1VQ9F

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq9F00
3NK7A 3VMFB 3CD6F 3VI6A 2I6DA 1ZWZA 3OBWA 5G4VC 5IT9M 3N4ZA 5FLXM 3NMUC 3OBYA 3MCAB 2QA4F 2CZWA 2JNBA 2WALA 1VQMF 1VQPF 1NMUB 3E20B 3HAXD 3O85A 2KTVA 3I56F 1E7KA 1N8RH 2HVYD 1XBIA 3CCEF 4C4WC 3RA6A 2KTUA 3NVKE 1KC8H 5GINC 3V7EA 1YIJF 5DCVA 3RA5A 4TZZA 3CCJF 4NUTA 1W41A 3E1YA 1X52A 5EWRA 2ALEA 2FC3A 1VQOF 3LWVC 3OW2F 1Q86H 1VQ7F 4LCKA 2QEXF 2VGMA 1T0KB 3HJWC 3SIVA 3CCUF 3LFOA 1VQ5F 3LWQC 1W3EX 1VQLF 3SIUA 1X7OA 3FFMA 1QVFF 1W2BF 3CCSF 1GZ0A 4BW0B 3CCVF 3ON1A 3PLAC 1W42A 1KQSF 1GO1A 2OHWA 3J80M 3CG6A 1CK2A 1VQ8F 3J7AR 1RLGA 3JCMM 3G6EF 3WXMB 1Q82H 1K8AH 1Q81H 2OTJF 3JAMM 3CPWF 3CCQF 1YI2F 1GO0A 3CPQA 1W40A 3CC2F 3PAFA 5G4UC 1PXWA 3J81M 1K9MH 4X3MA 5GIPC 1CN7A 1X7PA 1YJNF 2BO1A 3G71F 1YJWF 1KD1H 2OTLF 1VQNF 1NJIH 2VGNA 1S72F 3G4SF 3N4YA 1DT9A 3CMEF 5GIOC 1VQKF 1JJ2F 2OZBA 5GAPK 1K73H 3CC7F 4X3LA 5GANK 3CCMF 2QI2A 1VQ9F 3CC4F 1IPAA 3NK6A 5FJ4C 1M1KH 3NVIB 1QVGF 3GYQA 5EO3A 2AIFA 3CMAF 1H7MA 3LWOC 3CCRF 2LBXA 3I55F 3CXCF 4BY9D 3IR9A 1VQ4F 1SDSA 1YJ9F 1VQ6F 3CCLF 1M90H 2KG4A 1Q7YH 5A2QM 2LBWA 3AGKA 3LWRC 3LWPC 1YHQF 1RA4A 1YITF 3V7QA
chains in the Genus database with same CATH superfamily
3JATA 3HWUA 4G4ZA 3E22B 3ZO8A 2I6DA 5IT9M 5HXUA 3WGLA 3OBYA 4PWTA 2CZWA 2JNBA 2AMTA 1NMUB 2NMUA 3E20B 3KIZA 3VYTC 2KTVA 3RA6A 1W5EA 4B46A 1KC8H 5FNVA 3WPXA 1JFFA 5JH7A 4NUTA 5CA0B 1X52A 2ALEA 3HKEB 3D54A 5LYJB 3JARB 2PMPA 3P4EA 1COMA 1PF5A 3RYIB 5EYPA 4X20A 1FNKA 2ZOVA 3TD5A 4NQ3A 5LXTB 4DXDA 4DRXA 1X7OA 3FFMA 3MDOA 1U40A 2KGWA 4I55A 3GTZA 5HWEA 1GZ0A 4BW0B 1J7HA 3PLAC 4ZI7A 4EI8A 5IJ0B 3ZP4A 3J80M 1CK2A 3VTIC 4BT3A 1RLGA 4FFBA 4X1KB 1Q81H 2OTJF 3FD5A 3JAKA 3JAMM 3CPWF 1YI2F 1GO0A 3PAFA 5C8YA 3UT5A 1IV4A 2H8CA 2HP0A 2Z01A 4X3MA 1CN7A 1YJNF 3LYBA 1TUBB 1S72F 2HS0A 2IG8A 2K1SA 3FBAA 2UZHA 5GIOC 3QTYA 1JJ2F 3I3FA 4TUYB 3VIUA 4RHAA 4O4IB 5EB1B 4HNAB 3B6NA 3TD4A 1IPAA 3L7QA 5FJ4C 3JALA 2GLZA 1UI9A 5LP6C 3HKEA 5LYJA 2BTQB 3JARA 3S06A 2AIFA 5KX5B 3CMAF 4BVQA 2YYEA 3M84A 4M8IA 4RQOA 2IQQA 