2JNBA

Solution structure of rna-binding protein 15.5k
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2-like protein 1
publication title Functional Implications for a Prototypical K-Turn Binding Protein from Structural and Dynamical Studies of 15.5K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2jnbA00
1Q86H 1W42A 3CCMF 3CCRF 2JNBA 1K8AH 1Q7YH 3N4ZA 1VQ9F 2OTJF 3N4YA 1CK2A 3ON1A 1YJNF 3CPWF 3OW2F 1Q81H 2VGNA 4TZZA 2KTVA 1SDSA 3CCUF 2HVYD 3JAMM 3V7QA 3HAXD 1W3EX 3VI6A 1VQ6F 3IR9A 2LBWA 3NK6A 3NMUC 2VGMA 3PLAC 1VQ8F 3CMEF 5EWRA 1PXWA 1ZWZA 1QVFF 2OTLF 1RA4A 3E20B 5GANK 3CXCF 2BO1A 2QI2A 3NK7A 3RA6A 1W41A 3G71F 1X7PA 3CMAF 1JJ2F 1YIJF 1VQKF 5GINC 3V7EA 3MCAB 1X52A 4NUTA 1VQ4F 3LWQC 1S72F 3AGKA 1K73H 3CD6F 5FLXM 1M90H 3CC4F 2CZWA 3CCEF 5GAPK 1KC8H 2QA4F 3CCSF 2QEXF 2WALA 1YHQF 5G4VC 2KG4A 2KTUA 4X3LA 1VQMF 1GZ0A 3PAFA 3WXMB 3CCLF 3HJWC 3NVKE 1KQSF 3OBYA 1Q82H 3J7AR 1DT9A 3CG6A 1VQPF 3JCMM 2ALEA 5GIPC 3I55F 3CC7F 1M1KH 1QVGF 1VQLF 3I56F 5FJ4C 1VQNF 3LWPC 3CCQF 2I6DA 1NMUB 1W40A 3CCJF 3LFOA 1CN7A 1IPAA 3LWOC 4C4WC 4LCKA 1XBIA 3RA5A 3SIUA 3CPQA 1K9MH 1VQOF 1YI2F 1W2BF 3LWRC 1NJIH 2FC3A 1X7OA 4BY9D 3LWVC 3G4SF 3CC2F 1T0KB 2AIFA 3J80M 1GO0A 5IT9M 3OBWA 1YITF 3J81M 3FFMA 5DCVA 3O85A 1E7KA 1VQ5F 1KD1H 2OZBA 1N8RH 1YJ9F 1GO1A 4X3MA 1VQ7F 5G4UC 3SIVA 3E1YA 3G6EF 2LBXA 4BW0B 2OHWA 3GYQA 1RLGA 5A2QM 5GIOC 5EO3A 1H7MA 3CCVF 1YJWF 3NVIB 3VMFB
chains in the Genus database with same CATH superfamily
4G4WA 3CCMF 2CHTA 4C8GA 1VQ9F 1UI9A 4G4XA 1RLUA 3ON1A 3K12A 5JQGB 3TD5A 5GONB 2VGNA 3ZP7A 3KJKA 2CVLA 4TZZA 1OFUA 5LP6B 1TUBA 1JN1A 3FBAA 5IJ9B 3JAMM 3TD3A 3VOBA 2UYJA 3VI6A 2ZVYA 3MQWA 4DRXA 2H8EA 3V3TA 1H48A 3PLAC 4ZHQB 3KHNA 1VQ8F 5EWRA 1PXWA 2CSLA 2AIZP 5ITZA 3HKEA 5LXTB 5J2UA 5GANK 2BO1A 3F6MA 2H8CA 3HKBB 3NK7A 4ZHYB 3Q8HA 2DYYA 4B62A 5KX5A 1W5EA 3S0WA 1YIJF 4BVTA 3CB2A 4PWTA 1IV2A 2L26A 3K14A 3MCAB 1J7HA 3T80A 3N2GA 1X52A 3KE1A 3HTNA 3FPIA 5C8YB 1S72F 3AGKA 3RYFA 4ZHVA 3L7QA 4TUYB 5EIBD 3S03A 1KC8H 3QTYA 4TV9B 1NQ3A 5MN4A 5G4VC 3EORA 5HY2A 5EAZA 4O2AA 4WBNA 4X1IB 