2JNBA

Solution structure of rna-binding protein 15.5k
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NHP2-like protein 1
publication title Functional Implications for a Prototypical K-Turn Binding Protein from Structural and Dynamical Studies of 15.5K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2jnbA00
1X7OA 2OZBA 5FJ4C 4C4WC 3HAXD 1VQMF 1VQ6F 1KD1H 1RLGA 1CN7A 3CC7F 3OBYA 3CPWF 1S72F 2OTLF 5FLXM 2WALA 4TZZA 1M1KH 1XBIA 1Q7YH 3LWOC 4BW0B 2QA4F 1M90H 1QVFF 3O85A 1VQNF 1PXWA 1GO1A 3LWVC 1YI2F 1K9MH 3CCQF 1GZ0A 1VQ4F 1VQPF 3J81M 3J80M 3CCUF 1Q81H 3LWRC 2VGNA 2AIFA 1NJIH 1YJNF 1N8RH 1KC8H 4X3LA 3N4YA 1X7PA 5G4VC 3CCJF 3AGKA 3E20B 1W2BF 3JAMM 3PLAC 2FC3A 1Q82H 3I56F 3CPQA 3OBWA 5IT9M 3V7EA 3NMUC 1Q86H 3E1YA 5GIOC 3CC4F 3FFMA 3CG6A 3NK7A 3SIVA 3VI6A 3RA6A 5DCVA 1VQ7F 3I55F 1W42A 1ZWZA 1IPAA 3CCRF 3IR9A 1VQOF 3J7AR 1CK2A 1YJ9F 3CCLF 2BO1A 5EWRA 5GANK 3CCEF 1T0KB 3G4SF 5A2QM 1DT9A 2VGMA 3G6EF 3CD6F 4LCKA 1H7MA 2QEXF 3RA5A 3N4ZA 3LWPC 2OTJF 3HJWC 1E7KA 3ON1A 1YITF 3OW2F 3LFOA 3WXMB 1X52A 1RA4A 3V7QA 4X3MA 5G4UC 1VQ8F 1NMUB 2ALEA 1YJWF 2QI2A 3CCSF 2KG4A 3CMEF 2JNBA 2LBWA 5GAPK 1KQSF 2KTUA 1YHQF 4BY9D 1W41A 5GIPC 3NVKE 3MCAB 3CCMF 3SIUA 2HVYD 1VQ5F 3NVIB 2OHWA 4NUTA 3CC2F 1W40A 3CXCF 1YIJF 1QVGF 3VMFB 1K8AH 1W3EX 2LBXA 3JCMM 3NK6A 2KTVA 1K73H 1GO0A 3G71F 3PAFA 3CCVF 2I6DA 3CMAF 1SDSA 3LWQC 2CZWA 3GYQA 1JJ2F 1VQLF 5GINC 5EO3A 1VQ9F 1VQKF
chains in the Genus database with same CATH superfamily
5IJ0B 1X7OA 3C9RA 3WGKA 1KNJA 3RYHB 5LXTA 1U40A 2BTOA 3C9SA 1Z5WA 3HWUA 2LBTA 1CN7A 3CC7F 3E22A 2QTPA 2ZOVA 5FLXM 4O2BB 5HP7A 3F6MA 1IV3A 3FPIA 4EI9A 4PWTA 1TVKB 3LWOC 3LMEA 1M90H 3RYIA 2RHHA 1PXWA 5BMVA 1GO1A 1VQNF 4B62A 3VYTC 4G4XA 1U3LA 4C8GA 1Q81H 1H47A 3WJQA 5FNVA 2RB9A 4ZHVA 3HKEA 2CVLA 4BVRA 2UYNB 2KGWA 2Q1XA 1KC8H 3CCJF 3MBMA 3E20B 2HS3A 3RYIB 3DDNA 3IKFA 1W2BF 1JY8A 2FC3A 3JAKA 3I56F 5IT9M 2PHNA 3IKEA 1KNKA 3E1YA 2IQQA 3KJJA 1XHOA 5FNVB 3F0FA 3ZP7A 5DCVA 1VQ7F 1W42A 1ZWZA 3GHZA 3JASB 5KX5B 1VQOF 3WPXA 5MN5A 2BO1A 