1VQ9F

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq9F00
1W40A 5GANK 3CMAF 3N4YA 1GO0A 1W41A 2VGNA 3CCLF 3E20B 5FLXM 1S72F 3JCMM 1K73H 3J81M 5FJ4C 2LBXA 1T0KB 1Q81H 3CCQF 1W2BF 1VQ9F 3PLAC 1VQMF 1VQ4F 3CC2F 3FFMA 2I6DA 3NVIB 1VQ6F 3J7AR 1VQ5F 1CK2A 1Q86H 3V7QA 3LWPC 5G4UC 3MCAB 2WALA 3SIUA 1YHQF 1QVFF 3CPWF 4X3LA 5EWRA 3CCMF 1KQSF 1X7PA 4X3MA 3NVKE 1YI2F 1GO1A 4NUTA 5IT9M 3G6EF 3G4SF 1K9MH 2HVYD 5EO3A 1VQLF 3N4ZA 3RA5A 1CN7A 2OTLF 2LBWA 1KC8H 1YITF 2KG4A 3NK6A 3OBWA 1RA4A 1KD1H 3CCSF 3CD6F 1NJIH 3NMUC 3CG6A 3CCUF 4BW0B 1VQOF 1SDSA 1QVGF 4LCKA 3LWQC 3CC7F 1ZWZA 3IR9A 3LFOA 1VQPF 1Q82H 1VQ7F 3HJWC 2QEXF 3OW2F 1M1KH 2VGMA 3SIVA 1W3EX 3O85A 1Q7YH 1X7OA 3CC4F 3HAXD 2JNBA 1H7MA 2OHWA 1M90H 3E1YA 1PXWA 3AGKA 3GYQA 1YJWF 2OZBA 3WXMB 1JJ2F 3LWVC 1K8AH 3J80M 1N8RH 5GIPC 3OBYA 5GAPK 3CXCF 3LWOC 5GIOC 2QA4F 4C4WC 3LWRC 3CCEF 3G71F 2BO1A 4BY9D 1X52A 2CZWA 3V7EA 1W42A 1VQ8F 3ON1A 5A2QM 2AIFA 3CCJF 2FC3A 3VMFB 1VQKF 4TZZA 5G4VC 1YJ9F 1E7KA 3VI6A 3RA6A 3CCVF 1RLGA 3NK7A 1GZ0A 1YIJF 1DT9A 1XBIA 2ALEA 1YJNF 2QI2A 2KTVA 3CCRF 5GINC 2OTJF 1NMUB 3I56F 3CMEF 3PAFA 2KTUA 5DCVA 3CPQA 1IPAA 3I55F 3JAMM 1VQNF
chains in the Genus database with same CATH superfamily
4YJ3B 3CMAF 1VQVA 3QHDA 4O4LA 4C8GA 4ZHQA 3FPIA 1TUBB 4G4XA 5CA1B 2HRUA 2DYYA 1S72F 3P10A 2KGWA 1VQ4F 3CC2F 5JH7A 5FNVB 5B8FA 3M84A 1U40A 3NVIB 4TUYB 3R0PA 5GONB 3J7AR 1VQ5F 4ZOLB 3K0TA 4LNUA 1YHQF 4O2BA 5EWRA 1UI9A 2ZAUA 1X7PA 3WPWA 2W8BC 3JASB 2OTMA 3QTYA 4DRXA 3G4SF 5EIBD 2NMUA 3MBMA 3N2KB 5IJ9B 2CHSA 2UYNB 2H8EA 3ESJA 3F0GA 3I7TA 1CN7A 4X1YB 2CSLA 2LBWA 3VYTC 1KC8H 2F9ZC 3CYQA 2PHNA 4C8IA 3RYFB 5JQGB 1NJIH 5J2TA 3NMUC 3C9TA 3JATB 4BW0B 1XV2A 2CW4A 2FGYA 5BMVB 1CLIA 4X1KB 1Q82H 1VQPF 4C8EA 2IQQA 5EYPA 3HJWC 4BT7A 3VOBA 3RYCA 3OW2F 5C8YA 2QTPA 2Z1UA 1X7OA 3HAXD 3JARA 3N2GB 1U3LA 3RE3A 1H7MA 5CA0B 2HS0A 4BVRA 2OHWA 4ZK7A 1FNJA 1M90H 3WJRA 4X1IA 4WBNB 3WXMB 1JJ2F 4O4LB 1N8RH 4ZHQB 5EAZA 2ZF8A 3ERNA 2BTQB 3V3TA 3CCEF 3S06A 3G71F 5KX5A 1R1MA 3V7EA 5HP7A 1RLUA 3ON1A 2Q1YA 4IHJA 1VQ8F 