2ZVZA 3HKCB 3D00A 4YJ3B 1SA0A 1Q82H 1YGYA 2VAWA 3JCMM 4I4TB 4O4LB 5HXUA 3WGMA 3VOAA 2HX0A 2UYPA 2N48A 5FJ4C 3CCQF 2I6DA 1NMUB 1JY8A 4ZOLB 3VYTC 1UFYA 1FNJA 5HWEA 4LCKA 2HRYA 1ONIA 1W2BF 2HQSC 3RYHB 1FSZA 2FC3A 4NWOB 2RHLA 1Q8RA 5HY4A 4BT6A 3JASB 5EB1B 1T0KB 3IMPA 3S02A 5LOVB 5LYJA 3O85A 1FFXB 1VQ5F 5JH7B 2HS4A 3HKDB 2AMTA 1GO1A 3WGKA 4HNAB 1KNKA 4O2BA 3ELCA 4BW0B 1FNKA 4ZI7B 2OHWA 3LDTA 5JVDB 3D01A 3RYCB 1RLGA 1YJWF 1H7MA 3P0ZA 3VMFB 3DC2A 4BT3A 3CCRF 4EI7A 5CB4B 2Z01A 3N4ZA 1K8AH 3N4YA 1CK2A 1R1MA 1YJNF 2CWJA 3V4DA 2VAPA 1Q81H 2OTMA 3MBMA 2KTVA 1VQVA 3JARA 4E6EA 1SDSA 4EB6A 2HP0B 2P6YA 3HAXD 4BT5A 4R40B 3IR9A 2LBWA 5JCOC 5EZYA 3VO8A 1T0AA 1XV2A 2EWCA 4G4VA 1ZWZA 3E22B 2OTLF 5LP6C 3CXCF 2UYKA 3RA6A 4B45A 4O4JA 2GZLA 4YJ2B 5KMGB 5LA6A 3CMAF 1VQKF 1VHAA 5GINC 3UT5B 1DBFA 2G9IA 4O4HB 4I55B 4FFBB 5JCOA 3QHDA 3JAKB 3LWQC 3JATB 3QUWA 4IHJA 4X20A 4X1KA 5GONA 4U3JA 2CZWA 3WPWA 3CCEF 2KGWA 2GLZA 5HY0A 2K1SA 5LP6A 4NQ3A 3FD5A 2QEXF 4B5CA 2ZODA 2KTUA 3WJRA 1SZQA 3PAFA 3WXMB 4I50A 3OBYA 5CA1A 1ODEA 3CG6A 2IQQA 1H47A 1TUBB 2ALEA 3HKBA 5HP7A 5CA0A 3K2XA 4DRXB 1M1KH 1QVGF 1VQLF 2LBTA 5AVMA 2ZAUA 3N2KA 3JVHA 1U40A 2HS0A 4G4ZA 3CCJF 3LFOA 1CN7A 3HKEB 5J2UB 2VAMA 3ERNA 4TV8A 5KX5B 1NJIH 5J2TB 4EI8A 4IIJA 4BY9D 3N2GB 2RB9A 4X1IA 3VTIC 1GO0A 3VYSC 3WGNA 2RHJA 2DT4A 4BVSA 5DCVA 3S0HA 5B8FA 4O4LA 3C9UA 2R751 3E1YA 1QAHA 4O2AB 3CYPB 4WBNB 4BT2A 3GYQA 2V9YA 5A2QM 4F6RA 4M8IA 3NVIB 2Q1XA 1W42A 4O4IA 5EYPA 4LNUA 1KNJA 5BMVA 2OTJF 1W5BA 3WGJA 3WJPA 4C8IA 5EIBC 3JASA 4G88A 3JALB 3CCUF 4X1YB 5LOVA 2R6R1 3V7QA 1W3EX 1RQ2A 3JAWA 3HKDA 1RQ7A 3I3FA 2VGMA 1JFFA 1TVKA 3NK6A 3R0PA 4HNAA 3RYIB 3S06A 3VIUA 3VYUC 3CMEF 2CHSA 4RHAA 3MCQA 3MDOA 2W8BC 1Z5WA 3WJQA 3ZO8A 4ZK7A 3M1XA 5JVDA 2QI2A 3TD4A 5IYZA 1W41A 3C9RA 2ZF8A 3G71F 5FNVB 3VCZA 5MN5A 3V7EA 4NUTA 4O2BB 2IAFA 2RHOA 3LYBA 3P4EA 3C8LA 3CD6F 5GAPK 1VK3A 3DDNA 2QA4F 2BTQB 2UYNA 3CCSF 1W59A 2Z1TA 5HY1A 3S0YA 2KG4A 1VQMF 5IJ0A 3J7AR 2F9ZC 1VQPF 3JARB 5GIPC 3I55F 3WGLA 2YXZA 4YJ2A 2YYEA 3UT5A 3GTZA 5EZYB 1QU9A 1Z5VA 3LWPC 4FFBA 5JQGA 3LWOC 5EB0A 