1VQ9F

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq9F00
1RA4A 1SDSA 3V7EA 3J80M 5FLXM 1VQOF 1YHQF 1YI2F 3LWPC 3CMEF 3LWRC 3JAMM 2QA4F 1CN7A 3CC7F 1VQ6F 3V7QA 1Q7YH 3I55F 3HAXD 1YIJF 3NK7A 2OHWA 2KG4A 3CMAF 5A2QM 1VQKF 3CCSF 1K8AH 1QVGF 1KQSF 1KD1H 1GO1A 1VQ4F 2JNBA 3CCVF 5EWRA 1VQ9F 1W42A 2QEXF 4TZZA 1NMUB 1E7KA 3N4ZA 1YJWF 3MCAB 3CPQA 1K73H 1CK2A 2FC3A 3G71F 1VQ7F 1YJNF 3WXMB 3ON1A 1ZWZA 2OTLF 3VI6A 3FFMA 3N4YA 5EO3A 2LBWA 1X52A 1Q81H 1X7PA 2VGMA 4C4WC 3GYQA 3J81M 1YITF 1QVFF 5DCVA 3G6EF 1VQPF 1T0KB 1XBIA 3CCQF 5GAPK 1W2BF 2WALA 5GIOC 3IR9A 3HJWC 4LCKA 3O85A 1VQLF 3LWVC 3CCLF 3CCMF 4X3MA 2OZBA 1PXWA 3PAFA 3RA6A 3SIVA 1GZ0A 3CG6A 2OTJF 2AIFA 1RLGA 1IPAA 4X3LA 3CCUF 3CD6F 5GIPC 3OW2F 1VQNF 3J7AR 2I6DA 2LBXA 3CPWF 2BO1A 3E1YA 3VMFB 4BW0B 2KTVA 1JJ2F 3G4SF 1M90H 3NK6A 3CCEF 1X7OA 1VQMF 3RA5A 1W3EX 2HVYD 2CZWA 3CC4F 4BY9D 1M1KH 2ALEA 3NVKE 3AGKA 3CCJF 5G4UC 1GO0A 1W40A 3OBWA 5GANK 1H7MA 3PLAC 3I56F 3CXCF 3E20B 3LFOA 5GINC 5G4VC 3CC2F 3NMUC 3NVIB 5FJ4C 1Q86H 1VQ5F 1VQ8F 2KTUA 1YJ9F 4NUTA 1N8RH 2QI2A 5IT9M 2VGNA 3LWOC 1DT9A 1Q82H 3JCMM 3LWQC 1K9MH 1NJIH 3SIUA 1W41A 1KC8H 1S72F 3CCRF 3OBYA
chains in the Genus database with same CATH superfamily
1RA4A 1YI2F 5FLXM 3HKBB 1OFUA 4DRXB 3HKDB 3JALB 3VYUC 1W59A 4I4TA 3UT5A 1X25A 5B8FA 1W55A 4BT3A 2MQEA 3JASA 3FPIA 5HXUA 5JQGA 3I55F 1Q7YH 3HAXD 5EIBD 3C8LA 3K12A 4C82A 5KMGB 3CCSF 2RB9A 2HP0B 3LMEA 5BMVB 1QVGF 3TD5A 1KD1H 1GO1A 1UFYA 2B33A 2JNBA 4G88A 3CCVF 5LP6B 5EWRA 1VQ9F 2CHSA 2HRYA 3E22A 3MCAB 1YJWF 5C8YA 1K73H 2CVLA 5MN5A 2FC3A 3G71F 3B6NA 3T80A 3ON1A 3F0DA 1ZWZA 2OTLF 4O4LB 3VI6A 4I55A 5EO3A 5ITZB 5EIBC 3S0HA 4C81A 3IKFA 2Z1FA 4X1YB 1XHOA 3L7QA 4LNUB 3RYIB 2R751 2UYKA 4ZHWA 4C4WC 4BT6A 4F6RB 3GYQA 1QVFF 1XBIA 4TUYA 5GAPK 3JAKA 4WBNA 3F0FA 3JARA 2HX0A 2Q1YA 3LWVC 3CCLF 4R40B 1TUBA 3RYHA 1H48A 1IV3A 4C8IA 3R0PA 2EWCA 1GZ0A 3JALA 5IJ0A 2AIFA 3DC2A 2LBTA 2HS0A 3IEQA 4X3LA 3VOBA 5GIPC 1VQNF 4YJ3A 1W5AA 3WPXA 1DBFA 2G9IA 3WGNA 4EB6B 2AMTA 3HKCA 2KTVA 1RQ2A 1KNKA 3NK6A 1U3LA 1YGYA 