHWA 3OBYA 4BY9D 1VQ6F 2OTLF 1CK2A 1YHQF 3HAXD 3PAFA 3WXMB 3OBWA 1YJNF 5IT9M 1X7PA 3CG6A 3CCJF 5FLXM 3OW2F 2KTVA 1M1KH 1VQ9F 1VQKF 3N4ZA 3CC2F 1KQSF 5A2QM 3SIUA 1YI2F 2JNBA 3LWOC 2AIFA 2KTUA 3RA5A 5GIOC 1GZ0A 3ON1A 1Q7YH 1Q82H 1KC8H 1X52A 3NVIB 3CMEF 1DT9A 3VI6A 1CN7A 4LCKA 3CCSF 1S72F 3LWRC 5GIPC 1K73H 3J81M 3I56F 2BO1A 2OTJF 1NJIH 5FJ4C 3CXCF 1YITF 1QVGF 1RA4A 1K8AH 3CCVF 1N8RH 5DCVA 3SIVA 4X3LA 3NVKE 1H7MA 1VQ8F 5GANK 3GYQA 2KG4A 1Q86H 3G6EF 1GO0A 1W41A 1KD1H 1YJWF 3O85A 1XBIA 3I55F 2HVYD 3MCAB 2I6DA 1GO1A 2OZBA 5G4VC 3CPQA 2QI2A 3G4SF 1JJ2F 1VQLF 1SDSA 3J7AR 3LWPC 1NMUB 3JCMM 1X7OA 1VQMF 3CCUF 1M90H 3NMUC 4C4WC 1Q81H 3CPWF 1ZWZA 2QA4F 2ALEA 3CC7F 1QVFF 1E7KA 3LFOA 5GAPK 3PLAC 2FC3A 3CD6F 4X3MA 3CCLF 1W3EX 3LWQC 3AGKA 3E20B 3JAMM 2QEXF 1YJ9F 1VQOF 2LBWA 3E1YA 3G71F 5GINC 1VQ7F
chains in the Genus database with same CATH superfamily
4C82A 2VAWA 2RHLA 4ZOLA 3OONA 2LBTA 3T80A 4LNUB 3NK6A 2IQQA 3N2KA 4TV8A 5G4UC 3HJWC 4PWTA 1VQ5F 4U3JA 3FFMA 1SA0B 4X1YB 3CCEF 2Z1UA 5IJ9B 4TZZA 5LP6A 1YQNA 1W42A 3KJJA 2VGNA 1FFXB 2CZWA 1RLGA 4I55A 2UYKA 3V7EA 1W2BF 1VQ4F 4O4HA 4BY9D 3FPIA 1VK3A 2V9YA 3WXMB 1YJNF 3IEWA 4EB6B 4I55B 3F6MA 2UYJA 3OW2F 4ZOLB 5J2UB 1M1KH 5ITZB 4TUYB 2BTOA 1KQSF 4ZHQB 1YI2F 4X1KB 2KTUA 3K14A 1GZ0A 3VO8A 2RHJA 4M8IA 3WPWA 4O4JA 2F9ZC 3CCSF 4G4YA 1Z5VA 3M4SA 3J81M 3I56F 2BO1A 2OTJF 1NJIH 3HKBB 5HY1A 3WJRA 1JY8A 2CSLA 5EIBD 4DRXA 4YJ3A 1QVGF 3LDTA 4TV8B 1K8AH 3C9TA 1XV2A 1KNKA 1R1MA 3HKCA 4F6RA 3SIVA 3F0EA 2DT4A 5FNVA 2HQSC 2KG4A 3QTYA 1VQVA 1COMA 5JVDB 3IEQA 1OAPA 2CWJA 4ZHQA 1YJWF 1XBIA 2HVYD 5G4VC 3G4SF 5JCOA 5LOVA 5LYJB 1DBFA 3VTIC 3NMUC 4G88A 3QUWA 3CCUF 1M90H 3JATB 4O2BB 3BYQA 1Q81H 5B8FA 3S0HA 3CYPB 3CC7F 1SA0A 5GAPK 2G9IA 1FNKA 3C9SA 4C8EA 2FC3A 4ZK7A 1U3LA 2KGWA 1Q8RA 3ZOPA 3D54A 2YXZA 3AGKA 3JAMM 4TV9B 1IV2A 4XCQA 3D00A 4BVRA 3N2KB 4ZHWA 2BTUA 5KX5A 2LBWA 3G71F 5GINC 3JVHA 1H48A 2EWCA 4BT3A 2B33A 4TV9A 5J2UA 2LBXA 1PXWA 3J80M 1KNJA 3HKBA 5JH7A 4NUTA 2RB9A 3CCMF 1W40A 4WBNB 