4C4WC 1XBIA 5IJ9A 3SIUA 3CPQA 1K9MH 1VQOF 1YI2F 4O4JB 4DXDA 5LA6B 4ZHQA 3IEQA 3KJJA 3LWVC 3FD6A 2QTPA 3CC2F 2Z1FA 3J80M 5LXTA 1OAPA 1IV3A 1IV1A 4IHJB 4X20B 4X1KB 4U3JB 3FFMA 3IEWA 3C9SA 4ERHA 2HP3A 1E7KA 2OZBA 2NMUA 1XRGA 5MN6A 4RQOA 3K0TA 4U39A 2LBXA 5C8YA 3M4SA 2Z1EA 3CYQA 5ITZB 2MQEA 4TUYA 3CCVF 4I50B 5CA1B 3HWUA 4G4YA 3GHZA 1Q86H 4TV9A 5CA0B 2JNBA 1Q7YH 2BTOA 3RE3A 5J2TA 2PHNA 2BTUA 3HKCA 1W5FA 3CPWF 2LCAA 1COMA 3N2KB 3RYFB 4YJ3A 3OW2F 2HVYD 4I4TA 3ESJA 1VQ6F 4TV8B 4BT7A 3NMUC 2PMPA 4ZHWA 4IIJB 3P10A 2CW4A 3F0GA 3F0DA 4ZOLA 1QVFF 1W57A 1SA0B 1RA4A 3E20B 1U43A 2H6LA 1X7PA 3RYHA 3C9TA 1JJ2F 3OONA 1W55A 1JD1A 3M84A 2B33A 1VQ4F 4C8EA 1VH8A 1K73H 3U0OA 5FLXM 1M90H 3JALA 3CC4F 2VXYA 3F0EA 1FFXA 4F6RB 3LMEA 1U3LA 5JH7A 4KWEA 4X1YA 1GX1A 2IG8A 4O4IB 5EYPB 2WALA 3B6NA 4LNUB 1YHQF 4BVQA 3RYIA 1X25A 1QD9A 5BMVB 2Z1UA 4ZI7A 4X3LA 1GZ0A 2Q1YA 3RYCA 3CCLF 3HJWC 3NVKE 1KQSF 4EI9A 1DT9A 5LYJB 2FGYA 3IKFA 3CC7F 5CB4A 3I7TA 5FNVA 3JAWB 3I56F 1JFFB 1TVKB 1W581 1VQNF 2RHHA 1PF5A 1IV4A 1W40A 1IPAA 2HP0A 3RA5A 4XCQA 1XHOA 5IYZB 3BYQA 3LWRC 3ZOPA 3WPXA 4C81A 2GVIA 1CLIA 1X7OA 5HXZA 5HP8A 4BT4A 3G4SF 2HRUA 3KIZA 4C82A 2AIFA 3E22A 4B46A 1U3PA 3OBWA 2ZOVA 5IT9M 1YITF 4EB6B 3J81M 3F0FA 2HS3A 3ZP4A 5KMGA 1KD1H 2UYNB 1N8RH 1YJ9F 1VQ7F 4X3MA 5G4UC 3D54A 3SIVA 4O4HA 4I55A 4BVRA 3G6EF 3JAKA 3JATA 1YQNA 2UZHA 5GIOC 5EO3A 5IJ0B 3IKEA 2I6RA 1W5AA
chains in the Genus database with same CATH topology
1Q86H 1W42A 3CCMF 3CCRF 2JNBA 4EI7A 1K8AH 1Q7YH 3N4ZA 1VQ9F 2OTJF 3N4YA 1CK2A 3ON1A 1YJNF 3CPWF 3OW2F 1Q81H 2VGNA 4TZZA 2KTVA 1SDSA 3CCUF 2HVYD 3JAMM 3V7QA 3HAXD 1W3EX 3VI6A 1VQ6F 3IR9A 2LBWA 3NK6A 3NMUC 2VGMA 3V3TA 3PLAC 1VQ8F 3CMEF 5EWRA 1PXWA 1ZWZA 1QVFF 2OTLF 1RA4A 3E20B 5GANK 3CXCF 2BO1A 2QI2A 3NK7A 3RA6A 1W41A 3G71F 1X7PA 3CMAF 1JJ2F 1YIJF 1VQKF 4BVTA 5GINC 3V7EA 3MCAB 1X52A 4NUTA 1VQ4F 3LWQC 1S72F 3AGKA 1K73H 3CD6F 5FLXM 1M90H 3CC4F 2CZWA 3CCEF 5GAPK 1KC8H 2GLZA 5HY0A 2QA4F 4NQ3A 3CCSF 2QEXF 2WALA 5HY1A 1YHQF 4BVQA 5G4VC 5HY2A 2KG4A 2KTUA 4X3LA 1VQMF 1GZ0A 3PAFA 3WXMB 3CCLF 3HJWC 3D00A 