2R6R1 3P4EA 4X1KA 5J2UB 3TD3A 5BMVA 2ALEA 2NMUA 3AGKA 5EB0A 5AVMA 3CCJF 1GO0A 5HY0A 1W40A 4ZOLB 1H7MA 3KJJA 4TV8A 3I3FA 5EZYB 4X20B 3I56F 3CXCF 2DYYA 5G4VC 5LP6C 1Q86H 1YQNA 2RHOA 3WGKA 4NUTA 4IHJA 3S06A 3F6MA 5MN4A 1CLIA 2CWJA 1NJIH 2UZHA 1W41A 3K0TA 3RYIA 4LNUA 1VK3A 1SDSA 3K2XA 5HP8A 2GLZA 3RYCA 3LWPC 4F6RA 2HS3A 4KWEA 3LWRC 2VAWA 3JAMM 4O2BB 5J2TB 1SZQA 3HKEA 2K1SA 5JVDB 2YYEA 1VQ6F 3KHNA 1W5EA 1FNJA 4DXDA 3NK7A 5JCOA 1Z5WA 1JFFA 4ZI7B 5JCOC 5KX5A 4U3JB 3WGMA 1W5BA 5CA0B 5EB1B 1Z5VA 2UYPA 1KQSF 4BVQA 1PF5A 1VQ4F 4O4JA 3GTZA 4BVSA 4G4ZA 5LXTB 2QEXF 5CB4B 1FSZA 4TZZA 1NMUB 1E7KA 5J2UA 2ZODA 1CK2A 3M1XA 3F0EA 4U39A 1VQ7F 4BVRA 3WXMB 1R1MA 1XV2A 1YJNF 1QU9A 4X20A 1W5FA 3ELCA 1QD9A 5HP7A 3HWUA 1JD1A 1X7PA 4HNAB 4YJ2B 3ZP7A 3J81M 3EORA 3IMPA 1TVKA 5LOVB 1YITF 5DCVA 3G6EF 3N2GB 1FFXA 1W2BF 2Z1UA 3VIUA 3ZO8A 5GIOC 3IR9A 3P0ZA 3RYFA 5IYZA 1PXWA 2OTJF 3WJRA 1IPAA 2HQSC 4B46A 3CD6F 3OW2F 3LDTA 2IG8A 4I50B 3CYQA 4O2AA 3VMFB 4ERHA 1JJ2F 2ZVYA 3CCEF 1X7OA 2UYNB 1IV1A 3N2KB 2ZAUA 3RA5A 4U3JA 2LCAA 5CA0A 3JATA 2OTMA 5G4UC 4EI7A 3OBWA 5GANK 4EI9A 1JN1A 3E20B 2Z01A 5LXTA 3HKBA 4DRXA 3HKDA 3NVIB 4FFBB 5FJ4C 3VOAA 1OAPA 5EYPB 3D00A 2KTUA 3ERNA 5CA1B 2IAFA 2QI2A 5IT9M 2VGNA 3LWOC 1DT9A 2DT4A 2CSLA 3M84A 3IEWA 1IV4A 5MN6A 1VQLF 1VQOF 1YHQF 5KMGA 4TV9B 5LYJB 2HP0A 5LA6B 5LOVA 4BT7A 3D01A 1U43A 3CYPB 2HP3A 2QA4F 4O4HB 3CC7F 5LP6A 3K14A 1NQ3A 3V7QA 4G4VA 3ZP4A 3QTYA 1YIJF 3C9SA 1QAHA 1SA0B 2HRUA 1Q8RA 2KG4A 3I7TA 3CMAF 3WGLA 3S0WA 3U0OA 1K8AH 4O4LA 4I50A 5ITZA 2I6RA 1IV2A 3UT5B 4RQOA 4X1YA 1T0AA 3V4DA 3ESJA 1W42A 3WJPA 3JASB 3RE3A 5JQGB 3N2KA 3N4ZA 4C8GA 3CPQA 3FD6A 4X1IB 3S03A 2BTQB 1KNJA 2PHNA 1H47A 1XRGA 3N4YA 4BVTA 2L26A 2GVIA 1Q81H 5EYPA 5HXZA 2RHLA 5CA1A 1VQPF 5C8YB 1RLUA 4EB6A 3MQWA 2GZLA 3IKEA 4I55B 1FNKA 3CCMF 3BYQA 4TV9A 3V3TA 4RHAA 1RLGA 3CCUF 3J7AR 2PMPA 2I6DA 4ZOLA 3CPWF 2CHTA 2H8CA 2BO1A 5EZYA 4C8EA 4NWOB 3JAKB 3WJQA 1GX1A 3KJKA 1M90H 2CW4A 3MBMA 1VQMF 2HVYD 1W3EX 4B45A 5HY4A 3CC4F 5IJ0B 3D54A 5IJ9B 3CB2A 4M8IA 4YJ3B 5FNVB 1VQVA 1W57A 