2RHOA 5GONA 3GTZA 3VYUC 5G4VC 3S03A 3VI6A 3BYQA 4RQOA 3NK7A 1GZ0A 4BVSA 1DT9A 5HWEA 1YIJF 1YJNF 1W5BA 4O2BB 1JFFA 2QI2A 2Z1FA 4TV9B 2R6R1 4G4WA 3CCRF 5GINC 3LDTA 3WJQA 4DRXB 5EB1B 1JN1A 4U39A 3S0YA 3HKEA 2EWCA 3JAMM 1VQNF 2GLZA 5HY2A 3N4YA 2UYNA 5MN4A 1W41A 2ZOVA 4HNAA 5FLXM 1SA0B 4B62A 1Z5WA 3C9UA 1Q81H 1FFXB 3KIZA 3JATA 3UT5A 1W2BF 1VQMF 2UYJA 4B46A 2IG8A 5EYPB 5LA6A 3WJPA 3RYCB 3TD3A 5C8YB 5CA0A 1X25A 3RYIB 2PMPA 3LWPC 5G4UC 3E22A 4XCQA 2WALA 3EORA 3WPXA 3DDNA 3V4DA 3KE1A 2AIZP 2V9YA 1KQSF 3F6MA 5LP6C 1U43A 4FFBB 3VCZA 3IEWA 4EI8A 1VH8A 2HP3A 1Q8RA 3MDOA 3D54A 3N4ZA 5KX5B 2HS3A 1FSZA 1YITF 2KG4A 4G4ZA 3NK6A 1ODEA 4IHJB 1KD1H 1JY8A 3HTNA 2G9IA 1OAPA 4NQ3A 4BT2A 3CCUF 1VQOF 2HP0B 1SDSA 5CB4A 3K2XA 1QVGF 4BT3A 3IR9A 5JVDA 4TV9A 4G4YA 5JCOC 1M1KH 2VGMA 1JFFB 1W3EX 1Q7YH 2JNBA 2VXYA 3F0DA 4E6EA 3E1YA 5IJ0B 3AGKA 2CVLA 2UYKA 3HKEB 5HY1A 3LWVC 2GVIA 5GAPK 1RQ7A 1SA0A 3CXCF 3K12A 2I6RA 4HNAB 1W55A 1FFXA 5GIOC 4I50A 4EB6A 3C9SA 3UT5B 2RB9A 3LWRC 2BO1A 3S02A 5LP6B 4BT5A 5A2QM 2CWJA 3ZO8A 5LA6B 2IAFA 2AMTA 3RYIA 1YJ9F 3RA6A 4B45A 4EI9A 1RLGA 4G4VA 5IYZB 3E22B 5EIBC 3JAWA 2ALEA 2RHLA 1QAHA 3IKFA 4FFBA 3TD4A 3F0FA 3PAFA 3CPQA 2Q1XA 5MN5A 5EB0A 3HWUA 4NWOB 1W40A 4BVQA 5GANK 1W5EA 1GO0A 5FJ4C 2UZHA 1QU9A 1T0KB 4O2AB 1JD1A 3CCQF 1XRGA 2HP0A 4O4IB 1IV1A 1W57A 1T0AA 1KNKA 3M4SA 5CB4B 2ZVYA 5JVDB 1VQ6F 5EZYA 2L26A 4ZHVA 3WGJA 3MCAB 5IJ0A 3SIUA 1FNKA 4I55A 1QVFF 3F0EA 2Z1EA 3U0OA 1IV4A 1RQ2A 4X3MA 5HXUA 5HXZA 1YI2F 3T80A 2HRYA 3KJJA 4NUTA 5IT9M 3G6EF 1QD9A 1K9MH 2HVYD 4I50B 4EB6B 5EO3A 4TV8A 5LP6A 3RA5A 2OTLF 2H6LA 1IV3A 3JALB 3OBWA 1RA4A 3QUWA 3VYSC 3L7QA 4BVTA 5IYZA 4B5CA 3LMEA 4LCKA 4F6RB 3LWQC 2HX0A 1ZWZA 3CC7F 1VQ7F 1XHOA 3IEQA 3JAWB 2UYPA 2YYEA 3CC4F 3KHNA 2LCAA 1YJWF 3LYBA 3FD6A 2ZODA 3D00A 4G88A 2DT4A 4ZHWA 3ELCA 3S0HA 3TD5A 2GZLA 5JCOA 5GIPC 3K14A 2ZVZA 4EI7A 1TVKB 1W5AA 4O2AA 2HQSC 4ZI7B 4O4IA 4YJ2A 2QA4F 4IIJA 2BTUA 3VOAA 4C4WC 3VIUA 4KWEA 4U3JA 1X52A 3KJKA 4BY9D 1W42A 3WGLA 2AIFA 2RHHA 3C9RA 2VAMA 4TZZA 1VK3A 5EZYB 3RYHA 2LBTA 1XBIA 