1X25A 3KE1A 3CD6F 2QEXF 4X1KA 2OTJF 3ZP4A 2GZLA 3HKCA 3HJWC 1E7KA 5CA1A 3LFOA 1X52A 3V7QA 4X3MA 5G4UC 2VAWA 2ALEA 5HP8A 2QI2A 3JATB 4I55A 3I3FA 4HNAA 2LBWA 2BTQB 3JARB 5JVDA 1YHQF 4LNUA 2H8EA 3ZO8A 3NVKE 5HWEA 3MCAB 1TUBA 3NVIB 3D00A 3HKCB 2HRUA 3JALA 4M8IA 4O4HB 1YIJF 2UYKA 3VMFB 1K8AH 1W3EX 4TV8B 3P0ZA 3K2XA 2Z1EA 2KTVA 3NK6A 4TV9A 1GO0A 4EB6B 1VK3A 5KMGB 4HNAB 4NQ3A 1T0AA 1VQLF 2P6YA 5JVDB 1COMA 4LNUB 5HY2A 3WJRA 4ZHWA 2NMUA 5CA0B 1TUBB 2OZBA 3M4SA 1RQ7A 5LA6A 1VQ6F 5HY4A 1RLGA 2OTLF 1VHAA 3K12A 3S03A 4C8IA 4XCQA 4TZZA 4ZOLA 1FFXB 4IIJB 4O4LB 3IMPA 4YJ2A 2VAPA 3JAWA 5LP6B 4I4TB 2PMPA 3J80M 5LA6B 3CCUF 2Z01A 4YJ3B 3U0OA 2HX0A 4U3JA 3MCQA 2K1SA 3KJKA 4ZHYB 5C8YB 3FD5A 4ZOLB 2DYYA 4X3LA 5EIBD 3FD6A 2GLZA 5J2UA 1Z5VA 4BT2A 5IYZB 2L26A 4YJ2B 3I7TA 5EB0A 2Z1UA 5EZYA 3RYFA 3CPQA 3VOBA 3V7EA 4DRXB 3NMUC 5JH7A 3CYPB 5EAZA 2CW4A 2BTUA 2ZAUA 3RA6A 3K14A 3I55F 5LXTB 3OONA 3S0HA 3TD4A 4B46A 4TUYA 4B45A 3J7AR 3E22B 3CCLF 1YJ9F 3CCEF 1T0KB 4EI7A 3G4SF 5A2QM 3B6NA 4WBNA 5J2UB 4BT4A 4ZHQA 3RYFB 1W55A 3G6EF 1H7MA 4KWEA 2HP3A 5BMVB 5JH7B 5J2TA 3ON1A 1YITF 1JFFA 5LOVA 5HY0A 1VQ8F 1YJWF 2Z1FA 1W581 1U3PA 2KG4A 4C82A 3CMEF 5ITZA 3HKEB 5CB4A 1QAHA 1QD9A 4WBNB 2RHOA 4ZHQB 1FNKA 3HKDA 1W41A 4U39A 1ODEA 3SIUA 5HXZA 4IHJA 3CC2F 3T80A 1QVGF 1JFFB 4G4WA 3JAKB 5LOVB 3BYQA 3JCMM 3G71F 5GONA 3IEQA 5HY1A 2N48A 3WPWA 2I6DA 2VAMA 4G88A 3GYQA 5EO3A 3CB2A 2DT4A 2IG8A 3VO8A 4X20A 3WGLA 4F6RA 2B33A 4IHJB 2UYJA 5EB1B 3JVHA 1KD1H 4X1KB 3OBYA 2OTMA 1IV4A 5GONB 2H8CA 2GVIA 2WALA 3Q8HA 5CA1B 1XBIA 2VXYA 1IV1A 4BW0B 3C8LA 1YQNA 5MN6A 3S0YA 3UT5A 4O2AA 3CCQF 3C9UA 1GZ0A 4FFBA 4I55B 2UYPA 1VQ4F 4F6RB 2UZHA 1VQVA 5EYPA 3LWRC 2VGNA 4X1IA 2CHSA 3TD5A 1NJIH 1YJNF 3JALB 3WGNA 1NQ3A 2R6R1 4O4JA 1X7PA 5G4VC 4TV9B 3AGKA 3S06A 5IJ9A 4R40B 3JAMM 5AVMA 1Q82H 1OAPA 4B5CA 3OBWA 3S02A 3P4EA 5LYJA 1GX1A 5GIOC 3CG6A 4X1YA 3SIVA 4X1IB 4BT7A 1CLIA 4ZI7A 1IV2A 1IPAA 3CCRF 2YXZA 3QUWA 4O4JB 5IJ0A 3R0PA 5EWRA 1DT9A 2VGMA 1OFUA 2ZODA 3WGMA 4LCKA 2MQEA 3DC2A 1JD1A 3TD3A 3LWPC 