3KE1A 1JY8A 4G4XA 3NMUC 3HKCB 2P6YA 4ZHYB 5JH7B 2RHJA 3JAWB 2H8EA 4O2BA 4X1IA 1VQ8F 4X1KB 5J2TA 1YJ9F 5EAZA 5JVDA 1N8RH 2ZOVA 2VAMA 3JCMM 3LWQC 1K9MH 3MDOA 3SIUA 2Z1TA 4TV8B 3CCRF 3V7EA 4ZI7A 3J80M 1VHAA 2BTOA 3LYBA 3CMEF 2AIZP 2YXZA 4BT5A 4ZK7A 4IHJB 2F9ZC 1CN7A 3F0GA 5HY1A 5CB4A 2FGYA 4IIJB 3FD5A 3VCZA 2OHWA 5GONB 3RYCB 5A2QM 1VQKF 3JVHA 4O4IB 2BTUA 2H6LA 3FBAA 4HNAA 3HKEB 4ZHQB 2RHHA 4YJ2A 2V9YA 4BT2A 4NQ3A 1J7HA 3VYSC 4B62A 3OONA 2UYJA 4E6EA 3N2GA 3GHZA 1JFFB 2VXYA 5KX5B 5IJ9A 3FFMA 5FNVA 2LBWA 1X52A 4O4JB 5HY2A 5JH7A 2VAPA 2VGMA 1COMA 3JAWA 4G4WA 1ONIA 3QHDA 4I4TB 1T0KB 1U40A 3CCQF 3MCQA 2QTPA 3P10A 3VYTC 2WALA 3HJWC 1UI9A 4LCKA 3O85A 4X3MA 2UYNA 3WGJA 5HWEA 2OZBA 3QUWA 3PAFA 3RA6A 3SIVA 3CG6A 3TD4A 3WPWA 4ZHVA 2LBXA 3S02A 2ZF8A 1TVKB 3HTNA 1VH8A 1ODEA 3E1YA 3ZOPA 1KC8H 1RQ7A 1FFXB 4BW0B 4FFBA 1U3PA 3VTIC 4IIJA 3RYFB 3G4SF 3C9UA 5IYZB 5GONA 3E22B 2Z1EA 2IQQA 3C9RA 2CZWA 4BY9D 1M1KH 4O4IA 4BT4A 4EI8A 3VO8A 3NVKE 2W8BC 2KGWA 2Q1XA 3PLAC 2N48A 4O2AB 3LFOA 4ZHQA 5GINC 3CC2F 3M4SA 5LYJA 4PWTA 5LA6A 3C9TA 3KIZA 4B5CA 2HS4A 1VQ5F 4XCQA 2ZVZA 3DDNA 4TUYB 4O4HA 3S0YA 3JATB 3Q8HA 1Q82H 4G4YA 1W581 4WBNB 3JARB 1SA0A 1S72F 1TUBB 3RYHB 3OBYA
chains in the Genus database with same CATH topology
1RA4A 1SDSA 3V7EA 3J80M 5FLXM 1VQOF 2GLZA 1YHQF 1YI2F 3LWPC 3CMEF 3LWRC 3JAMM 2QA4F 2F9ZC 1CN7A 3CC7F 5HY1A 1VQ6F 2FGYA 3V7QA 5HXUA 3I55F 1Q7YH 3HAXD 1YIJF 3NK7A 2OHWA 2KG4A 3CMAF 5A2QM 1VQKF 3CCSF 1K8AH 1QVGF 1KQSF 4BVQA 1KD1H 1GO1A 1VQ4F 2JNBA 4BVSA 3CCVF 5EWRA 1VQ9F 1W42A 2QEXF 4TZZA 1NMUB 4NQ3A 3N4ZA 1E7KA 1YJWF 3MCAB 3CPQA 1K73H 1CK2A 2FC3A 3G71F 1VQ7F 4BVRA 3WXMB 1YJNF 3ON1A 1ZWZA 2OTLF 3VI6A 3FFMA 3N4YA 5EO3A 2LBWA 1X52A 4BVTA 1Q81H 1X7PA 5HY2A 2VGMA 4C4WC 5HXZA 3GYQA 3J81M 1YITF 1QVFF 5DCVA 3G6EF 1VQPF 1T0KB 1XBIA 3CCQF 5GAPK 1W2BF 2WALA 5GIOC 3IR9A 3HJWC 4LCKA 3O85A 1VQLF 3LWVC 3CCLF 3CCMF 4X3MA 2OZBA 5HWEA 1PXWA 3PAFA 3RA6A 3SIVA 1GZ0A 3CG6A 2OTJF 2AIFA 3V3TA 1IPAA 1RLGA 4X3LA 3CCUF 3CD6F 5GIPC 3OW2F 1VQNF 3J7AR 2I6DA 2LBXA 3CPWF 2BO1A 