1VQ9F

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq9F00
3GYQA 1ZWZA 5GINC 3CXCF 1NMUB 2ALEA 1KC8H 2QA4F 1NJIH 5DCVA 3ON1A 1IPAA 1K8AH 4NUTA 1XBIA 2OZBA 1DT9A 1W40A 2OTLF 3NK7A 1YITF 1YJWF 3CPQA 1YJ9F 3OBYA 1VQPF 5IT9M 2OHWA 3CD6F 1VQ4F 5A2QM 4X3LA 4X3MA 3CCMF 1W2BF 1QVFF 3CCQF 3SIUA 3J7AR 3LFOA 1GO1A 2LBXA 1VQNF 2QI2A 3NVKE 3CMEF 3AGKA 1QVGF 1VQ8F 2LBWA 5GIPC 1RLGA 3V7EA 2KG4A 4LCKA 3OBWA 1PXWA 1W41A 2KTUA 5GANK 1Q82H 3IR9A 2VGNA 2OTJF 3CG6A 3NVIB 5FJ4C 1E7KA 5G4UC 3CC4F 3E1YA 2AIFA 1KD1H 1T0KB 3JCMM 4BY9D 1W3EX 1VQ7F 3J80M 1W42A 5FLXM 3OW2F 1X7OA 3CCJF 3HAXD 1X7PA 3RA6A 3SIVA 3CCUF 1CK2A 2KTVA 3CC2F 1SDSA 3E20B 3J81M 1YJNF 3CCLF 2WALA 3O85A 3FFMA 5G4VC 3CCRF 1VQ5F 2JNBA 2HVYD 3NMUC 1S72F 1X52A 3RA5A 3LWRC 3LWOC 3CCSF 2BO1A 3PLAC 2CZWA 1GZ0A 5EO3A 3N4YA 1Q81H 3G6EF 1VQLF 3VMFB 5GIOC 1M90H 5EWRA 2VGMA 1VQOF 4C4WC 3MCAB 1K73H 1VQ6F 1H7MA 3CCEF 1Q7YH 1CN7A 3JAMM 1YIJF 3HJWC 3I55F 3G71F 3CPWF 1YHQF 3CMAF 1JJ2F 3NK6A 1YI2F 5GAPK 2FC3A 1VQMF 3G4SF 4TZZA 1K9MH 1KQSF 4BW0B 2I6DA 1N8RH 3CC7F 3V7QA 1GO0A 3CCVF 1RA4A 3LWPC 3LWVC 3WXMB 2QEXF 1VQ9F 3PAFA 1VQKF 1M1KH 3VI6A 1Q86H 3LWQC 3I56F 3N4ZA
chains in the Genus database with same CATH superfamily
3CXCF 4RQOA 5MN5A 4E6EA 4KWEA 1SZQA 2ALEA 2QTPA 3N2KA 3DDNA 4O4IB 2HP0A 3WJRA 4TV9B 4O2AA 1UFYA 1IPAA 4NUTA 4BVRA 1W40A 5EYPA 3LMEA 2PMPA 3CPQA 1YJWF 3FPIA 4X1KB 3JASB 2GLZA 1JFFB 4X20A 1QD9A 2Z1EA 2L26A 3IMPA 5LP6A 3KJJA 3CCMF 5B8FA 2Z1UA 3TD4A 1QVFF 2LBTA 2IQQA 2YXZA 1TUBA 2HP3A 3ERNA 4X1IB 4B45A 4BT6A 3WJPA 4XCQA 2QI2A 1IV2A 3CMEF 2HQSC 3AGKA 3ZP7A 1PF5A 2KG4A 3S03A 2UYPA 3OBWA 3E22B 4LCKA 3IR9A 3JATA 1NQ3A 5KMGB 5G4UC 1ODEA 1KD1H 3KJKA 3JCMM 5IJ9A 3J80M 2RHJA 3K2XA 1Z5VA 3HAXD 1X7PA 2EWCA 2MQEA 3CCUF 3SIVA 3RYCB 3JVHA 2CVLA 3MDOA 5J2TA 3QHDA 3J81M 2WALA 3S0WA 4IIJB 1SA0A 3RA5A 3LWRC 1YQNA 4BT2A 1W581 3K12A 5EAZA 3HKEB 5LYJA 3F0GA 4LNUA 5IYZA 1GX1A 1W5AA 3N4YA 5HXUA 2B33A 1IV3A 3I3FA 5EWRA 2Q1XA 5CA1A 1OFUA 1W5FA 4HNAA 4I50B 3WGJA 3MCAB 1Z5WA 1VQ6F 1OAPA 5KX5A 1H7MA 2HS3A 3JARA 