3F0EA 4C8EA 3IR9A 4YJ2B 1VQ4F 2CHSA 3KE1A 3S0WA 1M90H 1Q7YH 3CYPB 5EIBD 3S0HA 1W59A 4ZOLB 2HRUA 4U39A 3KJKA 4C81A 1YHQF 4TV9A 2OTMA 5JCOC 2BTOA 3V7QA 4O2BA 2UYNB 3JAWA 4O4HB 3VMFB 2HP3A 3VI6A 5G4VC 3OBWA 3WGJA 3HKDA 3N4ZA 2AIZP 3WJRA 5IJ9B 5GONA 1JD1A 3RYHA 3VOAA 4B5CA 4C8GA 3MCAB 4ZHQA 2QA4F 2WALA 3HKBB 4TV8B 1VQPF 2CVLA 5JVDB 4B62A 5MN4A 1E7KA 5CB4B 1W5BA 1XBIA 3NVKE 1XV2A 3V7EA 4U3JA 2HQSC 5MN5A 2HS3A 4ZHYB 2IAFA 3VYUC 5HY4A 5LA6A 1VQOF 2HX0A 1SA0B 3OW2F 4BT5A 2VXYA 3LMEA 3N2KB 4IIJA 5CA1A 4LNUA 1JY8A 2I6RA 5IYZB 4G4XA 1W3EX 1QVFF 1W2BF 4X1YA 4O4JB 2LBTA 3JASB 5LP6A 5JQGA 5LOVB 4WBNA 3CCVF 3ON1A 5ITZB 3IEWA 1KQSF 2OHWA 3VO8A 1VQ8F 1TVKA 4BVRA 3C9RA 1X25A 3JCMM 1VHAA 3BYQA 5B8FA 3G6EF 1Q82H 3N2GB 1W40A 1H48A 3CC2F 1OAPA 4BVTA 1PXWA 3ESJA 5J2TA 3P10A 5GIPC 1X7PA 3V4DA 3G71F 4F6RB 1KD1H 5JCOA 4TV8A 4X1IB 4ZHVA 2H8EA 4BT7A 1QU9A 3C9SA 3FPIA 3GHZA 4O4LB 3F0DA 2QTPA 3WGMA 3CC7F 5GANK 3CCMF 1FFXB 2QI2A 3V3TA 4I4TA 2RHOA 2Z1EA 5HY1A 4ZK7A 1VQVA 5BMVB 1JN1A 1M1KH 2H6LA 1VK3A 1SA0A 2CSLA 5EAZA 2Z1FA 3HKCA 3RYCB 1XRGA 2EWCA 1H7MA 3E22A 3LWOC 2LBXA 2UYPA 5EIBC 2ZVZA 2LCAA 2V9YA 4IHJB 4O2AB 3CCLF 2KG4A 2UYJA 1W5AA 5A2QM 1QD9A 3LWPC 1U3PA 4ZHWA 2Z1UA 5ITZA 1Z5VA 4EI7A 3K12A 2HRYA 2PHNA 3CD6F 5CA0A 1ZWZA 3RYFB 2Q1XA 2HS4A 3NMUC 4YJ3B 4KWEA 2P6YA 3ZP7A 3RYIA 3HAXD 1XHOA 3O85A 3I56F 3ELCA 1N8RH 2HVYD 2VAWA 1IV2A 2FGYA 5LXTA 5MN6A 2KTUA 2CHTA 3WGNA 5GINC 3S03A 3WPWA 1ODEA 2ZAUA 2ZF8A 3JATB 1R1MA 3RA5A 4TZZA 3CCJF 1W41A 1CLIA 3E1YA 5EWRA 1VH8A 3MCQA 1KNJA 3LWVC 1Q86H 1IV1A 5IJ0A 3ERNA 3S02A 2VGMA 5J2UB 4X1KA 3WJPA 1T0KB 3SIVA 4B45A 3CCUF 3LWQC 3Q8HA 2VAMA 5FNVB 2Q1YA 3D01A 1VQLF 3SIUA 1W5FA 3LDTA 1UFYA 1JFFB 1RQ7A 1TUBA 4XCQA 2ZODA 5JH7B 1RQ2A 4G4WA 4G4YA 1W42A 4C8IA 1GO1A 1H47A 3CYQA 3VYSC 2RB9A 4I50B 3CB2A 4TUYA 3J7AR 4E6EA 1K8AH 5EYPB 2UYKA 4R40B 4O4IA 4X20B 3CCQF 5AVMA 4EB6B 4HNAA 3CPQA 4BT6A 2RHHA 3IKFA 5HP7A 3J81M 3KHNA 2YXZA 2BO1A 5HY0A 2OTLF 4I55B 2L26A 4YJ3A 1NJIH 5KX5A 2VGNA 5EZYB 4ZI7B 3CMEF 4YJ2A 3P0ZA 5GAPK 2RHJA 4FFBB 4X3LA 3JAKB 