3NVKE 1KQSF 3OBYA 1Q82H 2F9ZC 4EI9A 1DT9A 3J7AR 3CG6A 1VQPF 3JCMM 2FGYA 2ALEA 5GIPC 3I55F 3CC7F 1M1KH 1QVGF 5HXUA 1VQLF 3I56F 5FJ4C 1VQNF 3LWPC 3CCQF 2I6DA 1NMUB 1W40A 3CCJF 3LFOA 1CN7A 1IPAA 3LWOC 4C4WC 5HWEA 4LCKA 1XBIA 3RA5A 3SIUA 4XCQA 3CPQA 1K9MH 1VQOF 1YI2F 1W2BF 3LWRC 1NJIH 2FC3A 4EI8A 1X7OA 5HY4A 5HXZA 3LWVC 3G4SF 4BY9D 3CC2F 1T0KB 2AIFA 3J80M 1GO0A 5IT9M 3OBWA 1YITF 3J81M 4BVSA 3FFMA 5DCVA 3O85A 1E7KA 1VQ5F 1KD1H 2OZBA 1N8RH 1YJ9F 1GO1A 4X3MA 1VQ7F 5G4UC 3SIVA 3E1YA 4BVRA 3G6EF 2LBXA 4BW0B 2OHWA 3GYQA 1RLGA 5A2QM 5GIOC 5EO3A 1H7MA 3CCVF 1YJWF 3NVIB 3VMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 H;  1W42 A;  3CCM F;  3CCR F;  2JNB A;  1K8A H;  1Q7Y H;  3N4Z A;  1VQ9 F;  2OTJ F;  3N4Y A;  1CK2 A;  3ON1 A;  1YJN F;  3CPW F;  3OW2 F;  1Q81 H;  2VGN A;  4TZZ A;  2KTV A;  1SDS A;  3CCU F;  2HVY D;  3JAM M;  3V7Q A;  3HAX D;  1W3E X;  3VI6 A;  1VQ6 F;  3IR9 A;  2LBW A;  3NK6 A;  3NMU C;  2VGM A;  3PLA C;  1VQ8 F;  3CME F;  5EWR A;  1PXW A;  1ZWZ A;  1QVF F;  2OTL F;  1RA4 A;  3E20 B;  5GAN K;  3CXC F;  2BO1 A;  2QI2 A;  3NK7 A;  3RA6 A;  1W41 A;  3G71 F;  1X7P A;  3CMA F;  1JJ2 F;  1YIJ F;  1VQK F;  5GIN C;  3V7E A;  3MCA B;  1X52 A;  4NUT A;  1VQ4 F;  3LWQ C;  1S72 F;  3AGK A;  1K73 H;  3CD6 F;  5FLX M;  1M90 H;  3CC4 F;  2CZW A;  3CCE F;  5GAP K;  1KC8 H;  2QA4 F;  3CCS F;  2QEX F;  2WAL A;  1YHQ F;  5G4V C;  2KG4 A;  2KTU A;  4X3L A;  1VQM F;  1GZ0 A;  3PAF A;  3WXM B;  3CCL F;  3HJW C;  3NVK E;  1KQS F;  3OBY A;  1Q82 H;  3J7A R;  1DT9 A;  3CG6 A;  1VQP F;  3JCM M;  2ALE A;  5GIP C;  3I55 F;  3CC7 F;  1M1K H;  1QVG F;  1VQL F;  3I56 F;  5FJ4 C;  1VQN F;  3LWP C;  3CCQ F;  2I6D A;  1NMU B;  1W40 A;  3CCJ F;  3LFO A;  1CN7 A;  1IPA A;  3LWO C;  4C4W C;  4LCK A;  1XBI A;  3RA5 A;  3SIU A;  3CPQ A;  1K9M H;  1VQO F;  1YI2 F;  1W2B F;  3LWR C;  1NJI H;  2FC3 A;  1X7O A;  4BY9 D;  3LWV C;  3G4S F;  3CC2 F;  1T0K B;  2AIF A;  3J80 M;  1GO0 A;  5IT9 M;  3OBW A;  1YIT F;  3J81 M;  3FFM A;  5DCV A;  3O85 A;  1E7K A;  1VQ5 F;  1KD1 H;  2OZB A;  1N8R H;  1YJ9 F;  1GO1 A;  4X3M A;  1VQ7 F;  5G4U C;  3SIV A;  3E1Y A;  3G6E F;  2LBX A;  4BW0 B;  2OHW A;  3GYQ A;  1RLG A;  5A2Q M;  5GIO C;  5EO3 A;  1H7M A;  3CCV F;  1YJW F;  3NVI B;  3VMF B; 