4BT7A 2UYNB 4U39A 4C8EA 3G71F 2HS0A 3CPWF 3S06A 1YHQF 4O4LA 1YI2F 2VAPA 2PHNA 2ZVZA 5LOVB 2V9YA 4DXDA 4YJ2B 2R751 3WPXA 3LWPC 4NQ3A 4EI8A 5HP8A 2QEXF 3MCQA 4G4VA 3B6NA 3JAWB 3IKFA 3N2GA 3PAFA 1M1KH 3DC2A 3VI6A 3VOBA 3VO8A 5GONB 5IJ0B 3LWQC 1W57A 3HKCA 5C8YB 3GYQA 1ZWZA 2P6YA 1YGYA 3RYHB 3K14A 4RHAA 2QA4F 2N48A 1NJIH 3TD5A 2Z1FA 4C8IA 3TD3A 3JALB 5J2UA 1H48A 1YJ9F 4YJ3B 2OHWA 2IAFA 1U43A 3LDTA 4I55A 4X3MA 1W2BF 3S0HA 3CCQF 3SIUA 4O2BB 3ESJA 3RYIB 2H6LA 3WGKA 2ZF8A 5MN6A 3JAKA 1VQNF 2ZOVA 3NVKE 3RE3A 1VQ8F 4O4IA 1W5EA 5GIPC 5HY0A 1RLGA 1U3PA 1Q82H 5EIBD 3ZO8A 2RHHA 2ZAUA 5FNVB 4X1KA 3JASA 3F0FA 4IHJB 3NVIB 1E7KA 4EB6A 5EB0A 5FJ4C 1JFFA 4BY9D 5JH7B 5ITZA 2H8CA 2UYKA 3UT5B 4ERHA 4O4HB 1W5BA 3HKDA 2KTVA 3CC2F 3P0ZA 4X1IA 5BMVB 3CCLF 3O85A 5HXZA 5G4VC 4TUYB 4O2AB 2HVYD 1DBFA 1X52A 5JQGB 2H8EA 5EYPB 3LWOC 4R40B 3IEQA 5KMGA 4X20B 5LP6B 3F0DA 5EO3A 2AMTA 3D01A 1Q81H 5CB4A 2VGMA 4I4TB 4WBNB 1TUBB 1RQ7A 4C4WC 5HY2A 3JAMM 1YIJF 3HJWC 4DRXA 4FFBA 3S02A 3WGMA 3CMAF 4IIJA 2FC3A 3JATB 1W55A 1XRGA 2CW4A 3GTZA 2Z01A 2HX0A 3D00A 3RYFB 3MBMA 4BT5A 4BVTA 1J7HA 3VYSC 4ZHVA 2VXYA 1TVKB 3I56F 5J2TB 4BVSA 5GINC 1COMA 1QU9A 2ZODA 1KC8H 2UYNA 1SA0B 4X1YB 2AIZP 1ONIA 4ZOLB 4C81A 5DCVA 1K8AH 2OZBA 5LOVA 3F0EA 3NK7A 4LNUB 5IYZB 2OTLF 3OBYA 5IT9M 4BVQA 3CD6F 1VQ4F 4ZHQA 5A2QM 3OONA 3QTYA 4ZK7A 5HY4A 4U3JB 3WGNA 3JAWA 2G9IA 3IEWA 3LFOA 2KGWA 3LYBA 1KNJA 1GO1A 2HRUA 5C8YA 5EZYB 4ZHWA 2LBXA 5LA6B 3RYHA 4G4XA 4O4LB 3C8LA 2LBWA 5JVDA 2HRYA 3CYPB 4TV8B 5CA0A 2ZVYA 3FD6A 3V7EA 1PXWA 2KTUA 3WGLA 3HKBB 2VGNA 1H47A 1XHOA 3JALA 4C8GA 1T0AA 3FD5A 3ZP4A 2OTJF 5JCOA 1RLUA 3WJQA 1CLIA 3E1YA 4F6RA 3BYQA 3CC4F 3VYTC 1VQ7F 5LXTA 2CSLA 3T80A 3OW2F 4ZI7A 3HKCB 3C9UA 1IV4A 3RA6A 4O2BA 3R0PA 4EI9A 2CHTA 3HWUA 3V4DA 1YJNF 3CCRF 1VQ5F 2JNBA 5AVMA 1VHAA 1FFXB 4TV9A 4G4YA 4O4JB 5J2UB 1FNKA 2BO1A 3CYQA 1GZ0A 4I55B 5HP7A 5EB1B 5FNVA 3VCZA 4IHJA 3VYUC 1VQLF 1QAHA 3VMFB 5JH7A 2W8BC 5GIOC 4G88A 3C9SA 3KE1A 3S0YA 1K73H 3JAKB 2YYEA 3CCEF 3EORA 3VTIC 5BMVA 1KNKA 3N2KB 2BTUA 1Q7YH 1CN7A 2HP0B 