5ITZB 4I55B 3WGMA 1W5FA 3VTIC 3HKDA 2KTVA 2HS4A 5HY4A 3I56F 4O4JA 2Z01A 1OFUA 3MCQA 4DXDA 2RHJA 1IPAA 5LYJA 2OTJF 3P4EA 1VHAA 2VGNA 4TV8B 3B6NA 3JALA 3CCLF 4C81A 3E20B 4M8IA 5KMGB 3JCMM 4ERHA 3J81M 1K73H 2LBXA 3M1XA 1VQ9F 3PLAC 3P0ZA 2MQEA 1NQ3A 3FFMA 4C82A 1H47A 4F6RA 5HP8A 4I4TA 4O4HB 3JAKA 2I6DA 5LOVB 1YQNA 1DBFA 1Q86H 3V7QA 3DC2A 5LXTB 4X20A 3IKEA 3CPWF 4X3LA 3CCMF 1UFYA 1TVKA 3HKBA 1COMA 3NVKE 3HKCA 4ZI7A 1GO1A 1YGYA 5J2UA 1SZQA 4YJ3A 4YJ2B 4IIJB 5MN6A 2H8CA 1VQLF 1TUBA 2BTOA 5CA1A 3ZP7A 3WGKA 4U3JB 3WGNA 2B33A 3Q8HA 1KNJA 3OONA 4ZHYB 4BT4A 3CCSF 3CD6F 3C8LA 3CYPB 3IMPA 3CG6A 3FD5A 5FNVA 5JH7B 1W581 3RYHB 1W59A 4TUYA 5ITZA 3LFOA 2QEXF 2YXZA 3SIVA 3O85A 3HKDB 2Z1TA 4ZOLA 1PF5A 1H48A 1IV2A 4O4JB 3GYQA 1PXWA 4LNUB 2OZBA 4PWTA 5LYJB 1ONIA 1K8AH 3JASA 3J80M 3OBYA 3S0WA 5KMGA 3D01A 3VO8A 3GHZA 3LWOC 3FBAA 3N2KA 2K1SA 5AVMA 5IJ9A 2P6YA 2CHTA 4O4HA 4X1YA 5LOVA 2CZWA 1GX1A 4I4TB 3JAKB 2VAWA 2R751 3CB2A 3CCJF 1Z5VA 4RHAA 2FC3A 3MQWA 3VMFB 1VQKF 3RYFA 5JQGA 1E7KA 2N48A 3JVHA 1U3PA 3CCVF 5LXTA 5J2TB 2VAPA 5BMVA 4X1KA 4X20B 4BT6A 3N2GA 1J7HA 5HY0A 5DCVA 3HKBB 1NMUB 3ZP4A 3CMEF 3JARB 2KTUA 3I3FA 3HKCB 4WBNA 4R40B 3ZOPA 3I55F 5J2UB 1CK2A 4X1IB
chains in the Genus database with same CATH topology
1W40A 4BVQA 5HY2A 3N4YA 5GANK 3CMAF 1GO0A 1W41A 2VGNA 3CCLF 3E20B 5FLXM 1S72F 3JCMM 1K73H 3J81M 5FJ4C 2LBXA 1T0KB 1Q81H 3CCQF 1W2BF 1VQ9F 3PLAC 1VQMF 1VQ4F 3CC2F 3FFMA 2I6DA 3NVIB 1VQ6F 3J7AR 1VQ5F 1Q86H 3V7QA 3LWPC 5G4UC 3MCAB 2WALA 4XCQA 3SIUA 1YHQF 1QVFF 3CPWF 4X3LA 5EWRA 3CCMF 1KQSF 1X7PA 4X3MA 5HXUA 5HXZA 3NVKE 1YI2F 1GO1A 4NUTA 4EI8A 5IT9M 3G6EF 3G4SF 1K9MH 2HVYD 5EO3A 1VQLF 3N4ZA 3RA5A 1CN7A 2OTLF 2LBWA 1KC8H 1YITF 2KG4A 2F9ZC 3NK6A 1RA4A 3OBWA 1KD1H 3CCSF 3CD6F 4NQ3A 1NJIH 4BVTA 3CG6A 3NMUC 3CCUF 4BW0B 1VQOF 1SDSA 2FGYA 1QVGF 4LCKA 3LWQC 3CC7F 1ZWZA 3IR9A 3LFOA 1VQPF 1Q82H 1VQ7F 3HJWC 2QEXF 3OW2F 1M1KH 2VGMA 3SIVA 1W3EX 3O85A 1Q7YH 1X7OA 3CC4F 3HAXD 2JNBA 1H7MA 4BVRA 2OHWA 1M90H 3E1YA 1PXWA 3AGKA 3GYQA 3JAMM 1YJWF 2OZBA 3D00A 3WXMB 