2DT4A 4ZOLA 1W57A 1VQ9F 3TD3A 5C8YB 3I7TA 3CC4F 3UT5B 1T0AA 1NQ3A 2HP0B 3NVIB 3HTNA 3GYQA 2UYNA 1RLUA 3EORA 2R751 4O4HA 3CCRF 3DC2A 3U0OA 5J2UA 3I55F 5IJ9A 3RE3A 3CXCF 4G88A 1SDSA 3HKBA 5HY2A 5JVDA 2G9IA 5EB0A 4BT4A 2LBWA 5CB4A 2BTUA 3JALB 1Z5WA 3MQWA 3NK7A 2R6R1 4I50A 2W8BC 3F0GA 5FLXM 5KMGB 4EB6A 5HXZA 1FNJA 3VCZA 3N2KA 2DYYA 1VQMF 3F0FA 5IYZA 3KJJA 3CCEF 4C4WC 1QAHA 3WJQA 3OONA 4G4VA 4TV9B 5EZYA 2B33A 1YIJF 4O2BB 4O4JA 3JASA 3JAWB 5LOVA 5DCVA 4BT2A 2Z1TA 3HKDB 4EI9A 2FC3A 1OFUA 3VOBA 5GONB 3RYHB 4ZHQB 1VQ7F 4LCKA 1SZQA 2QEXF 1U43A 3K2XA 1YQNA 3IEQA 3HJWC 3C8LA 3N2GA 3K0TA 3LFOA 3IMPA 3T80A 1VQ5F 4ERHA 1W581 3M4SA 1U3LA 4U3JB 3ZOPA 4F6RA 3CCSF 3C9TA 3MBMA 2CWJA 4X1IA 2GVIA 5LA6B 2VAPA 3QUWA 2GZLA 3CG6A 4IIJB 4O4LA 4BVSA 2MQEA 3DDNA 5CA1B 4LNUB 3WXMB 1Q8RA 1FSZA 1FFXA 4C82A 5G4UC 2N48A 5BMVA 1K9MH 3QHDA 1YJWF 5KMGA 4X1YB 3RYCA 5LP6B 5JQGB 1VQNF 4WBNB 1ONIA 3G4SF 1W55A 3N4YA 1DT9A 3FD6A 3M1XA 3D00A 3JVHA 1VQKF 2OZBA 4NWOB 1TVKB 3F6MA 4O2AA 4IHJA 1K73H 2CW4A 1YGYA 3R0PA 2ZVYA 3NK6A 5J2TB 1QVGF 5EO3A 4DRXB 2RHLA 3WGKA 1KNKA 3RYFA 1DBFA 3C9UA 4BY9D 2F9ZC 1YJ9F 1VQ6F 1IV3A 3S0YA 3K14A 3AGKA 3LWRC 4I4TB 3IKEA 1RA4A 1YITF 1GX1A 3HKCB 5HP8A
chains in the Genus database with same CATH topology
3NK7A 3VMFB 3CD6F 3VI6A 2I6DA 1ZWZA 3OBWA 5HXUA 5G4VC 3N4ZA 5IT9M 5FLXM 3NMUC 3OBYA 5HXZA 3MCAB 2QA4F 2CZWA 2JNBA 2WALA 1VQMF 1VQPF 1NMUB 3E20B 3HAXD 3O85A 2KTVA 3I56F 1E7KA 1N8RH 2HVYD 1XBIA 2FGYA 3CCEF 3RA6A 4C4WC 2KTUA 3NVKE 1KC8H 5GINC 3V7EA 1YIJF 5DCVA 3RA5A 4TZZA 3CCJF 4NUTA 1W41A 3E1YA 1X52A 5EWRA 2ALEA 5HY4A 4EI9A 2FC3A 1VQOF 3LWVC 3OW2F 1Q86H 1VQ7F 4LCKA 2QEXF 2VGMA 1T0KB 3HJWC 4NQ3A 3SIVA 3CCUF 3LFOA 1VQ5F 3LWQC 1W3EX 1VQLF 3SIUA 1X7OA 3FFMA 1QVFF 1W2BF 4XCQA 3CCSF 5HWEA 1GZ0A 4BW0B 3CCVF 3ON1A 3PLAC 1W42A 1KQSF 1GO1A 4EI8A 2OHWA 3J80M 3CG6A 1CK2A 4BVSA 1VQ8F 4BVRA 3J7AR 1RLGA 3JCMM 3G6EF 3WXMB 1Q82H 1K8AH 1Q81H 2OTJF 3JAMM 3CPWF 3CCQF 1YI2F 1GO0A 3CPQA 1W40A 3CC2F 3PAFA 5G4UC 4BVTA 1PXWA 3J81M 1K9MH 4X3MA 5GIPC 1CN7A 1X7PA 1YJNF 2BO1A 