2JNBA

Solution structure of rna-binding protein 15.5k
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords NHP2-like protein 1
publication title Functional Implications for a Prototypical K-Turn Binding Protein from Structural and Dynamical Studies of 15.5K
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2jnbA00
3PAFA 5FLXM 1RLGA 3CCQF 3VI6A 3NVKE 3ON1A 3CMEF 3LFOA 3CG6A 1VQ5F 3WXMB 1NMUB 2QI2A 3GYQA 3OBYA 2VGMA 3JAMM 1YITF 3E1YA 4X3LA 1VQPF 1KC8H 1VQ6F 5GINC 5EWRA 3G71F 5DCVA 3OBWA 1W41A 3CC4F 4LCKA 1Q86H 5GIPC 1NJIH 3LWQC 3OW2F 1VQ8F 2LBWA 1VQOF 3HJWC 5G4VC 2LBXA 1W3EX 1YI2F 3LWPC 3CCLF 3G6EF 1JJ2F 3NK6A 1VQKF 3N4ZA 1W42A 1N8RH 1VQNF 3CCUF 3VMFB 5GANK 1X52A 3CPQA 1SDSA 1Q82H 3JCMM 3O85A 3CXCF 1CN7A 5FJ4C 2BO1A 4C4WC 3I55F 1VQ9F 3CC7F 4BY9D 2OZBA 3E20B 2OHWA 3HAXD 1K8AH 3NK7A 1YHQF 5GAPK 2QA4F 3CCMF 1KQSF 1XBIA 1QVGF 3RA6A 1M90H 3CMAF 1QVFF 3G4SF 2I6DA 1X7PA 3LWRC 3J7AR 2FC3A 4X3MA 4BW0B 1VQMF 1YIJF 1CK2A 5EO3A 5G4UC 3RA5A 3NMUC 2KTVA 3NVIB 2KTUA 1PXWA 3CCJF 1S72F 3MCAB 5GIOC 1GZ0A 1Q81H 3SIUA 1RA4A 2OTJF 2JNBA 1VQLF 1E7KA 1IPAA 1VQ4F 1GO1A 3AGKA 3IR9A 1K9MH 2AIFA 1M1KH 3CCEF 1KD1H 2KG4A 3LWVC 1YJWF 3J81M 1H7MA 1X7OA 1YJNF 1ZWZA 1VQ7F 3CC2F 2VGNA 3PLAC 4TZZA 3I56F 2ALEA 3V7EA 2HVYD 1K73H 3LWOC 3FFMA 1W40A 2OTLF 1Q7YH 3CD6F 3J80M 3CCRF 3CCVF 2WALA 4NUTA 2QEXF 3SIVA 2CZWA 1GO0A 1W2BF 5IT9M 1YJ9F 3N4YA 5A2QM 3CPWF 3CCSF 3V7QA 1T0KB 1DT9A
chains in the Genus database with same CATH superfamily
4ZHWA 1ODEA 2Z01A 3NVKE 3S02A 2IG8A 2H8EA 4C8IA 5GONA 3WXMB 4BVQA 2HS0A 3GYQA 2HP3A 5J2UA 1Z5WA 3N2KA 1KNJA 3RYCA 1YITF 3F6MA 1KC8H 5G4UC 1IV1A 1VQ6F 5GINC 4EB6A 4IHJB 3OBWA 4ZHYB 3CC4F 4LCKA 1Q86H 4BVRA 4YJ2B 5GIPC 3P10A 1NJIH 3LWQC 2AIZP 4E6EA 3P0ZA 1TVKA 2LBXA 3KJJA 4C81A 3P4EA 5LYJB 5EAZA 1T0AA 4YJ3A 5B8FA 1CLIA 4EI7A 4FFBB 3C9TA 4ZHQB 2ZODA 4HNAA 1N8RH 4TV9B 3RYHB 5GANK 5EYPB 1W57A 4O4HA 1FNJA 4G4ZA 3TD3A 5CB4B 1Q82H 5FJ4C 3FPIA 3KE1A 4O4JA 4BY9D 1RLUA 2ZF8A 2KGWA 3HAXD 1X25A 3NK7A 3WGNA 3D54A 1ONIA 5J2UB 4ZI7B 2CHTA 1XHOA 4O2AA 5IJ9A 3LWRC 1W55A 3FD6A 2LBTA 