4EI9A 3B6NA 3P10A 5J2TA 1VQPF 1T0KB 1YIJF 3KE1A 1IPAA 3CCRF 1VQ6F 5MN4A 3HAXD 3OBWA 5HY4A 5JCOC 3JARA 4I50A 5EYPA 5CA0B 4F6RB 4YJ3B 3WGNA 1TVKB 2ZAUA 1ONIA 3C8LA 3ESJA 1VQ9F 5GONB 3WJPA 3ERNA 3IKEA 3KHNA 4X20B 1VQKF 3N4ZA 3HKCB 3CC2F 4C81A 2BTQB 1RLUA 4YJ2B 3RYFA 2RHOA 3LWOC 5GIOC 3JAKB 1Q7YH 4BVTA 4ERHA 1DT9A 1NQ3A 3VI6A 1TUBA 2HX0A 3TD3A 2VAPA 1CLIA 3DC2A 5GIPC 5LYJA 3K2XA 5LOVB 3ZP4A 3CYQA 2CHSA 3TD4A 3F0FA 2IG8A 4C8GA 4I50B 4G4WA 4HNAB 5LXTA 1X25A 3VOBA 3LMEA 5HXZA 2H6LA 4BT6A 3L7QA 1N8RH 4HNAA 3NVKE 1VQ8F 5JQGA 5GANK 3KJKA 4RQOA 1W5EA 1KD1H 1FSZA 2DYYA 2R6R1 2UYPA 4O2AA 4BT7A 3S0WA 3I55F 1PF5A 1XHOA 2W8BC 1GO1A 2OZBA 3UT5B 1SDSA 4U3JB 3JCMM 5IJ9A 4O2AB 5CA0A 1ZWZA 2NMUA 4NWOB 5CB4B 2LCAA 2QA4F 3JASB 3IKFA 3LFOA 1T0AA 4TUYA 3RYCA 5C8YA 3JAWA 5LXTB 3CCLF 2K1SA 4G4VA 1W3EX 3LWQC 3JARB 3N2GA 2QEXF 2GLZA 5EB1B 2AIZP 3E1YA 3WGLA 1VQ7F 1VQNF 3IR9A 3MQWA 3MBMA 2VGMA 3V7QA 1JD1A 3VYTC 3N4YA 5LP6B 4G4XA 3HKDA 5EB0A 1K9MH 5AVMA 5EWRA 4B46A 3CC4F 2OTMA 3WPXA 4IIJB 3MCQA 3RE3A 2WALA 3NK7A 2H8EA 3P0ZA 2HP3A 2OHWA 5EYPB 1QD9A 3OBYA 2GZLA 2I6RA 3KIZA 1CK2A 4KWEA 1TVKA 1W59A 4ZI7B 2OTLF 3PAFA 2Q1XA 5IT9M 2P6YA 5HWEA 4R40B 5FLXM 2N48A 1JFFA 2Q1YA 2UZHA 3V3TA 1IV3A 3M1XA 3E22B 3S03A 2HS4A 1RQ7A 2Z1FA 5BMVB 3K12A 4B5CA 5A2QM 4O4JB 2Z1TA 5KMGA 2JNBA 3RA5A 2AIFA 3ZO8A 4B62A 1KC8H 5JH7B 1X52A 3Q8HA 4DXDA 3CMEF 3NVIB 4NQ3A 4WBNA 1W5AA 3S02A 3RYFB 5CA1B 1S72F 3LWRC 2ZF8A 5HY0A 5FJ4C 2AMTA 1VHAA 2CVLA 3FD5A 5EIBC 5CB4A 3CXCF 3C9RA 1SZQA 3WGMA 1RA4A 3F0GA 5EZYB 2HRYA 3CCVF 3WJQA 5IYZB 3RYIA 5DCVA 2ZVZA 4X3LA 1H7MA 5KMGB 2Z01A 3HTNA 4BT5A 3EORA 2CW4A 3MCAB 5HP7A 2I6DA 4ZI7A 2RHHA 5HP8A 3J7AR 4O4IB 1YGYA 1ODEA 3U0OA 3LWPC 4C4WC 1VQMF 2L26A 2R751 3ELCA 4X1IA 3TD5A 3JAWB 5C8YB 3CPWF 2ZODA 4BT4A 3VIUA 2HP0B 4IHJA 2Z1EA 5EAZA 3WGKA 2ALEA 1VH8A 1QVFF 4DRXB 2UYNB 5IJ0B 1UI9A 1U40A 3VYSC 4X3MA 5MN5A 1TUBB 3HWUA 1IV1A 3E20B 1YJ9F 1W5FA 1OFUA 3RYIB 4BT2A 2H8CA 5JQGB 4X20A 3N2GB 1W5BA 1W55A 4BW0B 2VAMA 1XRGA 5GONA 3WGJA 