3G71F 1YJWF 5HY0A 1KD1H 2OTLF 1VQNF 1NJIH 2VGNA 1S72F 3G4SF 3N4YA 1DT9A 3D00A 3CMEF 5GIOC 1VQKF 1JJ2F 2OZBA 5GAPK 1K73H 3CC7F 4X3LA 5GANK 3CCMF 2QI2A 1VQ9F 3V3TA 3CC4F 5HY1A 1IPAA 3NK6A 5FJ4C 1M1KH 2GLZA 3NVIB 1QVGF 3GYQA 5EO3A 2AIFA 3CMAF 4BVQA 1H7MA 3LWOC 3CCRF 2LBXA 3I55F 3CXCF 4BY9D 3IR9A 2F9ZC 1VQ4F 1SDSA 1YJ9F 1VQ6F 5HY2A 3CCLF 1M90H 2KG4A 1Q7YH 5A2QM 2LBWA 3AGKA 3LWRC 3LWPC 1YHQF 1RA4A 1YITF 4EI7A 3V7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK7 A;  3VMF B;  3CD6 F;  3VI6 A;  2I6D A;  1ZWZ A;  3OBW A;  5G4V C;  5IT9 M;  3N4Z A;  5FLX M;  3NMU C;  3OBY A;  3MCA B;  2QA4 F;  2CZW A;  2JNB A;  2WAL A;  1VQM F;  1VQP F;  1NMU B;  3E20 B;  3HAX D;  3O85 A;  2KTV A;  3I56 F;  1E7K A;  1N8R H;  2HVY D;  1XBI A;  3CCE F;  4C4W C;  3RA6 A;  2KTU A;  3NVK E;  1KC8 H;  5GIN C;  3V7E A;  1YIJ F;  5DCV A;  3RA5 A;  4TZZ A;  3CCJ F;  4NUT A;  1W41 A;  3E1Y A;  1X52 A;  5EWR A;  2ALE A;  2FC3 A;  1VQO F;  3LWV C;  3OW2 F;  1Q86 H;  1VQ7 F;  4LCK A;  2QEX F;  2VGM A;  1T0K B;  3HJW C;  3SIV A;  3CCU F;  3LFO A;  1VQ5 F;  3LWQ C;  1W3E X;  1VQL F;  3SIU A;  1X7O A;  3FFM A;  1QVF F;  1W2B F;  3CCS F;  1GZ0 A;  4BW0 B;  3CCV F;  3ON1 A;  3PLA C;  1W42 A;  1KQS F;  1GO1 A;  2OHW A;  3J80 M;  3CG6 A;  1CK2 A;  1VQ8 F;  3J7A R;  1RLG A;  3JCM M;  3G6E F;  3WXM B;  1Q82 H;  1K8A H;  1Q81 H;  2OTJ F;  3JAM M;  3CPW F;  3CCQ F;  1YI2 F;  1GO0 A;  3CPQ A;  1W40 A;  3CC2 F;  3PAF A;  5G4U C;  1PXW A;  3J81 M;  1K9M H;  4X3M A;  5GIP C;  1CN7 A;  1X7P A;  1YJN F;  2BO1 A;  3G71 F;  1YJW F;  1KD1 H;  2OTL F;  1VQN F;  1NJI H;  2VGN A;  1S72 F;  3G4S F;  3N4Y A;  1DT9 A;  3CME F;  5GIO C;  1VQK F;  1JJ2 F;  2OZB A;  5GAP K;  1K73 H;  3CC7 F;  4X3L A;  5GAN K;  3CCM F;  2QI2 A;  1VQ9 F;  3CC4 F;  1IPA A;  3NK6 A;  5FJ4 C;  1M1K H;  3NVI B;  1QVG F;  3GYQ A;  5EO3 A;  2AIF A;  3CMA F;  1H7M A;  3LWO C;  3CCR F;  2LBX A;  3I55 F;  3CXC F;  4BY9 D;  3IR9 A;  1VQ4 F;  1SDS A;  1YJ9 F;  1VQ6 F;  3CCL F;  1M90 H;  2KG4 A;  1Q7Y H;  5A2Q M;  2LBW A;  3AGK A;  3LWR C;  3LWP C;  1YHQ F;  1RA4 A;  1YIT F;  3V7Q A; 