#chains in the Genus database with same CATH topology
 4G4W A;  3CCM F;  2CHT A;  4C8G A;  1VQ9 F;  1UI9 A;  4G4X A;  1RLU A;  3ON1 A;  3K12 A;  5JQG B;  3TD5 A;  5GON B;  2VGN A;  3ZP7 A;  3KJK A;  2CVL A;  4TZZ A;  1OFU A;  5LP6 B;  1TUB A;  1JN1 A;  3FBA A;  5IJ9 B;  3JAM M;  3TD3 A;  3VOB A;  2UYJ A;  3VI6 A;  2ZVY A;  3MQW A;  4DRX A;  2H8E A;  3V3T A;  1H48 A;  3PLA C;  4ZHQ B;  3KHN A;  1VQ8 F;  5EWR A;  1PXW A;  2CSL A;  2AIZ P;  5ITZ A;  3HKE A;  5LXT B;  5J2U A;  5GAN K;  2BO1 A;  3F6M A;  2H8C A;  3HKB B;  3NK7 A;  4ZHY B;  3Q8H A;  2DYY A;  4B62 A;  5KX5 A;  1W5E A;  3S0W A;  1YIJ F;  4BVT A;  3CB2 A;  4PWT A;  1IV2 A;  2L26 A;  3K14 A;  3MCA B;  1J7H A;  3T80 A;  3N2G A;  1X52 A;  3KE1 A;  3HTN A;  3FPI A;  5C8Y B;  1S72 F;  3AGK A;  3RYF A;  4ZHV A;  3L7Q A;  4TUY B;  5EIB D;  3S03 A;  1KC8 H;  3QTY A;  4TV9 B;  1NQ3 A;  5MN4 A;  5G4V C;  3EOR A;  5HY2 A;  5EAZ A;  4O2A A;  4WBN A;  4X1I B;  2ZVZ A;  3HKC B;  3D00 A;  4YJ3 B;  1SA0 A;  1Q82 H;  1YGY A;  2VAW A;  3JCM M;  4I4T B;  4O4L B;  5HXU A;  3WGM A;  3VOA A;  2HX0 A;  2UYP A;  2N48 A;  5FJ4 C;  3CCQ F;  2I6D A;  1NMU B;  1JY8 A;  4ZOL B;  3VYT C;  1UFY A;  1FNJ A;  5HWE A;  4LCK A;  2HRY A;  1ONI A;  1W2B F;  2HQS C;  3RYH B;  1FSZ A;  2FC3 A;  4NWO B;  2RHL A;  1Q8R A;  5HY4 A;  4BT6 A;  3JAS B;  5EB1 B;  1T0K B;  3IMP A;  3S02 A;  5LOV B;  5LYJ A;  3O85 A;  1FFX B;  1VQ5 F;  5JH7 B;  2HS4 A;  3HKD B;  2AMT A;  1GO1 A;  3WGK A;  4HNA B;  1KNK A;  4O2B A;  3ELC A;  4BW0 B;  1FNK A;  4ZI7 B;  2OHW A;  3LDT A;  5JVD B;  3D01 A;  3RYC B;  1RLG A;  1YJW F;  1H7M A;  3P0Z A;  3VMF B;  3DC2 A;  4BT3 A;  3CCR F;  4EI7 A;  5CB4 B;  2Z01 A;  3N4Z A;  1K8A H;  3N4Y A;  1CK2 A;  1R1M A;  1YJN F;  2CWJ A;  3V4D A;  2VAP A;  1Q81 H;  2OTM A;  3MBM A;  2KTV A;  1VQV A;  3JAR A;  4E6E A;  1SDS A;  4EB6 A;  2HP0 B;  