3VMFB 1W57A 3RA6A 4X1IB 4ZHYB 5LP6C 3CCQF 2HP0A 4IHJB 2QTPA 2FGYA 4O4IA 2MQEA 3D01A 3V4DA 5CA1A 5EO3A 4G4ZA 3RYCB 3CMAF 3R0PA 2CHTA 4ZHVA 3JASA 3LWVC 3DDNA 4E6EA 4IIJA 1YHQF 4C8IA 4U39A 3VYUC 1X7PA 5BMVA 3UT5A 2PHNA 3CG6A 5MN6A 3CCJF 1U3PA 2HS3A 3JAKA 3JALA 1GX1A 2KTVA 3IMPA 5EZYA 3VCZA 4O4LB 3S06A 1QAHA 5IYZA 5JVDA 1J7HA 5LA6B 3GTZA 3SIUA 2UYNA 1Q82H 3ON1A 4X1YA 1JN1A 3P4EA 3FBAA 4EI7A 2IAFA 3MDOA 4RHAA 3RYHB 1CN7A 1Z5WA 5KX5B 4EI8A 2ZVYA 2VXYA 4LCKA 4X1KA 1FNJA 4I4TB 1K73H 3CB2A 1QU9A 3HKDB 3S0YA 5HY2A 3HKEA 2HS0A 3LYBA 1YITF 3F0DA 3C9UA 4EB6A 1UFYA 1H47A 4FFBB 3K0TA 4BVSA 1JFFB 3FD6A 3E22A 3GYQA 1Q86H 4B45A 1FFXA 3VOAA 3G6EF 1GO0A 1W41A 3ZP7A 1U43A 1IV4A 3O85A 1RQ2A 4YJ2A 3M84A 5FNVB 3CPQA 3QHDA 2QI2A 1JJ2F 1VQLF 4LNUA 2GVIA 3I3FA 2ZOVA 1NMUB 1X7OA 2YYEA 5J2TB 3I7TA 3JALB 5LA6A 1E7KA 2HRUA 4O4HB 2PMPA 4O4LA 3PLAC 4BVQA 3JATA 4O2BA 4FFBA 3CD6F 3HKEB 3GHZA 5IJ0A 3RYHA 1VQOF 5HXUA 5ITZA 4I4TA 1W581
chains in the Genus database with same CATH topology
1VQNF 3IR9A 2VGMA 3V7QA 2LBXA 4BW0B 3NK6A 1PXWA 3N4YA 3J80M 4NUTA 3VMFB 3RA6A 3CCMF 5G4UC 1W40A 1K9MH 3CCQF 3HJWC 4EI9A 1VQ5F 2FGYA 5EWRA 3FFMA 3CC4F 3CCEF 4TZZA 5EO3A 1W42A 2VGNA 2CZWA 2WALA 3NK7A 3CMAF 1VQPF 1YIJF 1RLGA 1IPAA 1T0KB 1W2BF 3V7EA 3CCRF 3LWVC 1VQ4F 2OHWA 3OBYA 4BY9D 1VQ6F 2OTLF 1CK2A 1YHQF 3HAXD 3PAFA 3WXMB 3OBWA 1YJNF 5HY4A 5IT9M 1X7PA 3CG6A 5HWEA 3CCJF 5FLXM 3OW2F 3V3TA 2KTVA 1M1KH 1VQ9F 1VQKF 3N4ZA 3CC2F 1KQSF 5A2QM 3SIUA 1YI2F 2JNBA 2KTUA 2AIFA 3RA5A 3LWOC 5GIOC 1GZ0A 3ON1A 1Q7YH 1Q82H 1KC8H 1X52A 3NVIB 4BVTA 3CMEF 4NQ3A 1DT9A 4EI7A 3VI6A 1CN7A 4EI8A 2F9ZC 4LCKA 3CCSF 1S72F 3LWRC 5GIPC 1K73H 3J81M 3I56F 2BO1A 2OTJF 5HY0A 1NJIH 5FJ4C 5HY1A 5HY2A 3CXCF 1YITF 1QVGF 1RA4A 1K8AH 5HXZA 3CCVF 4BVSA 1N8RH 5DCVA 3SIVA 4X3LA 3NVKE 1H7MA 1VQ8F 5GANK 3GYQA 2KG4A 1Q86H 3G6EF 1GO0A 1W41A 1KD1H 1YJWF 3O85A 1XBIA 3I55F 2HVYD 3MCAB 2I6DA 1GO1A 2OZBA 3CPQA 5G4VC 2QI2A 3G4SF 1JJ2F 1VQLF 1SDSA 3J7AR 3LWPC 1NMUB 3JCMM 1X7OA 1VQMF 3CCUF 1M90H 