#chains in the Genus database with same CATH topology
 3JAT A;  3HWU A;  4G4Z A;  3E22 B;  3ZO8 A;  2I6D A;  5IT9 M;  5HXU A;  3WGL A;  3OBY A;  4PWT A;  2CZW A;  2JNB A;  2AMT A;  1NMU B;  2NMU A;  3E20 B;  3KIZ A;  3VYT C;  2KTV A;  3RA6 A;  1W5E A;  4B46 A;  1KC8 H;  5FNV A;  3WPX A;  1JFF A;  5JH7 A;  4NUT A;  5CA0 B;  1X52 A;  2ALE A;  3HKE B;  3D54 A;  5LYJ B;  3JAR B;  2PMP A;  3P4E A;  1COM A;  1PF5 A;  3RYI B;  5EYP A;  4X20 A;  1FNK A;  2ZOV A;  3TD5 A;  4NQ3 A;  5LXT B;  4DXD A;  4DRX A;  1X7O A;  3FFM A;  3MDO A;  1U40 A;  2KGW A;  4I55 A;  3GTZ A;  5HWE A;  1GZ0 A;  4BW0 B;  1J7H A;  3PLA C;  4ZI7 A;  4EI8 A;  5IJ0 B;  3ZP4 A;  3J80 M;  1CK2 A;  3VTI C;  4BT3 A;  1RLG A;  4FFB A;  4X1K B;  1Q81 H;  2OTJ F;  3FD5 A;  3JAK A;  3JAM M;  3CPW F;  1YI2 F;  1GO0 A;  3PAF A;  5C8Y A;  3UT5 A;  1IV4 A;  2H8C A;  2HP0 A;  2Z01 A;  4X3M A;  1CN7 A;  1YJN F;  3LYB A;  1TUB B;  1S72 F;  2HS0 A;  2IG8 A;  2K1S A;  3FBA A;  2UZH A;  5GIO C;  3QTY A;  1JJ2 F;  3I3F A;  4TUY B;  3VIU A;  4RHA A;  4O4I B;  5EB1 B;  4HNA B;  3B6N A;  3TD4 A;  1IPA A;  3L7Q A;  5FJ4 C;  3JAL A;  2GLZ A;  1UI9 A;  5LP6 C;  3HKE A;  5LYJ A;  2BTQ B;  3JAR A;  3S06 A;  2AIF A;  5KX5 B;  3CMA F;  4BVQ A;  2YYE A;  3M84 A;  4M8I A;  4RQO A;  2IQQ A;  3F0E A;  4C8E A;  3IR9 A;  4YJ2 B;  1VQ4 F;  2CHS A;  3KE1 A;  3S0W A;  1M90 H;  1Q7Y H;  3CYP B;  5EIB D;  3S0H A;  1W59 A;  4ZOL B;  2HRU A;  4U39 A;  3KJK A;  4C81 A;  1YHQ F;  4TV9 A;  2OTM A;  5JCO C;  2BTO A;  3V7Q A;  4O2B A;  2UYN B;  3JAW A;  4O4H B;  3VMF B;  2HP3 A;  3VI6 A;  5G4V C;  3OBW A;  3WGJ A;  3HKD A;  3N4Z A;  2AIZ P;  3WJR A;  5IJ9 B;  5GON A;  1JD1 A;  3RYH A;  3VOA A;  4B5C A;  4C8G A;  3MCA B;  4ZHQ A;  2QA4 F;  2WAL A;  3HKB B;  4TV8 B;  1VQP F;  2CVL A;  5JVD B;  4B62 A;  5MN4 A;  1E7K A;  5CB4 B;  1W5B A;  1XBI A;  3NVK E;  1XV2 A;  3V7E A;  4U3J A;  2HQS C;  5MN5 A;  2HS3 A;  4ZHY B;  2IAF A;  3VYU C;  5HY4 A;  