1JJ2F 5HY1A 3LWVC 1K8AH 3J80M 1N8RH 5GIPC 3OBYA 4EI7A 5GAPK 3CXCF 3LWOC 5GIOC 2QA4F 3V3TA 4C4WC 3LWRC 3CCEF 3G71F 2BO1A 4BY9D 1X52A 2CZWA 3V7EA 1W42A 1VQ8F 3ON1A 5A2QM 2AIFA 3CCJF 2FC3A 3VMFB 1VQKF 4TZZA 5G4VC 1YJ9F 1E7KA 3VI6A 3RA6A 4EI9A 3CCVF 1RLGA 3NK7A 1GZ0A 4BVSA 1DT9A 5HWEA 1YIJF 1XBIA 2ALEA 1YJNF 2QI2A 5HY0A 2KTVA 5HY4A 3CCRF 5GINC 2OTJF 1NMUB 3I56F 3CMEF 3PAFA 2KTUA 5DCVA 3CPQA 1IPAA 3I55F 1CK2A 1VQNF 2GLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W40 A;  5GAN K;  3CMA F;  3N4Y A;  1GO0 A;  1W41 A;  2VGN A;  3CCL F;  3E20 B;  5FLX M;  1S72 F;  3JCM M;  1K73 H;  3J81 M;  5FJ4 C;  2LBX A;  1T0K B;  1Q81 H;  3CCQ F;  1W2B F;  1VQ9 F;  3PLA C;  1VQM F;  1VQ4 F;  3CC2 F;  3FFM A;  2I6D A;  3NVI B;  1VQ6 F;  3J7A R;  1VQ5 F;  1CK2 A;  1Q86 H;  3V7Q A;  3LWP C;  5G4U C;  3MCA B;  2WAL A;  3SIU A;  1YHQ F;  1QVF F;  3CPW F;  4X3L A;  5EWR A;  3CCM F;  1KQS F;  1X7P A;  4X3M A;  3NVK E;  1YI2 F;  1GO1 A;  4NUT A;  5IT9 M;  3G6E F;  3G4S F;  1K9M H;  2HVY D;  5EO3 A;  1VQL F;  3N4Z A;  3RA5 A;  1CN7 A;  2OTL F;  2LBW A;  1KC8 H;  1YIT F;  2KG4 A;  3NK6 A;  3OBW A;  1RA4 A;  1KD1 H;  3CCS F;  3CD6 F;  1NJI H;  3NMU C;  3CG6 A;  3CCU F;  4BW0 B;  1VQO F;  1SDS A;  1QVG F;  4LCK A;  3LWQ C;  3CC7 F;  1ZWZ A;  3IR9 A;  3LFO A;  1VQP F;  1Q82 H;  1VQ7 F;  3HJW C;  2QEX F;  3OW2 F;  1M1K H;  2VGM A;  3SIV A;  1W3E X;  3O85 A;  1Q7Y H;  1X7O A;  3CC4 F;  3HAX D;  2JNB A;  1H7M A;  2OHW A;  1M90 H;  3E1Y A;  1PXW A;  3AGK A;  3GYQ A;  1YJW F;  2OZB A;  3WXM B;  1JJ2 F;  3LWV C;  1K8A H;  3J80 M;  1N8R H;  5GIP C;  3OBY A;  5GAP K;  3CXC F;  3LWO C;  5GIO C;  2QA4 F;  4C4W C;  3LWR C;  3CCE F;  3G71 F;  2BO1 A;  4BY9 D;  1X52 A;  2CZW A;  3V7E A;  1W42 A;  1VQ8 F;  3ON1 A;  5A2Q M;  2AIF A;  3CCJ F;  2FC3 A;  3VMF B;  1VQK F;  4TZZ A;  5G4V C;  1YJ9 F;  1E7K A;  3VI6 A;  3RA6 A;  3CCV F;  1RLG A;  3NK7 A;  1GZ0 A;  1YIJ F;  1DT9 A;  1XBI A;  2ALE A;  1YJN F;  2QI2 A;  2KTV A;  3CCR F;  5GIN C;  2OTJ F;  1NMU B;  3I56 F;  3CME F;  