1U3LA 2I6RA 4TUYA 3KHNA 5GAPK 5JQGA 1VQMF 4TZZA 1K9MH 3C9RA 3GHZA 3ZOPA 4BW0B 5HWEA 1KQSF 1N8RH 3CC7F 3E22A 3V7QA 1GO0A 1VH8A 4EB6B 3CCVF 5LP6C 5ITZB 3WXMB 4BT4A 1VQVA 1UI9A 4B62A 1VQ9F 3VIUA 3HKDB 4I4TA 3V3TA 4WBNA 2GZLA 2OTMA 3N4ZA 3RYCA 1NMUB 3M84A 4B5CA 3L7QA 2IG8A 3MQWA 3WPWA 3ON1A 1XBIA 1DT9A 3FBAA 1YITF 2LCAA 1VQPF 2UYJA 3HKEA 4X3LA 5CB4B 5IJ9B 3RYFA 3P10A 3P4EA 3J7AR 1TVKA 4I50A 2DYYA 3I7TA 3IKEA 4DRXB 4FFBB 2VAWA 1QVGF 2R6R1 1FNJA 3C9TA 4X1YA 4NWOB 4ZOLA 4C82A 1W41A 5GANK 5LYJB 3CG6A 4YJ2A 2BTQB 2AIFA 1T0KB 1JN1A 1W3EX 2VAMA 1Q8RA 2FGYA 1IV1A 2DT4A 1W42A 1R1MA 4U3JA 2RB9A 5FLXM 5CA1B 1X7OA 2BTOA 4HNAB 2Q1YA 3CCJF 5EIBC 3F6MA 1CK2A 5GONA 5IJ0A 3D54A 5KX5B 1SDSA 2K1SA 3E20B 3ELCA 3JARB 5EZYA 3VOAA 1JY8A 5LA6A 3FFMA 3NMUC 1X25A 4G4ZA 3U0OA 4B46A 1S72F 1U40A 4TV8A 1VK3A 3CCSF 2Z1TA 2NMUA 3CB2A 3HKBA 2CZWA 4ZHQB 3PLAC 4YJ3A 4BT3A 3M4SA 3Q8HA 2RHOA 4ZHYB 3G6EF 3N2GB 1M90H 2F9ZC 1VQOF 3HTNA 1W59A 1FSZA 2GVIA 1XV2A 4M8IA 3QUWA 3RYIA 5JVDB 5MN4A 3I55F 5CA0B 1JJ2F 3NK6A 1FFXA 4PWTA 3G4SF 2UZHA 4O4JA 1RQ2A 2I6DA 5JCOC 3K0TA 2HS4A 3M1XA 4EI7A 4F6RB 1RA4A 4G4WA 3LWVC 2CHSA 5LXTB 3KIZA 2RHLA 4ZI7B 5HY1A 1VQKF 1JD1A 1Q86H 2CWJA 3UT5A 4O4HA
chains in the Genus database with same CATH topology
3GYQA 1ZWZA 4BVSA 5GINC 3CXCF 1NMUB 2ALEA 1KC8H 2QA4F 1NJIH 5DCVA 3ON1A 1IPAA 1K8AH 4NUTA 1XBIA 2OZBA 1DT9A 4BVRA 1W40A 2OTLF 3NK7A 1YITF 1YJWF 3CPQA 1YJ9F 3OBYA 1VQPF 5IT9M 2OHWA 4BVQA 1VQ4F 3CD6F 5A2QM 2GLZA 4X3LA 4X3MA 3CCMF 5HY4A 1W2BF 1QVFF 3CCQF 3SIUA 3J7AR 3LFOA 1GO1A 4XCQA 2LBXA 1VQNF 2QI2A 3NVKE 3CMEF 3AGKA 1QVGF 1VQ8F 2LBWA 5GIPC 5HY0A 1RLGA 3V7EA 2KG4A 4LCKA 3OBWA 1PXWA 1W41A 2KTUA 5GANK 1Q82H 3IR9A 2VGNA 2OTJF 3CG6A 3NVIB 5FJ4C 1E7KA 5G4UC 3CC4F 3E1YA 2AIFA 1KD1H 1T0KB 3JCMM 4BY9D 1W3EX 1VQ7F 3J80M 2FGYA 1W42A 5FLXM 3OW2F 1X7OA 3CCJF 3HAXD 1X7PA 3RA6A 3SIVA 3CCUF 1CK2A 2KTVA 3CC2F 4EI9A 1SDSA 3E20B 3J81M 1YJNF 3CCLF 2WALA 3O85A 5HXZA 3FFMA 5G4VC 3CCRF 1VQ5F 2JNBA 2HVYD 3NMUC 1S72F 1X52A 3RA5A 3LWRC 3LWOC 3CCSF 2BO1A 3PLAC 2CZWA 1GZ0A 