5LA6 A;  1VQO F;  2HX0 A;  1SA0 B;  3OW2 F;  4BT5 A;  2VXY A;  3LME A;  3N2K B;  4IIJ A;  5CA1 A;  4LNU A;  1JY8 A;  2I6R A;  5IYZ B;  4G4X A;  1W3E X;  1QVF F;  1W2B F;  4X1Y A;  4O4J B;  2LBT A;  3JAS B;  5LP6 A;  5JQG A;  5LOV B;  4WBN A;  3CCV F;  3ON1 A;  5ITZ B;  3IEW A;  1KQS F;  2OHW A;  3VO8 A;  1VQ8 F;  1TVK A;  4BVR A;  3C9R A;  1X25 A;  3JCM M;  1VHA A;  3BYQ A;  5B8F A;  3G6E F;  1Q82 H;  3N2G B;  1W40 A;  1H48 A;  3CC2 F;  1OAP A;  4BVT A;  1PXW A;  3ESJ A;  5J2T A;  3P10 A;  5GIP C;  1X7P A;  3V4D A;  3G71 F;  4F6R B;  1KD1 H;  5JCO A;  4TV8 A;  4X1I B;  4ZHV A;  2H8E A;  4BT7 A;  1QU9 A;  3C9S A;  3FPI A;  3GHZ A;  4O4L B;  3F0D A;  2QTP A;  3WGM A;  3CC7 F;  5GAN K;  3CCM F;  1FFX B;  2QI2 A;  3V3T A;  4I4T A;  2RHO A;  2Z1E A;  5HY1 A;  4ZK7 A;  1VQV A;  5BMV B;  1JN1 A;  1M1K H;  2H6L A;  1VK3 A;  1SA0 A;  2CSL A;  5EAZ A;  2Z1F A;  3HKC A;  3RYC B;  1XRG A;  2EWC A;  1H7M A;  3E22 A;  3LWO C;  2LBX A;  2UYP A;  5EIB C;  2ZVZ A;  2LCA A;  2V9Y A;  4IHJ B;  4O2A B;  3CCL F;  2KG4 A;  2UYJ A;  1W5A A;  5A2Q M;  1QD9 A;  3LWP C;  1U3P A;  4ZHW A;  2Z1U A;  5ITZ A;  1Z5V A;  4EI7 A;  3K12 A;  2HRY A;  2PHN A;  3CD6 F;  5CA0 A;  1ZWZ A;  3RYF B;  2Q1X A;  2HS4 A;  3NMU C;  4YJ3 B;  4KWE A;  2P6Y A;  3ZP7 A;  3RYI A;  3HAX D;  1XHO A;  3O85 A;  3I56 F;  3ELC A;  1N8R H;  2HVY D;  2VAW A;  1IV2 A;  2FGY A;  5LXT A;  5MN6 A;  2KTU A;  2CHT A;  3WGN A;  5GIN C;  3S03 A;  3WPW A;  1ODE A;  2ZAU A;  2ZF8 A;  3JAT B;  1R1M A;  3RA5 A;  4TZZ A;  3CCJ F;  1W41 A;  1CLI A;  3E1Y A;  5EWR A;  1VH8 A;  3MCQ A;  1KNJ A;  3LWV C;  1Q86 H;  1IV1 A;  5IJ0 A;  3ERN A;  3S02 A;  2VGM A;  5J2U B;  4X1K A;  3WJP A;  1T0K B;  3SIV A;  4B45 A;  3CCU F;  3LWQ C;  3Q8H A;  2VAM A;  5FNV B;  2Q1Y A;  3D01 A;  1VQL F;  3SIU A;  1W5F A;  3LDT A;  1UFY A;  1JFF B;  1RQ7 A;  1TUB A;  4XCQ A;  2ZOD A;  5JH7 B;  1RQ2 A;  4G4W A;  4G4Y A;  1W42 A;  4C8I A;  1GO1 A;  1H47 A;  3CYQ A;  3VYS C;  2RB9 A;  4I50 B;  3CB2 A;  4TUY A;  3J7A R;  4E6E A;  