3PAF A;  2KTU A;  5DCV A;  3CPQ A;  1IPA A;  3I55 F;  3JAM M;  1VQN F; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  3CMA F;  1VQV A;  3QHD A;  4O4L A;  4C8G A;  4ZHQ A;  3FPI A;  1TUB B;  4G4X A;  5CA1 B;  2HRU A;  2DYY A;  1S72 F;  3P10 A;  2KGW A;  1VQ4 F;  3CC2 F;  5JH7 A;  5FNV B;  5B8F A;  3M84 A;  1U40 A;  3NVI B;  4TUY B;  3R0P A;  5GON B;  3J7A R;  1VQ5 F;  4ZOL B;  3K0T A;  4LNU A;  1YHQ F;  4O2B A;  5EWR A;  1UI9 A;  2ZAU A;  1X7P A;  3WPW A;  2W8B C;  3JAS B;  2OTM A;  3QTY A;  4DRX A;  3G4S F;  5EIB D;  2NMU A;  3MBM A;  3N2K B;  5IJ9 B;  2CHS A;  2UYN B;  2H8E A;  3ESJ A;  3F0G A;  3I7T A;  1CN7 A;  4X1Y B;  2CSL A;  2LBW A;  3VYT C;  1KC8 H;  2F9Z C;  3CYQ A;  2PHN A;  4C8I A;  3RYF B;  5JQG B;  1NJI H;  5J2T A;  3NMU C;  3C9T A;  3JAT B;  4BW0 B;  1XV2 A;  2CW4 A;  2FGY A;  5BMV B;  1CLI A;  4X1K B;  1Q82 H;  1VQP F;  4C8E A;  2IQQ A;  5EYP A;  3HJW C;  4BT7 A;  3VOB A;  3RYC A;  3OW2 F;  5C8Y A;  2QTP A;  2Z1U A;  1X7O A;  3HAX D;  3JAR A;  3N2G B;  1U3L A;  3RE3 A;  1H7M A;  5CA0 B;  2HS0 A;  4BVR A;  2OHW A;  4ZK7 A;  1FNJ A;  1M90 H;  3WJR A;  4X1I A;  4WBN B;  3WXM B;  1JJ2 F;  4O4L B;  1N8R H;  4ZHQ B;  5EAZ A;  2ZF8 A;  3ERN A;  2BTQ B;  3V3T A;  3CCE F;  3S06 A;  3G71 F;  5KX5 A;  1R1M A;  3V7E A;  5HP7 A;  1RLU A;  3ON1 A;  2Q1Y A;  4IHJ A;  1VQ8 F;  2RHO A;  5GON A;  3GTZ A;  3VYU C;  5G4V C;  3S03 A;  3VI6 A;  3BYQ A;  4RQO A;  3NK7 A;  1GZ0 A;  4BVS A;  1DT9 A;  5HWE A;  1YIJ F;  1YJN F;  1W5B A;  4O2B B;  1JFF A;  2QI2 A;  2Z1F A;  4TV9 B;  2R6R 1;  4G4W A;  3CCR F;  5GIN C;  3LDT A;  3WJQ A;  4DRX B;  5EB1 B;  1JN1 A;  4U39 A;  3S0Y A;  3HKE A;  2EWC A;  3JAM M;  1VQN F;  2GLZ A;  5HY2 A;  3N4Y A;  2UYN A;  5MN4 A;  1W41 A;  2ZOV A;  4HNA A;  5FLX M;  1SA0 B;  4B62 A;  1Z5W A;  3C9U A;  1Q81 H;  1FFX B;  3KIZ A;  3JAT A;  3UT5 A;  1W2B F;  1VQM F;  2UYJ A;  4B46 A;  2IG8 A;  5EYP B;  5LA6 A;  3WJP A;  3RYC B;  3TD3 A;  5C8Y B;  5CA0 A;  1X25 A;  3RYI B;  2PMP A;  3LWP C;  5G4U C;  3E22 