5EO3A 3N4YA 1Q81H 5HXUA 3G6EF 1VQLF 3VMFB 5GIOC 1M90H 5EWRA 2VGMA 2F9ZC 1VQOF 4C4WC 5HY2A 3MCAB 1K73H 1VQ6F 1H7MA 3CCEF 1Q7YH 1CN7A 3JAMM 1YIJF 3HJWC 3I55F 3G71F 3CPWF 1YHQF 3CMAF 1JJ2F 3NK6A 1YI2F 5GAPK 2FC3A 1VQMF 3G4SF 4TZZA 1K9MH 5HWEA 1KQSF 4BW0B 2I6DA 1N8RH 4EI7A 3V7QA 3CC7F 1GO0A 3CCVF 1RA4A 3LWPC 4NQ3A 3LWVC 3D00A 3WXMB 4EI8A 2QEXF 5HY1A 4BVTA 1VQ9F 3PAFA 1VQKF 1M1KH 3VI6A 3V3TA 1Q86H 3LWQC 3I56F 3N4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYQ A;  1ZWZ A;  5GIN C;  3CXC F;  1NMU B;  2ALE A;  1KC8 H;  2QA4 F;  1NJI H;  5DCV A;  3ON1 A;  1IPA A;  1K8A H;  4NUT A;  1XBI A;  2OZB A;  1DT9 A;  1W40 A;  2OTL F;  3NK7 A;  1YIT F;  1YJW F;  3CPQ A;  1YJ9 F;  3OBY A;  1VQP F;  5IT9 M;  2OHW A;  3CD6 F;  1VQ4 F;  5A2Q M;  4X3L A;  4X3M A;  3CCM F;  1W2B F;  1QVF F;  3CCQ F;  3SIU A;  3J7A R;  3LFO A;  1GO1 A;  2LBX A;  1VQN F;  2QI2 A;  3NVK E;  3CME F;  3AGK A;  1QVG F;  1VQ8 F;  2LBW A;  5GIP C;  1RLG A;  3V7E A;  2KG4 A;  4LCK A;  3OBW A;  1PXW A;  1W41 A;  2KTU A;  5GAN K;  1Q82 H;  3IR9 A;  2VGN A;  2OTJ F;  3CG6 A;  3NVI B;  5FJ4 C;  1E7K A;  5G4U C;  3CC4 F;  3E1Y A;  2AIF A;  1KD1 H;  1T0K B;  3JCM M;  4BY9 D;  1W3E X;  1VQ7 F;  3J80 M;  1W42 A;  5FLX M;  3OW2 F;  1X7O A;  3CCJ F;  3HAX D;  1X7P A;  3RA6 A;  3SIV A;  3CCU F;  1CK2 A;  2KTV A;  3CC2 F;  1SDS A;  3E20 B;  3J81 M;  1YJN F;  3CCL F;  2WAL A;  3O85 A;  3FFM A;  5G4V C;  3CCR F;  1VQ5 F;  2JNB A;  2HVY D;  3NMU C;  1S72 F;  1X52 A;  3RA5 A;  3LWR C;  3LWO C;  3CCS F;  2BO1 A;  3PLA C;  2CZW A;  1GZ0 A;  5EO3 A;  3N4Y A;  1Q81 H;  3G6E F;  1VQL F;  3VMF B;  5GIO C;  1M90 H;  5EWR A;  2VGM A;  1VQO F;  4C4W C;  3MCA B;  1K73 H;  1VQ6 F;  1H7M A;  3CCE F;  1Q7Y H;  1CN7 A;  3JAM M;  1YIJ F;  3HJW C;  3I55 F;  3G71 F;  3CPW F;  1YHQ F;  3CMA F;  1JJ2 F;  3NK6 A;  1YI2 F;  5GAP K;  2FC3 A;  1VQM F;  3G4S F;  4TZZ A;  1K9M H;  1KQS F;  4BW0 B;  2I6D A;  1N8R H;  3CC7 F;  3V7Q A;  1GO0 A;  3CCV F;  1RA4 A;  3LWP C;  3LWV C;  3WXM B;  2QEX F;  1VQ9 F;  3PAF A;  1VQK F;  1M1K H;  3VI6 A;  1Q86 H;  3LWQ C;  3I56 F;  3N4Z A; 