4BT3A 3IKEA 4BW0B 4WBNB 1CK2A 1U3LA 3JASB 4B45A 2LCAA 5JVDA 5CA1A 1VHAA 3CYPB 4EI9A 4ZOLA 3WGMA 1PXWA 3QUWA 3CCJF 2Q1YA 3IEWA 1IPAA 1E7KA 4YJ3B 2CW4A 2F9ZC 3FD5A 4RQOA 2RB9A 1H7MA 4RHAA 4O4HB 1W5EA 3TD5A 5HWEA 4M8IA 4X1YA 4TZZA 3I56F 4DRXA 4I4TB 5HP8A 3LWOC 5JQGA 5FNVA 5IJ0A 3J80M 2BTQB 4NUTA 2QEXF 1H48A 3K0TA 4G4WA 1GO0A 3FBAA 5A2QM 3F0EA 3CPWF 3M4SA 2HRYA 3EORA 1DT9A 1RLGA 4O2AB 5IJ9B 4X1IA 3ON1A 3VYSC 1YGYA 3CMEF 5JH7A 1NMUB 4U3JA 5LA6A 3S0YA 5JVDB 1U3PA 4BT7A 2NMUA 5KMGA 3G71F 5DCVA 4I50A 3S03A 3VO8A 3HJWC 3HKEB 4G4YA 3D01A 5KX5A 1JJ2F 3GTZA 4F6RA 3NK6A 1OAPA 4X1KB 4X1YB 3MDOA 3K14A 1VQNF 3CCUF 4ERHA 4O4IA 1VQVA 3CPQA 1NQ3A 1SDSA 5HXUA 2V9YA 3O85A 5J2TB 1W5AA 1CN7A 4TUYA 2BO1A 4R40B 1W5BA 4BT2A 2H8CA 1H47A 3E20B 2VAMA 2BTUA 1XBIA 2YYEA 2PHNA 3K12A 2P6YA 4U3JB 1QVGF 1QU9A 5LA6B 3HKDA 3JAWB 2ZVYA 3VOAA 4O4LA 1JN1A 3JARA 2IQQA 5EO3A 3VOBA 5CA0B 1R1MA 5KMGB 1FFXB 5MN6A 5AVMA 2N48A 3S0HA 1GX1A 3OONA 2KTUA 4I50B 5LP6B 1S72F 3MCAB 4PWTA 1GZ0A 3V4DA 3VYTC 1Q81H 2UZHA 3SIUA 2OTJF 3RYIB 1J7HA 2YXZA 1GO1A 2R6R1 3AGKA 3HKBA 5KX5B 1K9MH 4F6RB 1M1KH 1W581 1PF5A 5GONB 2W8BC 5EIBC 4LNUA 1IV4A 3N2KB 3RE3A 3ERNA 1X7OA 3RYCB 3WGKA 3HKCA 3I3FA 2CVLA 3JALA 1K73H 4TUYB 1W40A 1Q7YH 4EB6B 3CD6F 1RQ7A 3CCVF 3MCQA 1FNKA 2ZVZA 2Q1XA 2CZWA 4BT4A 1YQNA 1W2BF 5IT9M 5MN5A 3N4YA 1TVKB 3CCSF 3VIUA 2DT4A 3M1XA 3VI6A 5LXTA 3F0FA 3LFOA 3CG6A 2Z1EA 3C9RA 4HNAB 3DC2A 2GZLA 2K1SA 3OBYA 2VGMA 3ZP4A 3JAKA 2HP0A 5IYZA 2VXYA 1U43A 1VK3A 3JAMM 5HY2A 1VQPF 3KIZA 5EWRA 4NWOB 3QTYA 2UYNA 2HQSC 3JATA 3WJQA 2HS3A 4O4JB 2AMTA 1IV2A 3MQWA 3HKBB 3C8LA 1JFFA 2VAPA 3OW2F 2LBWA 1VQOF 1QD9A 3KHNA 4C8EA 5HY0A 3CCLF 5LOVA 1JY8A 3HKCB 4KWEA 3JALB 1VQKF 3T80A 4I55A 3LDTA 5CA1B 5MN4A 4ZOLB 1Z5VA 3ESJA 2MQEA 3ELCA 2VAWA 4C4WC 3I55F 3CC7F 2OZBA 3E22A 2OHWA 1K8AH 3WPWA 4YJ2A 3N2GA 1YHQF 1KQSF 3WGLA 1SA0A 1W5FA 4BT6A 2HRUA 3RA6A 1XV2A 4BVTA 1M90H 4O2BA 3G4SF 3JAKB 2I6DA 4BT5A 1X7PA 2QTPA 3KJKA 2BTOA 3GHZA 3CB2A 4DRXB 4X3MA 1UI9A 1VQMF 3TD4A 4IIJA 2H6LA 5JQGB 5FNVB 4TV9A 5LP6C 3VCZA 2UYNB 5IJ0B 3RA5A 5JCOC 1COMA 2KTVA 