2H6LA 3KHNA 4G4YA 3JAWB 3C9TA 3OW2F 3WXMB 1RA4A 3RYCA 1NMUB 1H48A 3ZOPA 4U3JB 3CCSF 3MDOA 2RHLA 1JN1A 5JCOC 4G4ZA 3ERNA 2IAFA 1J7HA 3CYQA 1QU9A 3VYUC 4DXDA 3CCMF 2HVYD 2ZVYA 1VQ5F 2UYNA 1W40A 2HS0A 1DBFA 5EZYB 1FNJA 2LBXA 2F9ZC 1SZQA 3RYCB 2HQSC 5JQGA 3EORA 5EIBC 3CMAF 5MN4A 3HTNA 3L7QA 3F0DA 1SDSA 1JJ2F 1VQ9F 1VQKF 5HXUA 3RE3A 2CWJA 4TUYB 2LCAA 5FJ4C 4C4WC 1U43A 3HAXD 2W8BC 2YYEA 3D54A 1VQMF 3JASA 2ZF8A 3N2KA 5KX5A 4BVQA 3IEWA 3CPWF 1S72F 5JCOA 2HP0A 5J2TB 5JQGB 1M1KH 3VTIC 3HKBA 4ERHA 1RQ2A 1Q7YH 2QA4F 3MQWA 1QVFF 1UFYA 3O85A 2HS4A 1YGYA 3LWVC 1YI2F 4ZK7A 3F0GA 1K9MH 5ITZB 5CB4B 2CHTA 1VQPF 3J81M 1W5FA 3VOAA 3N2KB 3HKDB 4BT5A 1UI9A 3D01A 2AIFA 2HP0B 3JATA 1N8RH 3K0TA 3JARA 3HKBB 3VYSC 2I6RA 4E6EA 1XV2A 3N4YA 1Q8RA 3P10A 3S0WA 1VH8A 4O4IA 4O4HA 3WGJA 1W5BA 3M1XA 3PLAC 2G9IA 5LP6C 4TV8A 3ELCA 1Q86H 3CC4F 4EB6A 4BT6A 3FFMA 3NK7A 3QHDA 2EWCA 1XRGA 5KMGA 4X20B 3VI6A 1W5AA 4I50A 3IR9A 4C81A 1FSZA 1W57A 3QTYA 2R751 2AMTA 1ONIA 1CK2A 5CA0A 5GANK 2Q1YA 4RQOA 4O4IB 4BVSA 3ESJA 2FGYA 2HRYA 3RA5A 3N4ZA 1RLUA 3N2GA 4G4VA 3UT5B 4O2AB 2CSLA 4FFBB 1SA0A 1W5EA 4I50B 3WJPA 1FFXA 3GTZA 3KIZA 4IIJA 3M84A 5EYPB 4O4LA 2ZVZA 4BT3A 1R1MA 5LP6A 2AIZP 1PF5A 2JNBA 5GAPK 4I4TA 1KQSF 3V3TA 2KTUA 4C8EA 4BY9D 5GIPC 4YJ3A 3V4DA 3LDTA 4NWOB 5IJ9B 3RYHA 5B8FA 2OHWA 3FBAA 3N2GB 3VIUA 4NUTA 2RHJA 2V9YA 3F0EA 5C8YA 3CXCF 4BVTA 4RHAA 1SA0B 5LYJB 4O2BA 1K73H 2Z1TA 3PAFA 4X1YB 3CCVF 1W59A 5IYZA 4EI8A 3LWQC 2CZWA 1TVKA 3VCZA 5GINC 4ZI7B 3LYBA 4DRXA
chains in the Genus database with same CATH topology
5HY2A 1X7OA 2OZBA 5FJ4C 4C4WC 3HAXD 1VQMF 1VQ6F 4BVQA 1KD1H 5HY4A 1RLGA 1CN7A 3CC7F 3OBYA 3CPWF 1S72F 2OTLF 5FLXM 2WALA 4EI9A 4XCQA 4TZZA 1M1KH 1XBIA 1Q7YH 3LWOC 4BW0B 2QA4F 1M90H 1QVFF 3O85A 1VQNF 1PXWA 1GO1A 3LWVC 1YI2F 1K9MH 3CCQF 1GZ0A 1VQ4F 1VQPF 3J81M 3J80M 3CCUF 1Q81H 3LWRC 2VGNA 2AIFA 1NJIH 1YJNF 1N8RH 4BVRA 1KC8H 4X3LA 3N4YA 1X7PA 5G4VC 3CCJF 3AGKA 3E20B 1W2BF 2GLZA 3JAMM 3PLAC 2FC3A 1Q82H 3I56F 3CPQA 3OBWA 5IT9M 3V7EA 3NMUC 1Q86H 3E1YA 5GIOC 3CC4F 