3NMUC 4C4WC 1Q81H 3CPWF 1ZWZA 2QA4F 2ALEA 3CC7F 1QVFF 1E7KA 3LFOA 5GAPK 3PLAC 2FC3A 4BVQA 3CD6F 4X3MA 3CCLF 1W3EX 3LWQC 3AGKA 3E20B 3JAMM 2QEXF 1YJ9F 2GLZA 4XCQA 3D00A 4BVRA 1VQOF 2LBWA 3E1YA 5HXUA 3G71F 5GINC 1VQ7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN F;  3IR9 A;  2VGM A;  3V7Q A;  2LBX A;  4BW0 B;  3NK6 A;  1PXW A;  3N4Y A;  3J80 M;  4NUT A;  3VMF B;  3RA6 A;  3CCM F;  5G4U C;  1W40 A;  1K9M H;  3CCQ F;  3HJW C;  1VQ5 F;  5EWR A;  3FFM A;  3CC4 F;  3CCE F;  4TZZ A;  5EO3 A;  1W42 A;  2VGN A;  2CZW A;  2WAL A;  3NK7 A;  3CMA F;  1VQP F;  1YIJ F;  1RLG A;  1IPA A;  1T0K B;  1W2B F;  3V7E A;  3CCR F;  3LWV C;  1VQ4 F;  2OHW A;  3OBY A;  4BY9 D;  1VQ6 F;  2OTL F;  1CK2 A;  1YHQ F;  3HAX D;  3PAF A;  3WXM B;  3OBW A;  1YJN F;  5IT9 M;  1X7P A;  3CG6 A;  3CCJ F;  5FLX M;  3OW2 F;  2KTV A;  1M1K H;  1VQ9 F;  1VQK F;  3N4Z A;  3CC2 F;  1KQS F;  5A2Q M;  3SIU A;  1YI2 F;  2JNB A;  3LWO C;  2AIF A;  2KTU A;  3RA5 A;  5GIO C;  1GZ0 A;  3ON1 A;  1Q7Y H;  1Q82 H;  1KC8 H;  1X52 A;  3NVI B;  3CME F;  1DT9 A;  3VI6 A;  1CN7 A;  4LCK A;  3CCS F;  1S72 F;  3LWR C;  5GIP C;  1K73 H;  3J81 M;  3I56 F;  2BO1 A;  2OTJ F;  1NJI H;  5FJ4 C;  3CXC F;  1YIT F;  1QVG F;  1RA4 A;  1K8A H;  3CCV F;  1N8R H;  5DCV A;  3SIV A;  4X3L A;  3NVK E;  1H7M A;  1VQ8 F;  5GAN K;  3GYQ A;  2KG4 A;  1Q86 H;  3G6E F;  1GO0 A;  1W41 A;  1KD1 H;  1YJW F;  3O85 A;  1XBI A;  3I55 F;  2HVY D;  3MCA B;  2I6D A;  1GO1 A;  2OZB A;  5G4V C;  3CPQ A;  2QI2 A;  3G4S F;  1JJ2 F;  1VQL F;  1SDS A;  3J7A R;  3LWP C;  1NMU B;  3JCM M;  1X7O A;  1VQM F;  3CCU F;  1M90 H;  3NMU C;  4C4W C;  1Q81 H;  3CPW F;  1ZWZ A;  2QA4 F;  2ALE A;  3CC7 F;  1QVF F;  1E7K A;  3LFO A;  5GAP K;  3PLA C;  2FC3 A;  3CD6 F;  4X3M A;  3CCL F;  1W3E X;  3LWQ C;  3AGK A;  3E20 B;  3JAM M;  2QEX F;  1YJ9 F;  1VQO F;  2LBW A;  3E1Y A;  3G71 F;  5GIN C;  1VQ7 F; 
#chains in the Genus database with same CATH topology