3R0PA 3NVIB 1JFFB 2CSLA 5EIBD 5CB4A 4ZK7A 1RA4A 4G4XA 3C9SA 4TV8A 3WPXA 3I7TA 3F0DA 1VQLF 5LOVB 3WJPA 1VQ4F 4X1IB 2AIFA 3ZOPA 3HWUA 1TUBA 5JH7B 3MBMA 3LWVC 3UT5A 1KNKA 1YJWF 4ZI7A 4I55B 3J81M 1ZWZA 3K2XA 2ZOVA 2VGNA 2ALEA 2ZAUA 3HTNA 4B62A 4WBNA 2HVYD 3V7EA 3JASA 5ITZA 2OTLF 2EWCA 2WALA 4C82A 3E22B 1XRGA 5BMVA 3N2GB 2I6RA 1YJ9F 2GLZA 1SA0B 2UYJA 2RHHA 1VH8A 5EZYA 3RYFA 1T0KB 4O2BB 3PAFA 5FLXM 5HXZA 3CCQF 2UYPA 5HY4A 2CWJA 1OFUA 1VQ5F 2QI2A 4IIJB 3Q8HA 4O4IB 1QAHA 2Z1TA 2UYKA 3E1YA 4X3LA 3LMEA 4NQ3A 4I4TA 3C9UA 2FGYA 2Z1UA 4EI8A 1W41A 4TV8B 2R751 3CYQA 3WJRA 3D00A 1VQ8F 1TUBB 5G4VC 1W3EX 3UT5B 1YI2F 3LWPC 3ZO8A 2B33A 3LYBA 3G6EF 4X20A 3HKDB 2PMPA 4O4LB 3JARB 3BYQA 3IMPA 3N4ZA 1W42A 3JVHA 3VMFB 5ITZB 1X52A 4ZHVA 3U0OA 5BMVB 3M84A 3JCMM 3CXCF 5HY1A 1SZQA 3IEQA 4B46A 5EZYB 1RQ2A 3RYFB 1VQ9F 2RHLA 3F0GA 5C8YA 5GAPK 3V3TA 3CCMF 2QA4F 4LNUB 2GVIA 3VTIC 3HKEA 3CMAF 1QVFF 3DDNA 3J7AR 1W59A 4B5CA 2FC3A 4X1KA 3S06A 1YIJF 4XCQA 1FSZA 1DBFA 3NMUC 3VYUC 3QHDA 2RHJA 4G4VA 1U40A 1IV3A 2DYYA 4DXDA 1JD1A 5J2TA 5GIOC 2L26A 2IAFA 5EB0A 4IHJA 2JNBA 2RHOA 4X20B 3IR9A 5LXTB 3CCEF 5EB1B 1KD1H 2KG4A 2CHSA 2Z1FA 1UFYA 1Q8RA 2HX0A 2HP0B 5HP7A 5IYZB 5LYJA 1YJNF 2G9IA 3JAWA 3ZP7A 3CC2F 1VQ7F 4BVSA 3PLAC 4FFBA 4ZHQA 4U39A 3S0WA 5CA0A 3FFMA 3JATB 3RYHA 5EYPA 3L7QA 4G88A 1FFXA 3IKFA 3CCRF 3SIVA 3B6NA 5C8YB 4C8GA 5LP6A 5JCOA 3WGJA 3V7QA 2HS4A 3RYIA 2OTMA
chains in the Genus database with same CATH topology
3PAFA 5FLXM 1RLGA 5HXZA 3CCQF 3VI6A 5HY4A 3NVKE 3ON1A 3CMEF 3LFOA 3CG6A 4BVQA 3WXMB 1NMUB 1VQ5F 2QI2A 3GYQA 3OBYA 2VGMA 3JAMM 5HY2A 1YITF 3E1YA 4X3LA 1VQPF 1KC8H 1VQ6F 4NQ3A 5GINC 5EWRA 3G71F 5DCVA 2FGYA 4EI8A 3OBWA 1W41A 3CC4F 4LCKA 1Q86H 4BVRA 5GIPC 3D00A 3LWQC 3OW2F 1NJIH 1VQ8F 2LBWA 1VQOF 3HJWC 5G4VC 2LBXA 1W3EX 1YI2F 5HY0A 3LWPC 3CCLF 3G6EF 1JJ2F 3NK6A 4EI7A 1VQKF 3N4ZA 1W42A 1N8RH 1VQNF 3CCUF 3VMFB 5GANK 1X52A 3CPQA 1SDSA 1Q82H 5HXUA 3JCMM 3O85A 3CXCF 5HY1A 1CN7A 5FJ4C 2BO1A 4C4WC 3I55F 1VQ9F 3CC7F 4BY9D 2OZBA 3E20B 2OHWA 3HAXD 1K8AH 3NK7A 1YHQF 5GAPK 3V3TA 3CCMF 2QA4F 1KQSF 1XBIA 