#chains in the Genus database with same CATH topology
 3CXC F;  4RQO A;  5MN5 A;  4E6E A;  4KWE A;  1SZQ A;  2ALE A;  2QTP A;  3N2K A;  3DDN A;  4O4I B;  2HP0 A;  3WJR A;  4TV9 B;  4O2A A;  1UFY A;  1IPA A;  4NUT A;  4BVR A;  1W40 A;  5EYP A;  3LME A;  2PMP A;  3CPQ A;  1YJW F;  3FPI A;  4X1K B;  3JAS B;  2GLZ A;  1JFF B;  4X20 A;  1QD9 A;  2Z1E A;  2L26 A;  3IMP A;  5LP6 A;  3KJJ A;  3CCM F;  5B8F A;  2Z1U A;  3TD4 A;  1QVF F;  2LBT A;  2IQQ A;  2YXZ A;  1TUB A;  2HP3 A;  3ERN A;  4X1I B;  4B45 A;  4BT6 A;  3WJP A;  4XCQ A;  2QI2 A;  1IV2 A;  3CME F;  2HQS C;  3AGK A;  3ZP7 A;  1PF5 A;  2KG4 A;  3S03 A;  2UYP A;  3OBW A;  3E22 B;  4LCK A;  3IR9 A;  3JAT A;  1NQ3 A;  5KMG B;  5G4U C;  1ODE A;  1KD1 H;  3KJK A;  3JCM M;  5IJ9 A;  3J80 M;  2RHJ A;  3K2X A;  1Z5V A;  3HAX D;  1X7P A;  2EWC A;  2MQE A;  3CCU F;  3SIV A;  3RYC B;  3JVH A;  2CVL A;  3MDO A;  5J2T A;  3QHD A;  3J81 M;  2WAL A;  3S0W A;  4IIJ B;  1SA0 A;  3RA5 A;  3LWR C;  1YQN A;  4BT2 A;  1W58 1;  3K12 A;  5EAZ A;  3HKE B;  5LYJ A;  3F0G A;  4LNU A;  5IYZ A;  1GX1 A;  1W5A A;  3N4Y A;  5HXU A;  2B33 A;  1IV3 A;  3I3F A;  5EWR A;  2Q1X A;  5CA1 A;  1OFU A;  1W5F A;  4HNA A;  4I50 B;  3WGJ A;  3MCA B;  1Z5W A;  1VQ6 F;  1OAP A;  5KX5 A;  1H7M A;  2HS3 A;  3JAR A;  4BT7 A;  2UYN B;  4U39 A;  4C8E A;  3G71 F;  2HS0 A;  3CPW F;  3S06 A;  1YHQ F;  4O4L A;  1YI2 F;  2VAP A;  2PHN A;  2ZVZ A;  5LOV B;  2V9Y A;  4DXD A;  4YJ2 B;  2R75 1;  3WPX A;  3LWP C;  4NQ3 A;  4EI8 A;  5HP8 A;  2QEX F;  3MCQ A;  4G4V A;  3B6N A;  3JAW B;  3IKF A;  3N2G A;  3PAF A;  1M1K H;  3DC2 A;  3VI6 A;  3VOB A;  3VO8 A;  5GON B;  5IJ0 B;  3LWQ C;  1W57 A;  3HKC A;  5C8Y B;  3GYQ A;  1ZWZ A;  2P6Y A;  1YGY A;  3RYH B;  3K14 A;  4RHA A;  2QA4 F;  2N48 A;  1NJI H;  3TD5 A;  2Z1F A;  4C8I A;  3TD3 A;  3JAL B;  5J2U A;  1H48 A;  1YJ9 F;  4YJ3 B;  2OHW A;  2IAF A;  1U43 A;  3LDT A;  4I55 A;  4X3M A;  1W2B F;  3S0H A;  3CCQ F;  3SIU A;  