3E1YA 3VMFB 4BW0B 2KTVA 1JJ2F 3G4SF 1M90H 3NK6A 3CCEF 1X7OA 1VQMF 3RA5A 1W3EX 2HVYD 2CZWA 5HY4A 3CC4F 4BY9D 1M1KH 2ALEA 3NVKE 3AGKA 4EI8A 3CCJF 5G4UC 4EI7A 1GO0A 5HY0A 1W40A 3OBWA 5GANK 4EI9A 1H7MA 3PLAC 3I56F 3CXCF 3E20B 3LFOA 5GINC 5G4VC 3CC2F 3NMUC 3NVIB 5FJ4C 1Q86H 1VQ5F 1VQ8F 3D00A 4XCQA 2KTUA 1YJ9F 4NUTA 1N8RH 2QI2A 5IT9M 2VGNA 3LWOC 1DT9A 1Q82H 3JCMM 3LWQC 1K9MH 1NJIH 3SIUA 1W41A 1KC8H 1S72F 3CCRF 3OBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RA4 A;  1SDS A;  3V7E A;  3J80 M;  5FLX M;  1VQO F;  1YHQ F;  1YI2 F;  3LWP C;  3CME F;  3LWR C;  3JAM M;  2QA4 F;  1CN7 A;  3CC7 F;  1VQ6 F;  3V7Q A;  1Q7Y H;  3I55 F;  3HAX D;  1YIJ F;  3NK7 A;  2OHW A;  2KG4 A;  3CMA F;  5A2Q M;  1VQK F;  3CCS F;  1K8A H;  1QVG F;  1KQS F;  1KD1 H;  1GO1 A;  1VQ4 F;  2JNB A;  3CCV F;  5EWR A;  1VQ9 F;  1W42 A;  2QEX F;  4TZZ A;  1NMU B;  1E7K A;  3N4Z A;  1YJW F;  3MCA B;  3CPQ A;  1K73 H;  1CK2 A;  2FC3 A;  3G71 F;  1VQ7 F;  1YJN F;  3WXM B;  3ON1 A;  1ZWZ A;  2OTL F;  3VI6 A;  3FFM A;  3N4Y A;  5EO3 A;  2LBW A;  1X52 A;  1Q81 H;  1X7P A;  2VGM A;  4C4W C;  3GYQ A;  3J81 M;  1YIT F;  1QVF F;  5DCV A;  3G6E F;  1VQP F;  1T0K B;  1XBI A;  3CCQ F;  5GAP K;  1W2B F;  2WAL A;  5GIO C;  3IR9 A;  3HJW C;  4LCK A;  3O85 A;  1VQL F;  3LWV C;  3CCL F;  3CCM F;  4X3M A;  2OZB A;  1PXW A;  3PAF A;  3RA6 A;  3SIV A;  1GZ0 A;  3CG6 A;  2OTJ F;  2AIF A;  1RLG A;  1IPA A;  4X3L A;  3CCU F;  3CD6 F;  5GIP C;  3OW2 F;  1VQN F;  3J7A R;  2I6D A;  2LBX A;  3CPW F;  2BO1 A;  3E1Y A;  3VMF B;  4BW0 B;  2KTV A;  1JJ2 F;  3G4S F;  1M90 H;  3NK6 A;  3CCE F;  1X7O A;  1VQM F;  3RA5 A;  1W3E X;  2HVY D;  2CZW A;  3CC4 F;  4BY9 D;  1M1K H;  2ALE A;  3NVK E;  3AGK A;  3CCJ F;  5G4U C;  1GO0 A;  1W40 A;  3OBW A;  5GAN K;  1H7M A;  3PLA C;  3I56 F;  3CXC F;  3E20 B;  3LFO A;  5GIN C;  5G4V C;  3CC2 F;  3NMU C;  3NVI B;  5FJ4 C;  1Q86 H;  1VQ5 F;  1VQ8 F;  2KTU A;  1YJ9 F;  4NUT A;  1N8R H;  2QI2 A;  5IT9 M;  2VGN A;  3LWO C;  1DT9 A;  1Q82 H;  3JCM M;  3LWQ C;  1K9M H;  1NJI H;  3SIU A;  1W41 A;  1KC8 H;  1S72 F;  3CCR F;  3OBY A; 