1QVGF 3RA6A 4BVTA 1M90H 3CMAF 1QVFF 3G4SF 2I6DA 1X7PA 3LWRC 3J7AR 2FC3A 4X3MA 4BW0B 1VQMF 1YIJF 1CK2A 5EO3A 5G4UC 4XCQA 3RA5A 3NMUC 2KTVA 4EI9A 3NVIB 2KTUA 1PXWA 3CCJF 1S72F 3MCAB 5GIOC 1GZ0A 1Q81H 3SIUA 1RA4A 2OTJF 2JNBA 1VQLF 1E7KA 1IPAA 1VQ4F 1GO1A 3AGKA 3IR9A 1K9MH 2AIFA 1M1KH 3CCEF 1KD1H 2F9ZC 2KG4A 3LWVC 1YJWF 3J81M 1H7MA 1X7OA 1YJNF 1ZWZA 5HWEA 1VQ7F 3CC2F 2VGNA 4BVSA 3PLAC 4TZZA 3I56F 2ALEA 3V7EA 2HVYD 1K73H 3LWOC 3FFMA 1W40A 2OTLF 1Q7YH 3CD6F 3J80M 3CCRF 3CCVF 2WALA 4NUTA 2QEXF 3SIVA 2CZWA 1GO0A 1W2BF 5IT9M 1YJ9F 3N4YA 5A2QM 2GLZA 3CPWF 3CCSF 3V7QA 1T0KB 1DT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAF A;  5FLX M;  1RLG A;  3CCQ F;  3VI6 A;  3NVK E;  3ON1 A;  3CME F;  3LFO A;  3CG6 A;  1VQ5 F;  3WXM B;  1NMU B;  2QI2 A;  3GYQ A;  3OBY A;  2VGM A;  3JAM M;  1YIT F;  3E1Y A;  4X3L A;  1VQP F;  1KC8 H;  1VQ6 F;  5GIN C;  5EWR A;  3G71 F;  5DCV A;  3OBW A;  1W41 A;  3CC4 F;  4LCK A;  1Q86 H;  5GIP C;  1NJI H;  3LWQ C;  3OW2 F;  1VQ8 F;  2LBW A;  1VQO F;  3HJW C;  5G4V C;  2LBX A;  1W3E X;  1YI2 F;  3LWP C;  3CCL F;  3G6E F;  1JJ2 F;  3NK6 A;  1VQK F;  3N4Z A;  1W42 A;  1N8R H;  1VQN F;  3CCU F;  3VMF B;  5GAN K;  1X52 A;  3CPQ A;  1SDS A;  1Q82 H;  3JCM M;  3O85 A;  3CXC F;  1CN7 A;  5FJ4 C;  2BO1 A;  4C4W C;  3I55 F;  1VQ9 F;  3CC7 F;  4BY9 D;  2OZB A;  3E20 B;  2OHW A;  3HAX D;  1K8A H;  3NK7 A;  1YHQ F;  5GAP K;  2QA4 F;  3CCM F;  1KQS F;  1XBI A;  1QVG F;  3RA6 A;  1M90 H;  3CMA F;  1QVF F;  3G4S F;  2I6D A;  1X7P A;  3LWR C;  3J7A R;  2FC3 A;  4X3M A;  4BW0 B;  1VQM F;  1YIJ F;  1CK2 A;  5EO3 A;  5G4U C;  3RA5 A;  3NMU C;  2KTV A;  3NVI B;  2KTU A;  1PXW A;  3CCJ F;  1S72 F;  3MCA B;  5GIO C;  1GZ0 A;  1Q81 H;  3SIU A;  1RA4 A;  2OTJ F;  2JNB A;  1VQL F;  1E7K A;  1IPA A;  1VQ4 F;  1GO1 A;  3AGK A;  3IR9 A;  1K9M H;  2AIF A;  1M1K H;  3CCE F;  1KD1 H;  2KG4 A;  3LWV C;  1YJW F;  3J81 M;  1H7M A;  1X7O A;  1YJN F;  1ZWZ A;  1VQ7 F;  3CC2 F;  2VGN A;  3PLA C;  4TZZ A;  3I56 F;  2ALE A;  3V7E A;  2HVY D;  1K73 H;  3LWO C;  3FFM A;  1W40 A;  2OTL F;  1Q7Y H;  3CD6 F;  3J80 M;  3CCR F;  3CCV F;  2WAL A;  4NUT A;  2QEX F;  3SIV A;  2CZW A;  1GO0 A;  1W2B F;  5IT9 M;  1YJ9 F;  3N4Y A;  5A2Q M;  3CPW F;  3CCS F;  3V7Q A;  1T0K B;  1DT9 A; 