1K8A H;  5EYP B;  2UYK A;  4R40 B;  4O4I A;  4X20 B;  3CCQ F;  5AVM A;  4EB6 B;  4HNA A;  3CPQ A;  4BT6 A;  2RHH A;  3IKF A;  5HP7 A;  3J81 M;  3KHN A;  2YXZ A;  2BO1 A;  5HY0 A;  2OTL F;  4I55 B;  2L26 A;  4YJ3 A;  1NJI H;  5KX5 A;  2VGN A;  5EZY B;  4ZI7 B;  3CME F;  4YJ2 A;  3P0Z A;  5GAP K;  2RHJ A;  4FFB B;  4X3L A;  3JAK B;  2DT4 A;  4ZOL A;  1W57 A;  1VQ9 F;  3TD3 A;  5C8Y B;  3I7T A;  3CC4 F;  3UT5 B;  1T0A A;  1NQ3 A;  2HP0 B;  3NVI B;  3HTN A;  3GYQ A;  2UYN A;  1RLU A;  3EOR A;  2R75 1;  4O4H A;  3CCR F;  3DC2 A;  3U0O A;  5J2U A;  3I55 F;  5IJ9 A;  3RE3 A;  3CXC F;  4G88 A;  1SDS A;  3HKB A;  5HY2 A;  5JVD A;  2G9I A;  5EB0 A;  4BT4 A;  2LBW A;  5CB4 A;  2BTU A;  3JAL B;  1Z5W A;  3MQW A;  3NK7 A;  2R6R 1;  4I50 A;  2W8B C;  3F0G A;  5FLX M;  5KMG B;  4EB6 A;  5HXZ A;  1FNJ A;  3VCZ A;  3N2K A;  2DYY A;  1VQM F;  3F0F A;  5IYZ A;  3KJJ A;  3CCE F;  4C4W C;  1QAH A;  3WJQ A;  3OON A;  4G4V A;  4TV9 B;  5EZY A;  2B33 A;  1YIJ F;  4O2B B;  4O4J A;  3JAS A;  3JAW B;  5LOV A;  5DCV A;  4BT2 A;  2Z1T A;  3HKD B;  4EI9 A;  2FC3 A;  1OFU A;  3VOB A;  5GON B;  3RYH B;  4ZHQ B;  1VQ7 F;  4LCK A;  1SZQ A;  2QEX F;  1U43 A;  3K2X A;  1YQN A;  3IEQ A;  3HJW C;  3C8L A;  3N2G A;  3K0T A;  3LFO A;  3IMP A;  3T80 A;  1VQ5 F;  4ERH A;  1W58 1;  3M4S A;  1U3L A;  4U3J B;  3ZOP A;  4F6R A;  3CCS F;  3C9T A;  3MBM A;  2CWJ A;  4X1I A;  2GVI A;  5LA6 B;  2VAP A;  3QUW A;  2GZL A;  3CG6 A;  4IIJ B;  4O4L A;  4BVS A;  2MQE A;  3DDN A;  5CA1 B;  4LNU B;  3WXM B;  1Q8R A;  1FSZ A;  1FFX A;  4C82 A;  5G4U C;  2N48 A;  5BMV A;  1K9M H;  3QHD A;  1YJW F;  5KMG A;  4X1Y B;  3RYC A;  5LP6 B;  5JQG B;  1VQN F;  4WBN B;  1ONI A;  3G4S F;  1W55 A;  3N4Y A;  1DT9 A;  3FD6 A;  3M1X A;  3D00 A;  3JVH A;  1VQK F;  2OZB A;  4NWO B;  1TVK B;  3F6M A;  4O2A A;  4IHJ A;  1K73 H;  2CW4 A;  1YGY A;  3R0P A;  2ZVY A;  3NK6 A;  5J2T B;  1QVG F;  5EO3 A;  4DRX B;  2RHL A;  3WGK A;  1KNK A;  3RYF A;  1DBF A;  3C9U A;  4BY9 D;  2F9Z C;  1YJ9 F;  1VQ6 F;  1IV3 A;  3S0Y A;  3K14 A;  3AGK A;  3LWR C;  4I4T B;  3IKE A;  1RA4 A;  1YIT F;  1GX1 A;  3HKC B;  5HP8 A; 