 4C82 A;  2VAW A;  2RHL A;  4ZOL A;  3OON A;  2LBT A;  3T80 A;  4LNU B;  3NK6 A;  2IQQ A;  3N2K A;  4TV8 A;  5G4U C;  3HJW C;  4PWT A;  1VQ5 F;  4U3J A;  3FFM A;  1SA0 B;  4X1Y B;  3CCE F;  2Z1U A;  5IJ9 B;  4TZZ A;  5LP6 A;  1YQN A;  1W42 A;  3KJJ A;  2VGN A;  1FFX B;  2CZW A;  1RLG A;  4I55 A;  2UYK A;  3V7E A;  1W2B F;  1VQ4 F;  4O4H A;  4BY9 D;  3FPI A;  1VK3 A;  2V9Y A;  3WXM B;  1YJN F;  3IEW A;  4EB6 B;  4I55 B;  3F6M A;  2UYJ A;  3OW2 F;  4ZOL B;  5J2U B;  1M1K H;  5ITZ B;  4TUY B;  2BTO A;  1KQS F;  4ZHQ B;  1YI2 F;  4X1K B;  2KTU A;  3K14 A;  1GZ0 A;  3VO8 A;  2RHJ A;  4M8I A;  3WPW A;  4O4J A;  2F9Z C;  3CCS F;  4G4Y A;  1Z5V A;  3M4S A;  3J81 M;  3I56 F;  2BO1 A;  2OTJ F;  1NJI H;  3HKB B;  5HY1 A;  3WJR A;  1JY8 A;  2CSL A;  5EIB D;  4DRX A;  4YJ3 A;  1QVG F;  3LDT A;  4TV8 B;  1K8A H;  3C9T A;  1XV2 A;  1KNK A;  1R1M A;  3HKC A;  4F6R A;  3SIV A;  3F0E A;  2DT4 A;  5FNV A;  2HQS C;  2KG4 A;  3QTY A;  1VQV A;  1COM A;  5JVD B;  3IEQ A;  1OAP A;  2CWJ A;  4ZHQ A;  1YJW F;  1XBI A;  2HVY D;  5G4V C;  3G4S F;  5JCO A;  5LOV A;  5LYJ B;  1DBF A;  3VTI C;  3NMU C;  4G88 A;  3QUW A;  3CCU F;  1M90 H;  3JAT B;  4O2B B;  3BYQ A;  1Q81 H;  5B8F A;  3S0H A;  3CYP B;  3CC7 F;  1SA0 A;  5GAP K;  2G9I A;  1FNK A;  3C9S A;  4C8E A;  2FC3 A;  4ZK7 A;  1U3L A;  2KGW A;  1Q8R A;  3ZOP A;  3D54 A;  2YXZ A;  3AGK A;  3JAM M;  4TV9 B;  1IV2 A;  4XCQ A;  3D00 A;  4BVR A;  3N2K B;  4ZHW A;  2BTU A;  5KX5 A;  2LBW A;  3G71 F;  5GIN C;  3JVH A;  1H48 A;  2EWC A;  4BT3 A;  2B33 A;  4TV9 A;  5J2U A;  2LBX A;  1PXW A;  3J80 M;  1KNJ A;  3HKB A;  5JH7 A;  4NUT A;  2RB9 A;  3CCM F;  1W40 A;  4WBN B;  4EI9 A;  3B6N A;  3P10 A;  5J2T A;  1VQP F;  1T0K B;  1YIJ F;  3KE1 A;  1IPA A;  3CCR F;  1VQ6 F;  5MN4 A;  3HAX D;  3OBW A;  5HY4 A;  5JCO C;  3JAR A;  4I50 A;  5EYP A;  5CA0 B;  4F6R B;  4YJ3 B;  3WGN A;  1TVK B;  2ZAU A;  1ONI A;  3C8L A;  3ESJ A;  1VQ9 F;  5GON B;  3WJP A;  3ERN A;  3IKE A;  3KHN A;  4X20 B;  1VQK F;  3N4Z A;  3HKC B;  3CC2 