#chains in the Genus database with same CATH topology
 4ZHW A;  1ODE A;  2Z01 A;  3NVK E;  3S02 A;  2IG8 A;  2H8E A;  4C8I A;  5GON A;  3WXM B;  4BVQ A;  2HS0 A;  3GYQ A;  2HP3 A;  5J2U A;  1Z5W A;  3N2K A;  1KNJ A;  3RYC A;  1YIT F;  3F6M A;  1KC8 H;  5G4U C;  1IV1 A;  1VQ6 F;  5GIN C;  4EB6 A;  4IHJ B;  3OBW A;  4ZHY B;  3CC4 F;  4LCK A;  1Q86 H;  4BVR A;  4YJ2 B;  5GIP C;  3P10 A;  1NJI H;  3LWQ C;  2AIZ P;  4E6E A;  3P0Z A;  1TVK A;  2LBX A;  3KJJ A;  4C81 A;  3P4E A;  5LYJ B;  5EAZ A;  1T0A A;  4YJ3 A;  5B8F A;  1CLI A;  4EI7 A;  4FFB B;  3C9T A;  4ZHQ B;  2ZOD A;  4HNA A;  1N8R H;  4TV9 B;  3RYH B;  5GAN K;  5EYP B;  1W57 A;  4O4H A;  1FNJ A;  4G4Z A;  3TD3 A;  5CB4 B;  1Q82 H;  5FJ4 C;  3FPI A;  3KE1 A;  4O4J A;  4BY9 D;  1RLU A;  2ZF8 A;  2KGW A;  3HAX D;  1X25 A;  3NK7 A;  3WGN A;  3D54 A;  1ONI A;  5J2U B;  4ZI7 B;  2CHT A;  1XHO A;  4O2A A;  5IJ9 A;  3LWR C;  1W55 A;  3FD6 A;  2LBT A;  4BT3 A;  3IKE A;  4BW0 B;  4WBN B;  1CK2 A;  1U3L A;  3JAS B;  4B45 A;  2LCA A;  5JVD A;  5CA1 A;  1VHA A;  3CYP B;  4EI9 A;  4ZOL A;  3WGM A;  1PXW A;  3QUW A;  3CCJ F;  2Q1Y A;  3IEW A;  1IPA A;  1E7K A;  4YJ3 B;  2CW4 A;  2F9Z C;  3FD5 A;  4RQO A;  2RB9 A;  1H7M A;  4RHA A;  4O4H B;  1W5E A;  3TD5 A;  5HWE A;  4M8I A;  4X1Y A;  4TZZ A;  3I56 F;  4DRX A;  4I4T B;  5HP8 A;  3LWO C;  5JQG A;  5FNV A;  5IJ0 A;  3J80 M;  2BTQ B;  4NUT A;  2QEX F;  1H48 A;  3K0T A;  4G4W A;  1GO0 A;  3FBA A;  5A2Q M;  3F0E A;  3CPW F;  3M4S A;  2HRY A;  3EOR A;  1DT9 A;  1RLG A;  4O2A B;  5IJ9 B;  4X1I A;  3ON1 A;  3VYS C;  1YGY A;  3CME F;  5JH7 A;  1NMU B;  4U3J A;  5LA6 A;  3S0Y A;  5JVD B;  1U3P A;  4BT7 A;  2NMU A;  5KMG A;  3G71 F;  5DCV A;  4I50 A;  3S03 A;  3VO8 A;  3HJW C;  3HKE B;  4G4Y A;  3D01 A;  5KX5 A;  1JJ2 F;  3GTZ A;  4F6R A;  3NK6 A;  1OAP A;  4X1K B;  4X1Y B;  3MDO A;  3K14 