#chains in the Genus database with same CATH homology
 3NK7 A;  3VMF B;  3CD6 F;  3VI6 A;  2I6D A;  1ZWZ A;  3OBW A;  5HXU A;  5G4V C;  3N4Z A;  5IT9 M;  5FLX M;  3NMU C;  3OBY A;  5HXZ A;  3MCA B;  2QA4 F;  2CZW A;  2JNB A;  2WAL A;  1VQM F;  1VQP F;  1NMU B;  3E20 B;  3HAX D;  3O85 A;  2KTV A;  3I56 F;  1E7K A;  1N8R H;  2HVY D;  1XBI A;  2FGY A;  3CCE F;  3RA6 A;  4C4W C;  2KTU A;  3NVK E;  1KC8 H;  5GIN C;  3V7E A;  1YIJ F;  5DCV A;  3RA5 A;  4TZZ A;  3CCJ F;  4NUT A;  1W41 A;  3E1Y A;  1X52 A;  5EWR A;  2ALE A;  5HY4 A;  4EI9 A;  2FC3 A;  1VQO F;  3LWV C;  3OW2 F;  1Q86 H;  1VQ7 F;  4LCK A;  2QEX F;  2VGM A;  1T0K B;  3HJW C;  4NQ3 A;  3SIV A;  3CCU F;  3LFO A;  1VQ5 F;  3LWQ C;  1W3E X;  1VQL F;  3SIU A;  1X7O A;  3FFM A;  1QVF F;  1W2B F;  4XCQ A;  3CCS F;  5HWE A;  1GZ0 A;  4BW0 B;  3CCV F;  3ON1 A;  3PLA C;  1W42 A;  1KQS F;  1GO1 A;  4EI8 A;  2OHW A;  3J80 M;  3CG6 A;  1CK2 A;  4BVS A;  1VQ8 F;  4BVR A;  3J7A R;  1RLG A;  3JCM M;  3G6E F;  3WXM B;  1Q82 H;  1K8A H;  1Q81 H;  2OTJ F;  3JAM M;  3CPW F;  3CCQ F;  1YI2 F;  1GO0 A;  3CPQ A;  1W40 A;  3CC2 F;  3PAF A;  5G4U C;  4BVT A;  1PXW A;  3J81 M;  1K9M H;  4X3M A;  5GIP C;  1CN7 A;  1X7P A;  1YJN F;  2BO1 A;  3G71 F;  1YJW F;  5HY0 A;  1KD1 H;  2OTL F;  1VQN F;  1NJI H;  2VGN A;  1S72 F;  3G4S F;  3N4Y A;  1DT9 A;  3D00 A;  3CME F;  5GIO C;  1VQK F;  1JJ2 F;  2OZB A;  5GAP K;  1K73 H;  3CC7 F;  4X3L A;  5GAN K;  3CCM F;  2QI2 A;  1VQ9 F;  3V3T A;  3CC4 F;  5HY1 A;  1IPA A;  3NK6 A;  5FJ4 C;  1M1K H;  2GLZ A;  3NVI B;  1QVG F;  3GYQ A;  5EO3 A;  2AIF A;  3CMA F;  4BVQ A;  1H7M A;  3LWO C;  3CCR F;  2LBX A;  3I55 F;  3CXC F;  4BY9 D;  3IR9 A;  2F9Z C;  1VQ4 F;  1SDS A;  1YJ9 F;  1VQ6 F;  5HY2 A;  3CCL F;  1M90 H;  2KG4 A;  1Q7Y H;  5A2Q M;  2LBW A;  3AGK A;  3LWR C;  3LWP C;  1YHQ F;  1RA4 A;  1YIT F;  4EI7 A;  3V7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...