4O2B B;  3ESJ A;  3RYI B;  2H6L A;  3WGK A;  2ZF8 A;  5MN6 A;  3JAK A;  1VQN F;  2ZOV A;  3NVK E;  3RE3 A;  1VQ8 F;  4O4I A;  1W5E A;  5GIP C;  5HY0 A;  1RLG A;  1U3P A;  1Q82 H;  5EIB D;  3ZO8 A;  2RHH A;  2ZAU A;  5FNV B;  4X1K A;  3JAS A;  3F0F A;  4IHJ B;  3NVI B;  1E7K A;  4EB6 A;  5EB0 A;  5FJ4 C;  1JFF A;  4BY9 D;  5JH7 B;  5ITZ A;  2H8C A;  2UYK A;  3UT5 B;  4ERH A;  4O4H B;  1W5B A;  3HKD A;  2KTV A;  3CC2 F;  3P0Z A;  4X1I A;  5BMV B;  3CCL F;  3O85 A;  5HXZ A;  5G4V C;  4TUY B;  4O2A B;  2HVY D;  1DBF A;  1X52 A;  5JQG B;  2H8E A;  5EYP B;  3LWO C;  4R40 B;  3IEQ A;  5KMG A;  4X20 B;  5LP6 B;  3F0D A;  5EO3 A;  2AMT A;  3D01 A;  1Q81 H;  5CB4 A;  2VGM A;  4I4T B;  4WBN B;  1TUB B;  1RQ7 A;  4C4W C;  5HY2 A;  3JAM M;  1YIJ F;  3HJW C;  4DRX A;  4FFB A;  3S02 A;  3WGM A;  3CMA F;  4IIJ A;  2FC3 A;  3JAT B;  1W55 A;  1XRG A;  2CW4 A;  3GTZ A;  2Z01 A;  2HX0 A;  3D00 A;  3RYF B;  3MBM A;  4BT5 A;  4BVT A;  1J7H A;  3VYS C;  4ZHV A;  2VXY A;  1TVK B;  3I56 F;  5J2T B;  4BVS A;  5GIN C;  1COM A;  1QU9 A;  2ZOD A;  1KC8 H;  2UYN A;  1SA0 B;  4X1Y B;  2AIZ P;  1ONI A;  4ZOL B;  4C81 A;  5DCV A;  1K8A H;  2OZB A;  5LOV A;  3F0E A;  3NK7 A;  4LNU B;  5IYZ B;  2OTL F;  3OBY A;  5IT9 M;  4BVQ A;  3CD6 F;  1VQ4 F;  4ZHQ A;  5A2Q M;  3OON A;  3QTY A;  4ZK7 A;  5HY4 A;  4U3J B;  3WGN A;  3JAW A;  2G9I A;  3IEW A;  3LFO A;  2KGW A;  3LYB A;  1KNJ A;  1GO1 A;  2HRU A;  5C8Y A;  5EZY B;  4ZHW A;  2LBX A;  5LA6 B;  3RYH A;  4G4X A;  4O4L B;  3C8L A;  2LBW A;  5JVD A;  2HRY A;  3CYP B;  4TV8 B;  5CA0 A;  2ZVY A;  3FD6 A;  3V7E A;  1PXW A;  2KTU A;  3WGL A;  3HKB B;  2VGN A;  1H47 A;  1XHO A;  3JAL A;  4C8G A;  1T0A A;  3FD5 A;  3ZP4 A;  2OTJ F;  5JCO A;  1RLU A;  3WJQ A;  1CLI A;  3E1Y A;  4F6R A;  3BYQ A;  3CC4 F;  3VYT C;  1VQ7 F;  5LXT A;  2CSL A;  3T80 A;  3OW2 F;  4ZI7 A;  3HKC B;  3C9U A;  1IV4 A;  3RA6 A;  4O2B A;  3R0P A;  4EI9 A;  2CHT A;  3HWU A;  3V4D A;  1YJN F;  3CCR F;  1VQ5 F;  2JNB A;  5AVM A;  1VHA A;  1FFX B;  4TV9 A;  