A;  1VQN F;  3CCU F;  4ERH A;  4O4I A;  1VQV A;  3CPQ A;  1NQ3 A;  1SDS A;  5HXU A;  2V9Y A;  3O85 A;  5J2T B;  1W5A A;  1CN7 A;  4TUY A;  2BO1 A;  4R40 B;  1W5B A;  4BT2 A;  2H8C A;  1H47 A;  3E20 B;  2VAM A;  2BTU A;  1XBI A;  2YYE A;  2PHN A;  3K12 A;  2P6Y A;  4U3J B;  1QVG F;  1QU9 A;  5LA6 B;  3HKD A;  3JAW B;  2ZVY A;  3VOA A;  4O4L A;  1JN1 A;  3JAR A;  2IQQ A;  5EO3 A;  3VOB A;  5CA0 B;  1R1M A;  5KMG B;  1FFX B;  5MN6 A;  5AVM A;  2N48 A;  3S0H A;  1GX1 A;  3OON A;  2KTU A;  4I50 B;  5LP6 B;  1S72 F;  3MCA B;  4PWT A;  1GZ0 A;  3V4D A;  3VYT C;  1Q81 H;  2UZH A;  3SIU A;  2OTJ F;  3RYI B;  1J7H A;  2YXZ A;  1GO1 A;  2R6R 1;  3AGK A;  3HKB A;  5KX5 B;  1K9M H;  4F6R B;  1M1K H;  1W58 1;  1PF5 A;  5GON B;  2W8B C;  5EIB C;  4LNU A;  1IV4 A;  3N2K B;  3RE3 A;  3ERN A;  1X7O A;  3RYC B;  3WGK A;  3HKC A;  3I3F A;  2CVL A;  3JAL A;  1K73 H;  4TUY B;  1W40 A;  1Q7Y H;  4EB6 B;  3CD6 F;  1RQ7 A;  3CCV F;  3MCQ A;  1FNK A;  2ZVZ A;  2Q1X A;  2CZW A;  4BT4 A;  1YQN A;  1W2B F;  5IT9 M;  5MN5 A;  3N4Y A;  1TVK B;  3CCS F;  3VIU A;  2DT4 A;  3M1X A;  3VI6 A;  5LXT A;  3F0F A;  3LFO A;  3CG6 A;  2Z1E A;  3C9R A;  4HNA B;  3DC2 A;  2GZL A;  2K1S A;  3OBY A;  2VGM A;  3ZP4 A;  3JAK A;  2HP0 A;  5IYZ A;  2VXY A;  1U43 A;  1VK3 A;  3JAM M;  5HY2 A;  1VQP F;  3KIZ A;  5EWR A;  4NWO B;  3QTY A;  2UYN A;  2HQS C;  3JAT A;  3WJQ A;  2HS3 A;  4O4J B;  2AMT A;  1IV2 A;  3MQW A;  3HKB B;  3C8L A;  1JFF A;  2VAP A;  3OW2 F;  2LBW A;  1VQO F;  1QD9 A;  3KHN A;  4C8E A;  5HY0 A;  3CCL F;  5LOV A;  1JY8 A;  3HKC B;  4KWE A;  3JAL B;  1VQK F;  3T80 A;  4I55 A;  3LDT A;  5CA1 B;  5MN4 A;  4ZOL B;  1Z5V A;  3ESJ A;  2MQE A;  3ELC A;  2VAW A;  4C4W C;  3I55 F;  3CC7 F;  2OZB A;  3E22 A;  2OHW A;  1K8A H;  3WPW A;  4YJ2 A;  3N2G A;  1YHQ F;  1KQS F;  3WGL A;  1SA0 A;  1W5F A;  4BT6 A;  2HRU A;  3RA6 A;  1XV2 A;  4BVT A;  1M90 H;  4O2B A;  3G4S F;  3JAK B;  2I6D A;  4BT5 A;  1X7P A;  2QTP A;  3KJK A;  2BTO A;  3GHZ A;  3CB2 A;  4DRX B;  4X3M A;  1UI9 A;  1VQM F;  3TD4 A;  4IIJ A;  