#chains in the Genus database with same CATH topology
 1RA4 A;  1YI2 F;  5FLX M;  3HKB B;  1OFU A;  4DRX B;  3HKD B;  3JAL B;  3VYU C;  1W59 A;  4I4T A;  3UT5 A;  1X25 A;  5B8F A;  1W55 A;  4BT3 A;  2MQE A;  3JAS A;  3FPI A;  5HXU A;  5JQG A;  3I55 F;  1Q7Y H;  3HAX D;  5EIB D;  3C8L A;  3K12 A;  4C82 A;  5KMG B;  3CCS F;  2RB9 A;  2HP0 B;  3LME A;  5BMV B;  1QVG F;  3TD5 A;  1KD1 H;  1GO1 A;  1UFY A;  2B33 A;  2JNB A;  4G88 A;  3CCV F;  5LP6 B;  5EWR A;  1VQ9 F;  2CHS A;  2HRY A;  3E22 A;  3MCA B;  1YJW F;  5C8Y A;  1K73 H;  2CVL A;  5MN5 A;  2FC3 A;  3G71 F;  3B6N A;  3T80 A;  3ON1 A;  3F0D A;  1ZWZ A;  2OTL F;  4O4L B;  3VI6 A;  4I55 A;  5EO3 A;  5ITZ B;  5EIB C;  3S0H A;  4C81 A;  3IKF A;  2Z1F A;  4X1Y B;  1XHO A;  3L7Q A;  4LNU B;  3RYI B;  2R75 1;  2UYK A;  4ZHW A;  4C4W C;  4BT6 A;  4F6R B;  3GYQ A;  1QVF F;  1XBI A;  4TUY A;  5GAP K;  3JAK A;  4WBN A;  3F0F A;  3JAR A;  2HX0 A;  2Q1Y A;  3LWV C;  3CCL F;  4R40 B;  1TUB A;  3RYH A;  1H48 A;  1IV3 A;  4C8I A;  3R0P A;  2EWC A;  1GZ0 A;  3JAL A;  5IJ0 A;  2AIF A;  3DC2 A;  2LBT A;  2HS0 A;  3IEQ A;  4X3L A;  3VOB A;  5GIP C;  1VQN F;  4YJ3 A;  1W5A A;  3WPX A;  1DBF A;  2G9I A;  3WGN A;  4EB6 B;  2AMT A;  3HKC A;  2KTV A;  1RQ2 A;  1KNK A;  3NK6 A;  1U3L A;  1YGY A;  2R6R 1;  3P4E A;  4X1K A;  5J2U B;  3TD3 A;  5BMV A;  2ALE A;  2NMU A;  3AGK A;  5EB0 A;  5AVM A;  3CCJ F;  1GO0 A;  5HY0 A;  1W40 A;  4ZOL B;  1H7M A;  3KJJ A;  4TV8 A;  3I3F A;  5EZY B;  4X20 B;  3I56 F;  3CXC F;  2DYY A;  5G4V C;  5LP6 C;  1Q86 H;  1YQN A;  2RHO A;  3WGK A;  4NUT A;  4IHJ A;  3S06 A;  3F6M A;  5MN4 A;  1CLI A;  2CWJ A;  1NJI H;  2UZH A;  1W41 A;  3K0T A;  3RYI A;  4LNU A;  1VK3 A;  1SDS A;  3K2X A;  5HP8 A;  2GLZ A;  3RYC A;  3LWP C;  4F6R A;  2HS3 A;  4KWE A;  3LWR C;  2VAW A;  3JAM M;  4O2B B;  5J2T B;  1SZQ A;  3HKE A;  2K1S A;  5JVD B;  2YYE A;  1VQ6 F;  3KHN A;  1W5E A;  1FNJ A;  4DXD A;  3NK7 A;  5JCO A;  1Z5W A;  