2P6Y A;  3HAX D;  4BT5 A;  4R40 B;  3IR9 A;  2LBW A;  5JCO C;  5EZY A;  3VO8 A;  1T0A A;  1XV2 A;  2EWC A;  4G4V A;  1ZWZ A;  3E22 B;  2OTL F;  5LP6 C;  3CXC F;  2UYK A;  3RA6 A;  4B45 A;  4O4J A;  2GZL A;  4YJ2 B;  5KMG B;  5LA6 A;  3CMA F;  1VQK F;  1VHA A;  5GIN C;  3UT5 B;  1DBF A;  2G9I A;  4O4H B;  4I55 B;  4FFB B;  5JCO A;  3QHD A;  3JAK B;  3LWQ C;  3JAT B;  3QUW A;  4IHJ A;  4X20 A;  4X1K A;  5GON A;  4U3J A;  2CZW A;  3WPW A;  3CCE F;  2KGW A;  2GLZ A;  5HY0 A;  2K1S A;  5LP6 A;  4NQ3 A;  3FD5 A;  2QEX F;  4B5C A;  2ZOD A;  2KTU A;  3WJR A;  1SZQ A;  3PAF A;  3WXM B;  4I50 A;  3OBY A;  5CA1 A;  1ODE A;  3CG6 A;  2IQQ A;  1H47 A;  1TUB B;  2ALE A;  3HKB A;  5HP7 A;  5CA0 A;  3K2X A;  4DRX B;  1M1K H;  1QVG F;  1VQL F;  2LBT A;  5AVM A;  2ZAU A;  3N2K A;  3JVH A;  1U40 A;  2HS0 A;  4G4Z A;  3CCJ F;  3LFO A;  1CN7 A;  3HKE B;  5J2U B;  2VAM A;  3ERN A;  4TV8 A;  5KX5 B;  1NJI H;  5J2T B;  4EI8 A;  4IIJ A;  4BY9 D;  3N2G B;  2RB9 A;  4X1I A;  3VTI C;  1GO0 A;  3VYS C;  3WGN A;  2RHJ A;  2DT4 A;  4BVS A;  5DCV A;  3S0H A;  5B8F A;  4O4L A;  3C9U A;  2R75 1;  3E1Y A;  1QAH A;  4O2A B;  3CYP B;  4WBN B;  4BT2 A;  3GYQ A;  2V9Y A;  5A2Q M;  4F6R A;  4M8I A;  3NVI B;  2Q1X A;  1W42 A;  4O4I A;  5EYP A;  4LNU A;  1KNJ A;  5BMV A;  2OTJ F;  1W5B A;  3WGJ A;  3WJP A;  4C8I A;  5EIB C;  3JAS A;  4G88 A;  3JAL B;  3CCU F;  4X1Y B;  5LOV A;  2R6R 1;  3V7Q A;  1W3E X;  1RQ2 A;  3JAW A;  3HKD A;  1RQ7 A;  3I3F A;  2VGM A;  1JFF A;  1TVK A;  3NK6 A;  3R0P A;  4HNA A;  3RYI B;  3S06 A;  3VIU A;  3VYU C;  3CME F;  2CHS A;  4RHA A;  3MCQ A;  3MDO A;  2W8B C;  1Z5W A;  3WJQ A;  3ZO8 A;  4ZK7 A;  3M1X A;  5JVD A;  2QI2 A;  3TD4 A;  5IYZ A;  1W41 A;  3C9R A;  2ZF8 A;  3G71 F;  5FNV B;  3VCZ A;  5MN5 A;  3V7E A;  4NUT A;  4O2B B;  2IAF A;  2RHO A;  3LYB A;  3P4E A;  3C8L A;  3CD6 F;  5GAP K;  1VK3 A;  3DDN A;  2QA4 F;  2BTQ B;  2UYN A;  3CCS F;  1W59 A;  2Z1T A;  5HY1 A;  3S0Y A;  2KG4 A;  1VQM F;  5IJ0 A;  3J7A R;  2F9Z C;  1VQP F;  3JAR B;  5GIP C;  3I55 F;  3WGL A;  