A;  4XCQ A;  2WAL A;  3EOR A;  3WPX A;  3DDN A;  3V4D A;  3KE1 A;  2AIZ P;  2V9Y A;  1KQS F;  3F6M A;  5LP6 C;  1U43 A;  4FFB B;  3VCZ A;  3IEW A;  4EI8 A;  1VH8 A;  2HP3 A;  1Q8R A;  3MDO A;  3D54 A;  3N4Z A;  5KX5 B;  2HS3 A;  1FSZ A;  1YIT F;  2KG4 A;  4G4Z A;  3NK6 A;  1ODE A;  4IHJ B;  1KD1 H;  1JY8 A;  3HTN A;  2G9I A;  1OAP A;  4NQ3 A;  4BT2 A;  3CCU F;  1VQO F;  2HP0 B;  1SDS A;  5CB4 A;  3K2X A;  1QVG F;  4BT3 A;  3IR9 A;  5JVD A;  4TV9 A;  4G4Y A;  5JCO C;  1M1K H;  2VGM A;  1JFF B;  1W3E X;  1Q7Y H;  2JNB A;  2VXY A;  3F0D A;  4E6E A;  3E1Y A;  5IJ0 B;  3AGK A;  2CVL A;  2UYK A;  3HKE B;  5HY1 A;  3LWV C;  2GVI A;  5GAP K;  1RQ7 A;  1SA0 A;  3CXC F;  3K12 A;  2I6R A;  4HNA B;  1W55 A;  1FFX A;  5GIO C;  4I50 A;  4EB6 A;  3C9S A;  3UT5 B;  2RB9 A;  3LWR C;  2BO1 A;  3S02 A;  5LP6 B;  4BT5 A;  5A2Q M;  2CWJ A;  3ZO8 A;  5LA6 B;  2IAF A;  2AMT A;  3RYI A;  1YJ9 F;  3RA6 A;  4B45 A;  4EI9 A;  1RLG A;  4G4V A;  5IYZ B;  3E22 B;  5EIB C;  3JAW A;  2ALE A;  2RHL A;  1QAH A;  3IKF A;  4FFB A;  3TD4 A;  3F0F A;  3PAF A;  3CPQ A;  2Q1X A;  5MN5 A;  5EB0 A;  3HWU A;  4NWO B;  1W40 A;  4BVQ A;  5GAN K;  1W5E A;  1GO0 A;  5FJ4 C;  2UZH A;  1QU9 A;  1T0K B;  4O2A B;  1JD1 A;  3CCQ F;  1XRG A;  2HP0 A;  4O4I B;  1IV1 A;  1W57 A;  1T0A A;  1KNK A;  3M4S A;  5CB4 B;  2ZVY A;  5JVD B;  1VQ6 F;  5EZY A;  2L26 A;  4ZHV A;  3WGJ A;  3MCA B;  5IJ0 A;  3SIU A;  1FNK A;  4I55 A;  1QVF F;  3F0E A;  2Z1E A;  3U0O A;  1IV4 A;  1RQ2 A;  4X3M A;  5HXU A;  5HXZ A;  1YI2 F;  3T80 A;  2HRY A;  3KJJ A;  4NUT A;  5IT9 M;  3G6E F;  1QD9 A;  1K9M H;  2HVY D;  4I50 B;  4EB6 B;  5EO3 A;  4TV8 A;  5LP6 A;  3RA5 A;  2OTL F;  2H6L A;  1IV3 A;  3JAL B;  3OBW A;  1RA4 A;  3QUW A;  3VYS C;  3L7Q A;  4BVT A;  5IYZ A;  4B5C A;  3LME A;  4LCK A;  4F6R B;  3LWQ C;  2HX0 A;  1ZWZ A;  3CC7 F;  1VQ7 F;  1XHO A;  3IEQ A;  3JAW B;  2UYP A;  2YYE A;  3CC4 F;  3KHN A;  2LCA A;  1YJW F;  3LYB A;  3FD6 A;  2ZOD A;  3D00 A;  4G88 A;  2DT4 A;  4ZHW A;  3ELC A;  3S0H A;  3TD5 