F;  4C81 A;  2BTQ B;  1RLU A;  4YJ2 B;  3RYF A;  2RHO A;  3LWO C;  5GIO C;  3JAK B;  1Q7Y H;  4BVT A;  4ERH A;  1DT9 A;  1NQ3 A;  3VI6 A;  1TUB A;  2HX0 A;  3TD3 A;  2VAP A;  1CLI A;  3DC2 A;  5GIP C;  5LYJ A;  3K2X A;  5LOV B;  3ZP4 A;  3CYQ A;  2CHS A;  3TD4 A;  3F0F A;  2IG8 A;  4C8G A;  4I50 B;  4G4W A;  4HNA B;  5LXT A;  1X25 A;  3VOB A;  3LME A;  5HXZ A;  2H6L A;  4BT6 A;  3L7Q A;  1N8R H;  4HNA A;  3NVK E;  1VQ8 F;  5JQG A;  5GAN K;  3KJK A;  4RQO A;  1W5E A;  1KD1 H;  1FSZ A;  2DYY A;  2R6R 1;  2UYP A;  4O2A A;  4BT7 A;  3S0W A;  3I55 F;  1PF5 A;  1XHO A;  2W8B C;  1GO1 A;  2OZB A;  3UT5 B;  1SDS A;  4U3J B;  3JCM M;  5IJ9 A;  4O2A B;  5CA0 A;  1ZWZ A;  2NMU A;  4NWO B;  5CB4 B;  2LCA A;  2QA4 F;  3JAS B;  3IKF A;  3LFO A;  1T0A A;  4TUY A;  3RYC A;  5C8Y A;  3JAW A;  5LXT B;  3CCL F;  2K1S A;  4G4V A;  1W3E X;  3LWQ C;  3JAR B;  3N2G A;  2QEX F;  2GLZ A;  5EB1 B;  2AIZ P;  3E1Y A;  3WGL A;  1VQ7 F;  1VQN F;  3IR9 A;  3MQW A;  3MBM A;  2VGM A;  3V7Q A;  1JD1 A;  3VYT C;  3N4Y A;  5LP6 B;  4G4X A;  3HKD A;  5EB0 A;  1K9M H;  5AVM A;  5EWR A;  4B46 A;  3CC4 F;  2OTM A;  3WPX A;  4IIJ B;  3MCQ A;  3RE3 A;  2WAL A;  3NK7 A;  2H8E A;  3P0Z A;  2HP3 A;  2OHW A;  5EYP B;  1QD9 A;  3OBY A;  2GZL A;  2I6R A;  3KIZ A;  1CK2 A;  4KWE A;  1TVK A;  1W59 A;  4ZI7 B;  2OTL F;  3PAF A;  2Q1X A;  5IT9 M;  2P6Y A;  5HWE A;  4R40 B;  5FLX M;  2N48 A;  1JFF A;  2Q1Y A;  2UZH A;  3V3T A;  1IV3 A;  3M1X A;  3E22 B;  3S03 A;  2HS4 A;  1RQ7 A;  2Z1F A;  5BMV B;  3K12 A;  4B5C A;  5A2Q M;  4O4J B;  2Z1T A;  5KMG A;  2JNB A;  3RA5 A;  2AIF A;  3ZO8 A;  4B62 A;  1KC8 H;  5JH7 B;  1X52 A;  3Q8H A;  4DXD A;  3CME F;  3NVI B;  4NQ3 A;  4WBN A;  1W5A A;  3S02 A;  3RYF B;  5CA1 B;  1S72 F;  3LWR C;  2ZF8 A;  5HY0 A;  5FJ4 C;  2AMT A;  1VHA A;  2CVL A;  3FD5 A;  5EIB C;  5CB4 A;  3CXC F;  3C9R A;  1SZQ A;  3WGM A;  1RA4 A;  3F0G A;  5EZY B;  2HRY A;  3CCV F;  3WJQ A;  5IYZ B;  3RYI A;  5DCV A;  2ZVZ A;  4X3L A;  