2H6L A;  5JQG B;  5FNV B;  4TV9 A;  5LP6 C;  3VCZ A;  2UYN B;  5IJ0 B;  3RA5 A;  5JCO C;  1COM A;  2KTV A;  3R0P A;  3NVI B;  1JFF B;  2CSL A;  5EIB D;  5CB4 A;  4ZK7 A;  1RA4 A;  4G4X A;  3C9S A;  4TV8 A;  3WPX A;  3I7T A;  3F0D A;  1VQL F;  5LOV B;  3WJP A;  1VQ4 F;  4X1I B;  2AIF A;  3ZOP A;  3HWU A;  1TUB A;  5JH7 B;  3MBM A;  3LWV C;  3UT5 A;  1KNK A;  1YJW F;  4ZI7 A;  4I55 B;  3J81 M;  1ZWZ A;  3K2X A;  2ZOV A;  2VGN A;  2ALE A;  2ZAU A;  3HTN A;  4B62 A;  4WBN A;  2HVY D;  3V7E A;  3JAS A;  5ITZ A;  2OTL F;  2EWC A;  2WAL A;  4C82 A;  3E22 B;  1XRG A;  5BMV A;  3N2G B;  2I6R A;  1YJ9 F;  2GLZ A;  1SA0 B;  2UYJ A;  2RHH A;  1VH8 A;  5EZY A;  3RYF A;  1T0K B;  4O2B B;  3PAF A;  5FLX M;  5HXZ A;  3CCQ F;  2UYP A;  5HY4 A;  2CWJ A;  1OFU A;  1VQ5 F;  2QI2 A;  4IIJ B;  3Q8H A;  4O4I B;  1QAH A;  2Z1T A;  2UYK A;  3E1Y A;  4X3L A;  3LME A;  4NQ3 A;  4I4T A;  3C9U A;  2FGY A;  2Z1U A;  4EI8 A;  1W41 A;  4TV8 B;  2R75 1;  3CYQ A;  3WJR A;  3D00 A;  1VQ8 F;  1TUB B;  5G4V C;  1W3E X;  3UT5 B;  1YI2 F;  3LWP C;  3ZO8 A;  2B33 A;  3LYB A;  3G6E F;  4X20 A;  3HKD B;  2PMP A;  4O4L B;  3JAR B;  3BYQ A;  3IMP A;  3N4Z A;  1W42 A;  3JVH A;  3VMF B;  5ITZ B;  1X52 A;  4ZHV A;  3U0O A;  5BMV B;  3M84 A;  3JCM M;  3CXC F;  5HY1 A;  1SZQ A;  3IEQ A;  4B46 A;  5EZY B;  1RQ2 A;  3RYF B;  1VQ9 F;  2RHL A;  3F0G A;  5C8Y A;  5GAP K;  3V3T A;  3CCM F;  2QA4 F;  4LNU B;  2GVI A;  3VTI C;  3HKE A;  3CMA F;  1QVF F;  3DDN A;  3J7A R;  1W59 A;  4B5C A;  2FC3 A;  4X1K A;  3S06 A;  1YIJ F;  4XCQ A;  1FSZ A;  1DBF A;  3NMU C;  3VYU C;  3QHD A;  2RHJ A;  4G4V A;  1U40 A;  1IV3 A;  2DYY A;  4DXD A;  1JD1 A;  5J2T A;  5GIO C;  2L26 A;  2IAF A;  5EB0 A;  4IHJ A;  2JNB A;  2RHO A;  4X20 B;  3IR9 A;  5LXT B;  3CCE F;  5EB1 B;  1KD1 H;  2KG4 A;  2CHS A;  2Z1F A;  1UFY A;  1Q8R A;  2HX0 A;  2HP0 B;  5HP7 A;  5IYZ B;  5LYJ A;  1YJN F;  2G9I A;  3JAW A;  3ZP7 A;  3CC2 F;  1VQ7 F;  4BVS A;  3PLA C;  4FFB A;  4ZHQ A;  4U39 A;  3S0W A;  5CA0 A;  3FFM A;  3JAT B;  3RYH A;  5EYP A;  3L7Q A;  4G88 A;  1FFX A;  3IKF A;  3CCR F;  3SIV A;  3B6N A;  5C8Y B;  4C8G A;  5LP6 A;  5JCO A;  3WGJ A;  3V7Q A;  2HS4 A;  3RYI A;  2OTM A; 