A;  2GZL A;  5JCO A;  5GIP C;  3K14 A;  2ZVZ A;  4EI7 A;  1TVK B;  1W5A A;  4O2A A;  2HQS C;  4ZI7 B;  4O4I A;  4YJ2 A;  2QA4 F;  4IIJ A;  2BTU A;  3VOA A;  4C4W C;  3VIU A;  4KWE A;  4U3J A;  1X52 A;  3KJK A;  4BY9 D;  1W42 A;  3WGL A;  2AIF A;  2RHH A;  3C9R A;  2VAM A;  4TZZ A;  1VK3 A;  5EZY B;  3RYH A;  2LBT A;  1XBI A;  5ITZ B;  4I55 B;  3WGM A;  1W5F A;  3VTI C;  3HKD A;  2KTV A;  2HS4 A;  5HY4 A;  3I56 F;  4O4J A;  2Z01 A;  1OFU A;  3MCQ A;  4DXD A;  2RHJ A;  1IPA A;  5LYJ A;  2OTJ F;  3P4E A;  1VHA A;  2VGN A;  4TV8 B;  3B6N A;  3JAL A;  3CCL F;  4C81 A;  3E20 B;  4M8I A;  5KMG B;  3JCM M;  4ERH A;  3J81 M;  1K73 H;  2LBX A;  3M1X A;  1VQ9 F;  3PLA C;  3P0Z A;  2MQE A;  1NQ3 A;  3FFM A;  4C82 A;  1H47 A;  4F6R A;  5HP8 A;  4I4T A;  4O4H B;  3JAK A;  2I6D A;  5LOV B;  1YQN A;  1DBF A;  1Q86 H;  3V7Q A;  3DC2 A;  5LXT B;  4X20 A;  3IKE A;  3CPW F;  4X3L A;  3CCM F;  1UFY A;  1TVK A;  3HKB A;  1COM A;  3NVK E;  3HKC A;  4ZI7 A;  1GO1 A;  1YGY A;  5J2U A;  1SZQ A;  4YJ3 A;  4YJ2 B;  4IIJ B;  5MN6 A;  2H8C A;  1VQL F;  1TUB A;  2BTO A;  5CA1 A;  3ZP7 A;  3WGK A;  4U3J B;  3WGN A;  2B33 A;  3Q8H A;  1KNJ A;  3OON A;  4ZHY B;  4BT4 A;  3CCS F;  3CD6 F;  3C8L A;  3CYP B;  3IMP A;  3CG6 A;  3FD5 A;  5FNV A;  5JH7 B;  1W58 1;  3RYH B;  1W59 A;  4TUY A;  5ITZ A;  3LFO A;  2QEX F;  2YXZ A;  3SIV A;  3O85 A;  3HKD B;  2Z1T A;  4ZOL A;  1PF5 A;  1H48 A;  1IV2 A;  4O4J B;  3GYQ A;  1PXW A;  4LNU B;  2OZB A;  4PWT A;  5LYJ B;  1ONI A;  1K8A H;  3JAS A;  3J80 M;  3OBY A;  3S0W A;  5KMG A;  3D01 A;  3VO8 A;  3GHZ A;  3LWO C;  3FBA A;  3N2K A;  2K1S A;  5AVM A;  5IJ9 A;  2P6Y A;  2CHT A;  4O4H A;  4X1Y A;  5LOV A;  2CZW A;  1GX1 A;  4I4T B;  3JAK B;  2VAW A;  2R75 1;  3CB2 A;  3CCJ F;  1Z5V A;  4RHA A;  2FC3 A;  3MQW A;  3VMF B;  1VQK F;  3RYF A;  5JQG A;  1E7K A;  2N48 A;  3JVH A;  1U3P A;  3CCV F;  5LXT A;  5J2T B;  2VAP A;  5BMV A;  4X1K A;  4X20 B;  4BT6 A;  3N2G A;  1J7H A;  5HY0 A;  5DCV A;  3HKB B;  1NMU B;  3ZP4 A;  3CME F;  3JAR B;  2KTU A;  3I3F A;  3HKC B;  4WBN A;  4R40 B;  3ZOP A;  3I55 F;  5J2U B;  1CK2 A;  4X1I B; 