4G4Y A;  4O4J B;  5J2U B;  1FNK A;  2BO1 A;  3CYQ A;  1GZ0 A;  4I55 B;  5HP7 A;  5EB1 B;  5FNV A;  3VCZ A;  4IHJ A;  3VYU C;  1VQL F;  1QAH A;  3VMF B;  5JH7 A;  2W8B C;  5GIO C;  4G88 A;  3C9S A;  3KE1 A;  3S0Y A;  1K73 H;  3JAK B;  2YYE A;  3CCE F;  3EOR A;  3VTI C;  5BMV A;  1KNK A;  3N2K B;  2BTU A;  1Q7Y H;  1CN7 A;  2HP0 B;  1U3L A;  2I6R A;  4TUY A;  3KHN A;  5GAP K;  5JQG A;  1VQM F;  4TZZ A;  1K9M H;  3C9R A;  3GHZ A;  3ZOP A;  4BW0 B;  5HWE A;  1KQS F;  1N8R H;  3CC7 F;  3E22 A;  3V7Q A;  1GO0 A;  1VH8 A;  4EB6 B;  3CCV F;  5LP6 C;  5ITZ B;  3WXM B;  4BT4 A;  1VQV A;  1UI9 A;  4B62 A;  1VQ9 F;  3VIU A;  3HKD B;  4I4T A;  3V3T A;  4WBN A;  2GZL A;  2OTM A;  3N4Z A;  3RYC A;  1NMU B;  3M84 A;  4B5C A;  3L7Q A;  2IG8 A;  3MQW A;  3WPW A;  3ON1 A;  1XBI A;  1DT9 A;  3FBA A;  1YIT F;  2LCA A;  1VQP F;  2UYJ A;  3HKE A;  4X3L A;  5CB4 B;  5IJ9 B;  3RYF A;  3P10 A;  3P4E A;  3J7A R;  1TVK A;  4I50 A;  2DYY A;  3I7T A;  3IKE A;  4DRX B;  4FFB B;  2VAW A;  1QVG F;  2R6R 1;  1FNJ A;  3C9T A;  4X1Y A;  4NWO B;  4ZOL A;  4C82 A;  1W41 A;  5GAN K;  5LYJ B;  3CG6 A;  4YJ2 A;  2BTQ B;  2AIF A;  1T0K B;  1JN1 A;  1W3E X;  2VAM A;  1Q8R A;  2FGY A;  1IV1 A;  2DT4 A;  1W42 A;  1R1M A;  4U3J A;  2RB9 A;  5FLX M;  5CA1 B;  1X7O A;  2BTO A;  4HNA B;  2Q1Y A;  3CCJ F;  5EIB C;  3F6M A;  1CK2 A;  5GON A;  5IJ0 A;  3D54 A;  5KX5 B;  1SDS A;  2K1S A;  3E20 B;  3ELC A;  3JAR B;  5EZY A;  3VOA A;  1JY8 A;  5LA6 A;  3FFM A;  3NMU C;  1X25 A;  4G4Z A;  3U0O A;  4B46 A;  1S72 F;  1U40 A;  4TV8 A;  1VK3 A;  3CCS F;  2Z1T A;  2NMU A;  3CB2 A;  3HKB A;  2CZW A;  4ZHQ B;  3PLA C;  4YJ3 A;  4BT3 A;  3M4S A;  3Q8H A;  2RHO A;  4ZHY B;  3G6E F;  3N2G B;  1M90 H;  2F9Z C;  1VQO F;  3HTN A;  1W59 A;  1FSZ A;  2GVI A;  1XV2 A;  4M8I A;  3QUW A;  3RYI A;  5JVD B;  5MN4 A;  3I55 F;  5CA0 B;  1JJ2 F;  3NK6 A;  1FFX A;  4PWT A;  3G4S F;  2UZH A;  4O4J A;  1RQ2 A;  2I6D A;  5JCO C;  3K0T A;  2HS4 A;  3M1X A;  4EI7 A;  4F6R B;  1RA4 A;  4G4W A;  3LWV C;  2CHS A;  5LXT B;  3KIZ A;  2RHL A;  4ZI7 B;  5HY1 A;  1VQK F;  1JD1 A;  1Q86 H;  2CWJ A;  3UT5 A;  4O4H A; 