1H7M A;  5KMG B;  2Z01 A;  3HTN A;  4BT5 A;  3EOR A;  2CW4 A;  3MCA B;  5HP7 A;  2I6D A;  4ZI7 A;  2RHH A;  5HP8 A;  3J7A R;  4O4I B;  1YGY A;  1ODE A;  3U0O A;  3LWP C;  4C4W C;  1VQM F;  2L26 A;  2R75 1;  3ELC A;  4X1I A;  3TD5 A;  3JAW B;  5C8Y B;  3CPW F;  2ZOD A;  4BT4 A;  3VIU A;  2HP0 B;  4IHJ A;  2Z1E A;  5EAZ A;  3WGK A;  2ALE A;  1VH8 A;  1QVF F;  4DRX B;  2UYN B;  5IJ0 B;  1UI9 A;  1U40 A;  3VYS C;  4X3M A;  5MN5 A;  1TUB B;  3HWU A;  1IV1 A;  3E20 B;  1YJ9 F;  1W5F A;  1OFU A;  3RYI B;  4BT2 A;  2H8C A;  5JQG B;  4X20 A;  3N2G B;  1W5B A;  1W55 A;  4BW0 B;  2VAM A;  1XRG A;  5GON A;  3WGJ A;  3VMF B;  1W57 A;  3RA6 A;  4X1I B;  4ZHY B;  5LP6 C;  3CCQ F;  2HP0 A;  4IHJ B;  2QTP A;  2FGY A;  4O4I A;  2MQE A;  3D01 A;  3V4D A;  5CA1 A;  5EO3 A;  4G4Z A;  3RYC B;  3CMA F;  3R0P A;  2CHT A;  4ZHV A;  3JAS A;  3LWV C;  3DDN A;  4E6E A;  4IIJ A;  1YHQ F;  4C8I A;  4U39 A;  3VYU C;  1X7P A;  5BMV A;  3UT5 A;  2PHN A;  3CG6 A;  5MN6 A;  3CCJ F;  1U3P A;  2HS3 A;  3JAK A;  3JAL A;  1GX1 A;  2KTV A;  3IMP A;  5EZY A;  3VCZ A;  4O4L B;  3S06 A;  1QAH A;  5IYZ A;  5JVD A;  1J7H A;  5LA6 B;  3GTZ A;  3SIU A;  2UYN A;  1Q82 H;  3ON1 A;  4X1Y A;  1JN1 A;  3P4E A;  3FBA A;  4EI7 A;  2IAF A;  3MDO A;  4RHA A;  3RYH B;  1CN7 A;  1Z5W A;  5KX5 B;  4EI8 A;  2ZVY A;  2VXY A;  4LCK A;  4X1K A;  1FNJ A;  4I4T B;  1K73 H;  3CB2 A;  1QU9 A;  3HKD B;  3S0Y A;  5HY2 A;  3HKE A;  2HS0 A;  3LYB A;  1YIT F;  3F0D A;  3C9U A;  4EB6 A;  1UFY A;  1H47 A;  4FFB B;  3K0T A;  4BVS A;  1JFF B;  3FD6 A;  3E22 A;  3GYQ A;  1Q86 H;  4B45 A;  1FFX A;  3VOA A;  3G6E F;  1GO0 A;  1W41 A;  3ZP7 A;  1U43 A;  1IV4 A;  3O85 A;  1RQ2 A;  4YJ2 A;  3M84 A;  5FNV B;  3CPQ A;  3QHD A;  2QI2 A;  1JJ2 F;  1VQL F;  4LNU A;  2GVI A;  3I3F A;  2ZOV A;  1NMU B;  1X7O A;  2YYE A;  5J2T B;  3I7T A;  3JAL B;  5LA6 A;  1E7K A;  2HRU A;  4O4H B;  2PMP A;  4O4L A;  3PLA C;  4BVQ A;  3JAT A;  4O2B A;  4FFB A;  3CD6 F;  3HKE B;  3GHZ A;  5IJ0 A;  3RYH A;  1VQO F;  5HXU A;  5ITZ A;  4I4T A;  1W58 1; 