1JFF A;  4ZI7 B;  5JCO C;  5KX5 A;  4U3J B;  3WGM A;  1W5B A;  5CA0 B;  5EB1 B;  1Z5V A;  2UYP A;  1KQS F;  4BVQ A;  1PF5 A;  1VQ4 F;  4O4J A;  3GTZ A;  4BVS A;  4G4Z A;  5LXT B;  2QEX F;  5CB4 B;  1FSZ A;  4TZZ A;  1NMU B;  1E7K A;  5J2U A;  2ZOD A;  1CK2 A;  3M1X A;  3F0E A;  4U39 A;  1VQ7 F;  4BVR A;  3WXM B;  1R1M A;  1XV2 A;  1YJN F;  1QU9 A;  4X20 A;  1W5F A;  3ELC A;  1QD9 A;  5HP7 A;  3HWU A;  1JD1 A;  1X7P A;  4HNA B;  4YJ2 B;  3ZP7 A;  3J81 M;  3EOR A;  3IMP A;  1TVK A;  5LOV B;  1YIT F;  5DCV A;  3G6E F;  3N2G B;  1FFX A;  1W2B F;  2Z1U A;  3VIU A;  3ZO8 A;  5GIO C;  3IR9 A;  3P0Z A;  3RYF A;  5IYZ A;  1PXW A;  2OTJ F;  3WJR A;  1IPA A;  2HQS C;  4B46 A;  3CD6 F;  3OW2 F;  3LDT A;  2IG8 A;  4I50 B;  3CYQ A;  4O2A A;  3VMF B;  4ERH A;  1JJ2 F;  2ZVY A;  3CCE F;  1X7O A;  2UYN B;  1IV1 A;  3N2K B;  2ZAU A;  3RA5 A;  4U3J A;  2LCA A;  5CA0 A;  3JAT A;  2OTM A;  5G4U C;  4EI7 A;  3OBW A;  5GAN K;  4EI9 A;  1JN1 A;  3E20 B;  2Z01 A;  5LXT A;  3HKB A;  4DRX A;  3HKD A;  3NVI B;  4FFB B;  5FJ4 C;  3VOA A;  1OAP A;  5EYP B;  3D00 A;  2KTU A;  3ERN A;  5CA1 B;  2IAF A;  2QI2 A;  5IT9 M;  2VGN A;  3LWO C;  1DT9 A;  2DT4 A;  2CSL A;  3M84 A;  3IEW A;  1IV4 A;  5MN6 A;  1VQL F;  1VQO F;  1YHQ F;  5KMG A;  4TV9 B;  5LYJ B;  2HP0 A;  5LA6 B;  5LOV A;  4BT7 A;  3D01 A;  1U43 A;  3CYP B;  2HP3 A;  2QA4 F;  4O4H B;  3CC7 F;  5LP6 A;  3K14 A;  1NQ3 A;  3V7Q A;  4G4V A;  3ZP4 A;  3QTY A;  1YIJ F;  3C9S A;  1QAH A;  1SA0 B;  2HRU A;  1Q8R A;  2KG4 A;  3I7T A;  3CMA F;  3WGL A;  3S0W A;  3U0O A;  1K8A H;  4O4L A;  4I50 A;  5ITZ A;  2I6R A;  1IV2 A;  3UT5 B;  4RQO A;  4X1Y A;  1T0A A;  3V4D A;  3ESJ A;  1W42 A;  3WJP A;  3JAS B;  3RE3 A;  5JQG B;  3N2K A;  3N4Z A;  4C8G A;  3CPQ A;  3FD6 A;  4X1I B;  3S03 A;  2BTQ B;  1KNJ A;  2PHN A;  1H47 A;  1XRG A;  3N4Y A;  4BVT A;  2L26 A;  2GVI A;  1Q81 H;  5EYP A;  5HXZ A;  2RHL A;  5CA1 A;  1VQP F;  5C8Y B;  1RLU A;  4EB6 A;  3MQW A;  2GZL A;  3IKE A;  4I55 B;  1FNK A;  3CCM F;  3BYQ A;  4TV9 A;  