#chains in the Genus database with same CATH homology
 1W40 A;  4BVQ A;  5HY2 A;  3N4Y A;  5GAN K;  3CMA F;  1GO0 A;  1W41 A;  2VGN A;  3CCL F;  3E20 B;  5FLX M;  1S72 F;  3JCM M;  1K73 H;  3J81 M;  5FJ4 C;  2LBX A;  1T0K B;  1Q81 H;  3CCQ F;  1W2B F;  1VQ9 F;  3PLA C;  1VQM F;  1VQ4 F;  3CC2 F;  3FFM A;  2I6D A;  3NVI B;  1VQ6 F;  3J7A R;  1VQ5 F;  1Q86 H;  3V7Q A;  3LWP C;  5G4U C;  3MCA B;  2WAL A;  4XCQ A;  3SIU A;  1YHQ F;  1QVF F;  3CPW F;  4X3L A;  5EWR A;  3CCM F;  1KQS F;  1X7P A;  4X3M A;  5HXU A;  5HXZ A;  3NVK E;  1YI2 F;  1GO1 A;  4NUT A;  4EI8 A;  5IT9 M;  3G6E F;  3G4S F;  1K9M H;  2HVY D;  5EO3 A;  1VQL F;  3N4Z A;  3RA5 A;  1CN7 A;  2OTL F;  2LBW A;  1KC8 H;  1YIT F;  2KG4 A;  2F9Z C;  3NK6 A;  1RA4 A;  3OBW A;  1KD1 H;  3CCS F;  3CD6 F;  4NQ3 A;  1NJI H;  4BVT A;  3CG6 A;  3NMU C;  3CCU F;  4BW0 B;  1VQO F;  1SDS A;  2FGY A;  1QVG F;  4LCK A;  3LWQ C;  3CC7 F;  1ZWZ A;  3IR9 A;  3LFO A;  1VQP F;  1Q82 H;  1VQ7 F;  3HJW C;  2QEX F;  3OW2 F;  1M1K H;  2VGM A;  3SIV A;  1W3E X;  3O85 A;  1Q7Y H;  1X7O A;  3CC4 F;  3HAX D;  2JNB A;  1H7M A;  4BVR A;  2OHW A;  1M90 H;  3E1Y A;  1PXW A;  3AGK A;  3GYQ A;  3JAM M;  1YJW F;  2OZB A;  3D00 A;  3WXM B;  1JJ2 F;  5HY1 A;  3LWV C;  1K8A H;  3J80 M;  1N8R H;  5GIP C;  3OBY A;  4EI7 A;  5GAP K;  3CXC F;  3LWO C;  5GIO C;  2QA4 F;  3V3T A;  4C4W C;  3LWR C;  3CCE F;  3G71 F;  2BO1 A;  4BY9 D;  1X52 A;  2CZW A;  3V7E A;  1W42 A;  1VQ8 F;  3ON1 A;  5A2Q M;  2AIF A;  3CCJ F;  2FC3 A;  3VMF B;  1VQK F;  4TZZ A;  5G4V C;  1YJ9 F;  1E7K A;  3VI6 A;  3RA6 A;  4EI9 A;  3CCV F;  1RLG A;  3NK7 A;  1GZ0 A;  4BVS A;  1DT9 A;  5HWE A;  1YIJ F;  1XBI A;  2ALE A;  1YJN F;  2QI2 A;  5HY0 A;  2KTV A;  5HY4 A;  3CCR F;  5GIN C;  2OTJ F;  1NMU B;  3I56 F;  3CME F;  3PAF A;  2KTU A;  5DCV A;  3CPQ A;  1IPA A;  3I55 F;  1CK2 A;  1VQN F;  2GLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...