#chains in the Genus database with same CATH homology
 1VQN F;  3IR9 A;  2VGM A;  3V7Q A;  2LBX A;  4BW0 B;  3NK6 A;  1PXW A;  3N4Y A;  3J80 M;  4NUT A;  3VMF B;  3RA6 A;  3CCM F;  5G4U C;  1W40 A;  1K9M H;  3CCQ F;  3HJW C;  4EI9 A;  1VQ5 F;  2FGY A;  5EWR A;  3FFM A;  3CC4 F;  3CCE F;  4TZZ A;  5EO3 A;  1W42 A;  2VGN A;  2CZW A;  2WAL A;  3NK7 A;  3CMA F;  1VQP F;  1YIJ F;  1RLG A;  1IPA A;  1T0K B;  1W2B F;  3V7E A;  3CCR F;  3LWV C;  1VQ4 F;  2OHW A;  3OBY A;  4BY9 D;  1VQ6 F;  2OTL F;  1CK2 A;  1YHQ F;  3HAX D;  3PAF A;  3WXM B;  3OBW A;  1YJN F;  5HY4 A;  5IT9 M;  1X7P A;  3CG6 A;  5HWE A;  3CCJ F;  5FLX M;  3OW2 F;  3V3T A;  2KTV A;  1M1K H;  1VQ9 F;  1VQK F;  3N4Z A;  3CC2 F;  1KQS F;  5A2Q M;  3SIU A;  1YI2 F;  2JNB A;  2KTU A;  2AIF A;  3RA5 A;  3LWO C;  5GIO C;  1GZ0 A;  3ON1 A;  1Q7Y H;  1Q82 H;  1KC8 H;  1X52 A;  3NVI B;  4BVT A;  3CME F;  4NQ3 A;  1DT9 A;  4EI7 A;  3VI6 A;  1CN7 A;  4EI8 A;  2F9Z C;  4LCK A;  3CCS F;  1S72 F;  3LWR C;  5GIP C;  1K73 H;  3J81 M;  3I56 F;  2BO1 A;  2OTJ F;  5HY0 A;  1NJI H;  5FJ4 C;  5HY1 A;  5HY2 A;  3CXC F;  1YIT F;  1QVG F;  1RA4 A;  1K8A H;  5HXZ A;  3CCV F;  4BVS A;  1N8R H;  5DCV A;  3SIV A;  4X3L A;  3NVK E;  1H7M A;  1VQ8 F;  5GAN K;  3GYQ A;  2KG4 A;  1Q86 H;  3G6E F;  1GO0 A;  1W41 A;  1KD1 H;  1YJW F;  3O85 A;  1XBI A;  3I55 F;  2HVY D;  3MCA B;  2I6D A;  1GO1 A;  2OZB A;  3CPQ A;  5G4V C;  2QI2 A;  3G4S F;  1JJ2 F;  1VQL F;  1SDS A;  3J7A R;  3LWP C;  1NMU B;  3JCM M;  1X7O A;  1VQM F;  3CCU F;  1M90 H;  3NMU C;  4C4W C;  1Q81 H;  3CPW F;  1ZWZ A;  2QA4 F;  2ALE A;  3CC7 F;  1QVF F;  1E7K A;  3LFO A;  5GAP K;  3PLA C;  2FC3 A;  4BVQ A;  3CD6 F;  4X3M A;  3CCL F;  1W3E X;  3LWQ C;  3AGK A;  3E20 B;  3JAM M;  2QEX F;  1YJ9 F;  2GLZ A;  4XCQ A;  3D00 A;  4BVR A;  1VQO F;  2LBW A;  3E1Y A;  5HXU A;  3G71 F;  5GIN C;  1VQ7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...