3V3T A;  4RHA A;  1RLG A;  3CCU F;  3J7A R;  2PMP A;  2I6D A;  4ZOL A;  3CPW F;  2CHT A;  2H8C A;  2BO1 A;  5EZY A;  4C8E A;  4NWO B;  3JAK B;  3WJQ A;  1GX1 A;  3KJK A;  1M90 H;  2CW4 A;  3MBM A;  1VQM F;  2HVY D;  1W3E X;  4B45 A;  5HY4 A;  3CC4 F;  5IJ0 B;  3D54 A;  5IJ9 B;  3CB2 A;  4M8I A;  4YJ3 B;  5FNV B;  1VQV A;  1W57 A;  3KE1 A;  1JY8 A;  4G4X A;  3NMU C;  3HKC B;  2P6Y A;  4ZHY B;  5JH7 B;  2RHJ A;  3JAW B;  2H8E A;  4O2B A;  4X1I A;  1VQ8 F;  4X1K B;  5J2T A;  1YJ9 F;  5EAZ A;  5JVD A;  1N8R H;  2ZOV A;  2VAM A;  3JCM M;  3LWQ C;  1K9M H;  3MDO A;  3SIU A;  2Z1T A;  4TV8 B;  3CCR F;  3V7E A;  4ZI7 A;  3J80 M;  1VHA A;  2BTO A;  3LYB A;  3CME F;  2AIZ P;  2YXZ A;  4BT5 A;  4ZK7 A;  4IHJ B;  2F9Z C;  1CN7 A;  3F0G A;  5HY1 A;  5CB4 A;  2FGY A;  4IIJ B;  3FD5 A;  3VCZ A;  2OHW A;  5GON B;  3RYC B;  5A2Q M;  1VQK F;  3JVH A;  4O4I B;  2BTU A;  2H6L A;  3FBA A;  4HNA A;  3HKE B;  4ZHQ B;  2RHH A;  4YJ2 A;  2V9Y A;  4BT2 A;  4NQ3 A;  1J7H A;  3VYS C;  4B62 A;  3OON A;  2UYJ A;  4E6E A;  3N2G A;  3GHZ A;  1JFF B;  2VXY A;  5KX5 B;  5IJ9 A;  3FFM A;  5FNV A;  2LBW A;  1X52 A;  4O4J B;  5HY2 A;  5JH7 A;  2VAP A;  2VGM A;  1COM A;  3JAW A;  4G4W A;  1ONI A;  3QHD A;  4I4T B;  1T0K B;  1U40 A;  3CCQ F;  3MCQ A;  2QTP A;  3P10 A;  3VYT C;  2WAL A;  3HJW C;  1UI9 A;  4LCK A;  3O85 A;  4X3M A;  2UYN A;  3WGJ A;  5HWE A;  2OZB A;  3QUW A;  3PAF A;  3RA6 A;  3SIV A;  3CG6 A;  3TD4 A;  3WPW A;  4ZHV A;  2LBX A;  3S02 A;  2ZF8 A;  1TVK B;  3HTN A;  1VH8 A;  1ODE A;  3E1Y A;  3ZOP A;  1KC8 H;  1RQ7 A;  1FFX B;  4BW0 B;  4FFB A;  1U3P A;  3VTI C;  4IIJ A;  3RYF B;  3G4S F;  3C9U A;  5IYZ B;  5GON A;  3E22 B;  2Z1E A;  2IQQ A;  3C9R A;  2CZW A;  4BY9 D;  1M1K H;  4O4I A;  4BT4 A;  4EI8 A;  3VO8 A;  3NVK E;  2W8B C;  2KGW A;  2Q1X A;  3PLA C;  2N48 A;  4O2A B;  3LFO A;  4ZHQ A;  5GIN C;  3CC2 F;  3M4S A;  5LYJ A;  4PWT A;  5LA6 A;  3C9T A;  3KIZ A;  4B5C A;  2HS4 A;  1VQ5 F;  4XCQ A;  2ZVZ A;  3DDN A;  4TUY B;  4O4H A;  3S0Y A;  3JAT B;  3Q8H A;  1Q82 H;  4G4Y A;  1W58 1;  4WBN B;  3JAR B;  1SA0 A;  1S72 F;  1TUB B;  3RYH B;  3OBY A; 