#chains in the Genus database with same CATH homology
 3PAF A;  5FLX M;  1RLG A;  5HXZ A;  3CCQ F;  3VI6 A;  5HY4 A;  3NVK E;  3ON1 A;  3CME F;  3LFO A;  3CG6 A;  4BVQ A;  3WXM B;  1NMU B;  1VQ5 F;  2QI2 A;  3GYQ A;  3OBY A;  2VGM A;  3JAM M;  5HY2 A;  1YIT F;  3E1Y A;  4X3L A;  1VQP F;  1KC8 H;  1VQ6 F;  4NQ3 A;  5GIN C;  5EWR A;  3G71 F;  5DCV A;  2FGY A;  4EI8 A;  3OBW A;  1W41 A;  3CC4 F;  4LCK A;  1Q86 H;  4BVR A;  5GIP C;  3D00 A;  3LWQ C;  3OW2 F;  1NJI H;  1VQ8 F;  2LBW A;  1VQO F;  3HJW C;  5G4V C;  2LBX A;  1W3E X;  1YI2 F;  5HY0 A;  3LWP C;  3CCL F;  3G6E F;  1JJ2 F;  3NK6 A;  4EI7 A;  1VQK F;  3N4Z A;  1W42 A;  1N8R H;  1VQN F;  3CCU F;  3VMF B;  5GAN K;  1X52 A;  3CPQ A;  1SDS A;  1Q82 H;  5HXU A;  3JCM M;  3O85 A;  3CXC F;  5HY1 A;  1CN7 A;  5FJ4 C;  2BO1 A;  4C4W C;  3I55 F;  1VQ9 F;  3CC7 F;  4BY9 D;  2OZB A;  3E20 B;  2OHW A;  3HAX D;  1K8A H;  3NK7 A;  1YHQ F;  5GAP K;  3V3T A;  3CCM F;  2QA4 F;  1KQS F;  1XBI A;  1QVG F;  3RA6 A;  4BVT A;  1M90 H;  3CMA F;  1QVF F;  3G4S F;  2I6D A;  1X7P A;  3LWR C;  3J7A R;  2FC3 A;  4X3M A;  4BW0 B;  1VQM F;  1YIJ F;  1CK2 A;  5EO3 A;  5G4U C;  4XCQ A;  3RA5 A;  3NMU C;  2KTV A;  4EI9 A;  3NVI B;  2KTU A;  1PXW A;  3CCJ F;  1S72 F;  3MCA B;  5GIO C;  1GZ0 A;  1Q81 H;  3SIU A;  1RA4 A;  2OTJ F;  2JNB A;  1VQL F;  1E7K A;  1IPA A;  1VQ4 F;  1GO1 A;  3AGK A;  3IR9 A;  1K9M H;  2AIF A;  1M1K H;  3CCE F;  1KD1 H;  2F9Z C;  2KG4 A;  3LWV C;  1YJW F;  3J81 M;  1H7M A;  1X7O A;  1YJN F;  1ZWZ A;  5HWE A;  1VQ7 F;  3CC2 F;  2VGN A;  4BVS A;  3PLA C;  4TZZ A;  3I56 F;  2ALE A;  3V7E A;  2HVY D;  1K73 H;  3LWO C;  3FFM A;  1W40 A;  2OTL F;  1Q7Y H;  3CD6 F;  3J80 M;  3CCR F;  3CCV F;  2WAL A;  4NUT A;  2QEX F;  3SIV A;  2CZW A;  1GO0 A;  1W2B F;  5IT9 M;  1YJ9 F;  3N4Y A;  5A2Q M;  2GLZ A;  3CPW F;  3CCS F;  3V7Q A;  1T0K B;  1DT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...