#chains in the Genus database with same CATH homology
 3GYQ A;  1ZWZ A;  4BVS A;  5GIN C;  3CXC F;  1NMU B;  2ALE A;  1KC8 H;  2QA4 F;  1NJI H;  5DCV A;  3ON1 A;  1IPA A;  1K8A H;  4NUT A;  1XBI A;  2OZB A;  1DT9 A;  4BVR A;  1W40 A;  2OTL F;  3NK7 A;  1YIT F;  1YJW F;  3CPQ A;  1YJ9 F;  3OBY A;  1VQP F;  5IT9 M;  2OHW A;  4BVQ A;  1VQ4 F;  3CD6 F;  5A2Q M;  2GLZ A;  4X3L A;  4X3M A;  3CCM F;  5HY4 A;  1W2B F;  1QVF F;  3CCQ F;  3SIU A;  3J7A R;  3LFO A;  1GO1 A;  4XCQ A;  2LBX A;  1VQN F;  2QI2 A;  3NVK E;  3CME F;  3AGK A;  1QVG F;  1VQ8 F;  2LBW A;  5GIP C;  5HY0 A;  1RLG A;  3V7E A;  2KG4 A;  4LCK A;  3OBW A;  1PXW A;  1W41 A;  2KTU A;  5GAN K;  1Q82 H;  3IR9 A;  2VGN A;  2OTJ F;  3CG6 A;  3NVI B;  5FJ4 C;  1E7K A;  5G4U C;  3CC4 F;  3E1Y A;  2AIF A;  1KD1 H;  1T0K B;  3JCM M;  4BY9 D;  1W3E X;  1VQ7 F;  3J80 M;  2FGY A;  1W42 A;  5FLX M;  3OW2 F;  1X7O A;  3CCJ F;  3HAX D;  1X7P A;  3RA6 A;  3SIV A;  3CCU F;  1CK2 A;  2KTV A;  3CC2 F;  4EI9 A;  1SDS A;  3E20 B;  3J81 M;  1YJN F;  3CCL F;  2WAL A;  3O85 A;  5HXZ A;  3FFM A;  5G4V C;  3CCR F;  1VQ5 F;  2JNB A;  2HVY D;  3NMU C;  1S72 F;  1X52 A;  3RA5 A;  3LWR C;  3LWO C;  3CCS F;  2BO1 A;  3PLA C;  2CZW A;  1GZ0 A;  5EO3 A;  3N4Y A;  1Q81 H;  5HXU A;  3G6E F;  1VQL F;  3VMF B;  5GIO C;  1M90 H;  5EWR A;  2VGM A;  2F9Z C;  1VQO F;  4C4W C;  5HY2 A;  3MCA B;  1K73 H;  1VQ6 F;  1H7M A;  3CCE F;  1Q7Y H;  1CN7 A;  3JAM M;  1YIJ F;  3HJW C;  3I55 F;  3G71 F;  3CPW F;  1YHQ F;  3CMA F;  1JJ2 F;  3NK6 A;  1YI2 F;  5GAP K;  2FC3 A;  1VQM F;  3G4S F;  4TZZ A;  1K9M H;  5HWE A;  1KQS F;  4BW0 B;  2I6D A;  1N8R H;  4EI7 A;  3V7Q A;  3CC7 F;  1GO0 A;  3CCV F;  1RA4 A;  3LWP C;  4NQ3 A;  3LWV C;  3D00 A;  3WXM B;  4EI8 A;  2QEX F;  5HY1 A;  4BVT A;  1VQ9 F;  3PAF A;  1VQK F;  1M1K H;  3VI6 A;  3V3T A;  1Q86 H;  3LWQ C;  3I56 F;  3N4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...