2YXZ A;  4YJ2 A;  2YYE A;  3UT5 A;  3GTZ A;  5EZY B;  1QU9 A;  1Z5V A;  3LWP C;  4FFB A;  5JQG A;  3LWO C;  5EB0 A;  4C4W C;  1XBI A;  5IJ9 A;  3SIU A;  3CPQ A;  1K9M H;  1VQO F;  1YI2 F;  4O4J B;  4DXD A;  5LA6 B;  4ZHQ A;  3IEQ A;  3KJJ A;  3LWV C;  3FD6 A;  2QTP A;  3CC2 F;  2Z1F A;  3J80 M;  5LXT A;  1OAP A;  1IV3 A;  1IV1 A;  4IHJ B;  4X20 B;  4X1K B;  4U3J B;  3FFM A;  3IEW A;  3C9S A;  4ERH A;  2HP3 A;  1E7K A;  2OZB A;  2NMU A;  1XRG A;  5MN6 A;  4RQO A;  3K0T A;  4U39 A;  2LBX A;  5C8Y A;  3M4S A;  2Z1E A;  3CYQ A;  5ITZ B;  2MQE A;  4TUY A;  3CCV F;  4I50 B;  5CA1 B;  3HWU A;  4G4Y A;  3GHZ A;  1Q86 H;  4TV9 A;  5CA0 B;  2JNB A;  1Q7Y H;  2BTO A;  3RE3 A;  5J2T A;  2PHN A;  2BTU A;  3HKC A;  1W5F A;  3CPW F;  2LCA A;  1COM A;  3N2K B;  3RYF B;  4YJ3 A;  3OW2 F;  2HVY D;  4I4T A;  3ESJ A;  1VQ6 F;  4TV8 B;  4BT7 A;  3NMU C;  2PMP A;  4ZHW A;  4IIJ B;  3P10 A;  2CW4 A;  3F0G A;  3F0D A;  4ZOL A;  1QVF F;  1W57 A;  1SA0 B;  1RA4 A;  3E20 B;  1U43 A;  2H6L A;  1X7P A;  3RYH A;  3C9T A;  1JJ2 F;  3OON A;  1W55 A;  1JD1 A;  3M84 A;  2B33 A;  1VQ4 F;  4C8E A;  1VH8 A;  1K73 H;  3U0O A;  5FLX M;  1M90 H;  3JAL A;  3CC4 F;  2VXY A;  3F0E A;  1FFX A;  4F6R B;  3LME A;  1U3L A;  5JH7 A;  4KWE A;  4X1Y A;  1GX1 A;  2IG8 A;  4O4I B;  5EYP B;  2WAL A;  3B6N A;  4LNU B;  1YHQ F;  4BVQ A;  3RYI A;  1X25 A;  1QD9 A;  5BMV B;  2Z1U A;  4ZI7 A;  4X3L A;  1GZ0 A;  2Q1Y A;  3RYC A;  3CCL F;  3HJW C;  3NVK E;  1KQS F;  4EI9 A;  1DT9 A;  5LYJ B;  2FGY A;  3IKF A;  3CC7 F;  5CB4 A;  3I7T A;  5FNV A;  3JAW B;  3I56 F;  1JFF B;  1TVK B;  1W58 1;  1VQN F;  2RHH A;  1PF5 A;  1IV4 A;  1W40 A;  1IPA A;  2HP0 A;  3RA5 A;  4XCQ A;  1XHO A;  5IYZ B;  3BYQ A;  3LWR C;  3ZOP A;  3WPX A;  4C81 A;  2GVI A;  1CLI A;  1X7O A;  5HXZ A;  5HP8 A;  4BT4 A;  3G4S F;  2HRU A;  3KIZ A;  4C82 A;  2AIF A;  3E22 A;  4B46 A;  1U3P A;  3OBW A;  2ZOV A;  5IT9 M;  1YIT F;  4EB6 B;  3J81 M;  3F0F A;  2HS3 A;  3ZP4 A;  5KMG A;  1KD1 H;  2UYN B;  1N8R H;  1YJ9 F;  1VQ7 F;  4X3M A;  5G4U C;  3D54 A;  3SIV A;  4O4H A;  4I55 A;  4BVR A;  3G6E F;  3JAK A;  3JAT A;  1YQN A;  2UZH A;  5GIO C;  5EO3 A;  5IJ0 B;  3IKE A;  2I6R A;  1W5A A; 