#chains in the Genus database with same CATH homology
 1RA4 A;  1SDS A;  3V7E A;  3J80 M;  5FLX M;  1VQO F;  2GLZ A;  1YHQ F;  1YI2 F;  3LWP C;  3CME F;  3LWR C;  3JAM M;  2QA4 F;  2F9Z C;  1CN7 A;  3CC7 F;  5HY1 A;  1VQ6 F;  2FGY A;  3V7Q A;  5HXU A;  3I55 F;  1Q7Y H;  3HAX D;  1YIJ F;  3NK7 A;  2OHW A;  2KG4 A;  3CMA F;  5A2Q M;  1VQK F;  3CCS F;  1K8A H;  1QVG F;  1KQS F;  4BVQ A;  1KD1 H;  1GO1 A;  1VQ4 F;  2JNB A;  4BVS A;  3CCV F;  5EWR A;  1VQ9 F;  1W42 A;  2QEX F;  4TZZ A;  1NMU B;  4NQ3 A;  3N4Z A;  1E7K A;  1YJW F;  3MCA B;  3CPQ A;  1K73 H;  1CK2 A;  2FC3 A;  3G71 F;  1VQ7 F;  4BVR A;  3WXM B;  1YJN F;  3ON1 A;  1ZWZ A;  2OTL F;  3VI6 A;  3FFM A;  3N4Y A;  5EO3 A;  2LBW A;  1X52 A;  4BVT A;  1Q81 H;  1X7P A;  5HY2 A;  2VGM A;  4C4W C;  5HXZ A;  3GYQ A;  3J81 M;  1YIT F;  1QVF F;  5DCV A;  3G6E F;  1VQP F;  1T0K B;  1XBI A;  3CCQ F;  5GAP K;  1W2B F;  2WAL A;  5GIO C;  3IR9 A;  3HJW C;  4LCK A;  3O85 A;  1VQL F;  3LWV C;  3CCL F;  3CCM F;  4X3M A;  2OZB A;  5HWE A;  1PXW A;  3PAF A;  3RA6 A;  3SIV A;  1GZ0 A;  3CG6 A;  2OTJ F;  2AIF A;  3V3T A;  1IPA A;  1RLG A;  4X3L A;  3CCU F;  3CD6 F;  5GIP C;  3OW2 F;  1VQN F;  3J7A R;  2I6D A;  2LBX A;  3CPW F;  2BO1 A;  3E1Y A;  3VMF B;  4BW0 B;  2KTV A;  1JJ2 F;  3G4S F;  1M90 H;  3NK6 A;  3CCE F;  1X7O A;  1VQM F;  3RA5 A;  1W3E X;  2HVY D;  2CZW A;  5HY4 A;  3CC4 F;  4BY9 D;  1M1K H;  2ALE A;  3NVK E;  3AGK A;  4EI8 A;  3CCJ F;  5G4U C;  4EI7 A;  1GO0 A;  5HY0 A;  1W40 A;  3OBW A;  5GAN K;  4EI9 A;  1H7M A;  3PLA C;  3I56 F;  3CXC F;  3E20 B;  3LFO A;  5GIN C;  5G4V C;  3CC2 F;  3NMU C;  3NVI B;  5FJ4 C;  1Q86 H;  1VQ5 F;  1VQ8 F;  3D00 A;  4XCQ A;  2KTU A;  1YJ9 F;  4NUT A;  1N8R H;  2QI2 A;  5IT9 M;  2VGN A;  3LWO C;  1DT9 A;  1Q82 H;  3JCM M;  3LWQ C;  1K9M H;  1NJI H;  3SIU A;  1W41 A;  1KC8 H;  1S72 F;  3CCR F;  3OBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...