#chains in the Genus database with same CATH homology
 1Q86 H;  1W42 A;  3CCM F;  3CCR F;  2JNB A;  4EI7 A;  1K8A H;  1Q7Y H;  3N4Z A;  1VQ9 F;  2OTJ F;  3N4Y A;  1CK2 A;  3ON1 A;  1YJN F;  3CPW F;  3OW2 F;  1Q81 H;  2VGN A;  4TZZ A;  2KTV A;  1SDS A;  3CCU F;  2HVY D;  3JAM M;  3V7Q A;  3HAX D;  1W3E X;  3VI6 A;  1VQ6 F;  3IR9 A;  2LBW A;  3NK6 A;  3NMU C;  2VGM A;  3V3T A;  3PLA C;  1VQ8 F;  3CME F;  5EWR A;  1PXW A;  1ZWZ A;  1QVF F;  2OTL F;  1RA4 A;  3E20 B;  5GAN K;  3CXC F;  2BO1 A;  2QI2 A;  3NK7 A;  3RA6 A;  1W41 A;  3G71 F;  1X7P A;  3CMA F;  1JJ2 F;  1YIJ F;  1VQK F;  4BVT A;  5GIN C;  3V7E A;  3MCA B;  1X52 A;  4NUT A;  1VQ4 F;  3LWQ C;  1S72 F;  3AGK A;  1K73 H;  3CD6 F;  5FLX M;  1M90 H;  3CC4 F;  2CZW A;  3CCE F;  5GAP K;  1KC8 H;  2GLZ A;  5HY0 A;  2QA4 F;  4NQ3 A;  3CCS F;  2QEX F;  2WAL A;  5HY1 A;  1YHQ F;  4BVQ A;  5G4V C;  5HY2 A;  2KG4 A;  2KTU A;  4X3L A;  1VQM F;  1GZ0 A;  3PAF A;  3WXM B;  3CCL F;  3HJW C;  3D00 A;  3NVK E;  1KQS F;  3OBY A;  1Q82 H;  2F9Z C;  4EI9 A;  1DT9 A;  3J7A R;  3CG6 A;  1VQP F;  3JCM M;  2FGY A;  2ALE A;  5GIP C;  3I55 F;  3CC7 F;  1M1K H;  1QVG F;  5HXU A;  1VQL F;  3I56 F;  5FJ4 C;  1VQN F;  3LWP C;  3CCQ F;  2I6D A;  1NMU B;  1W40 A;  3CCJ F;  3LFO A;  1CN7 A;  1IPA A;  3LWO C;  4C4W C;  5HWE A;  4LCK A;  1XBI A;  3RA5 A;  3SIU A;  4XCQ A;  3CPQ A;  1K9M H;  1VQO F;  1YI2 F;  1W2B F;  3LWR C;  1NJI H;  2FC3 A;  4EI8 A;  1X7O A;  5HY4 A;  5HXZ A;  3LWV C;  3G4S F;  4BY9 D;  3CC2 F;  1T0K B;  2AIF A;  3J80 M;  1GO0 A;  5IT9 M;  3OBW A;  1YIT F;  3J81 M;  4BVS A;  3FFM A;  5DCV A;  3O85 A;  1E7K A;  1VQ5 F;  1KD1 H;  2OZB A;  1N8R H;  1YJ9 F;  1GO1 A;  4X3M A;  1VQ7 F;  5G4U C;  3SIV A;  3E1Y A;  4BVR A;  3G6E F;  2LBX A;  4BW0 B;  2OHW A;  3GYQ A;  1RLG A;  5A2Q M;  5GIO C;  5EO3 A;  1H7M A;  3CCV F;  1YJW F;  3NVI B;  3VMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...