3FFMA 3CG6A 3NK7A 3SIVA 3VI6A 3RA6A 5DCVA 1VQ7F 3I55F 1W42A 1ZWZA 1IPAA 3CCRF 3IR9A 1VQOF 3J7AR 1CK2A 1YJ9F 3CCLF 2BO1A 5EWRA 5GANK 3CCEF 1T0KB 4EI7A 3G4SF 5A2QM 1DT9A 2VGMA 4BVSA 2FGYA 3G6EF 3CD6F 4LCKA 1H7MA 2QEXF 3RA5A 3N4ZA 3LWPC 2OTJF 3HJWC 1E7KA 3ON1A 1YITF 3OW2F 3LFOA 3WXMB 1X52A 1RA4A 3V7QA 4X3MA 5G4UC 5HY0A 1VQ8F 1NMUB 2ALEA 1YJWF 2QI2A 3CCSF 2KG4A 3CMEF 2JNBA 2LBWA 5GAPK 1KQSF 3V3TA 2KTUA 1YHQF 4BY9D 1W41A 5GIPC 3NVKE 5HWEA 3MCAB 3CCMF 3SIUA 2HVYD 5HXZA 1VQ5F 3D00A 3NVIB 2OHWA 4NUTA 3CC2F 1W40A 3CXCF 1YIJF 1QVGF 3VMFB 4BVTA 1K8AH 1W3EX 2LBXA 3JCMM 2F9ZC 2KTVA 3NK6A 1K73H 1GO0A 3G71F 5HY1A 3PAFA 3CCVF 2I6DA 4EI8A 3CMAF 1SDSA 3LWQC 2CZWA 3GYQA 4NQ3A 1JJ2F 1VQLF 5GINC 5EO3A 1VQ9F 5HXUA 1VQKF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  2OZB A;  5FJ4 C;  4C4W C;  3HAX D;  1VQM F;  1VQ6 F;  1KD1 H;  1RLG A;  1CN7 A;  3CC7 F;  3OBY A;  3CPW F;  1S72 F;  2OTL F;  5FLX M;  2WAL A;  4TZZ A;  1M1K H;  1XBI A;  1Q7Y H;  3LWO C;  4BW0 B;  2QA4 F;  1M90 H;  1QVF F;  3O85 A;  1VQN F;  1PXW A;  1GO1 A;  3LWV C;  1YI2 F;  1K9M H;  3CCQ F;  1GZ0 A;  1VQ4 F;  1VQP F;  3J81 M;  3J80 M;  3CCU F;  1Q81 H;  3LWR C;  2VGN A;  2AIF A;  1NJI H;  1YJN F;  1N8R H;  1KC8 H;  4X3L A;  3N4Y A;  1X7P A;  5G4V C;  3CCJ F;  3AGK A;  3E20 B;  1W2B F;  3JAM M;  3PLA C;  2FC3 A;  1Q82 H;  3I56 F;  3CPQ A;  3OBW A;  5IT9 M;  3V7E A;  3NMU C;  1Q86 H;  3E1Y A;  5GIO C;  3CC4 F;  3FFM A;  3CG6 A;  3NK7 A;  3SIV A;  3VI6 A;  3RA6 A;  5DCV A;  1VQ7 F;  3I55 F;  1W42 A;  1ZWZ A;  1IPA A;  3CCR F;  3IR9 A;  1VQO F;  3J7A R;  1CK2 A;  1YJ9 F;  3CCL F;  2BO1 A;  5EWR A;  5GAN K;  3CCE F;  1T0K B;  3G4S F;  5A2Q M;  1DT9 A;  2VGM A;  3G6E F;  3CD6 F;  4LCK A;  1H7M A;  2QEX F;  3RA5 A;  3N4Z A;  3LWP C;  2OTJ F;  3HJW C;  1E7K A;  3ON1 A;  1YIT F;  3OW2 F;  3LFO A;  3WXM B;  1X52 A;  1RA4 A;  3V7Q A;  4X3M A;  5G4U C;  1VQ8 F;  1NMU B;  2ALE A;  1YJW F;  2QI2 A;  3CCS F;  2KG4 A;  3CME F;  2JNB A;  2LBW A;  5GAP K;  1KQS F;  2KTU A;  1YHQ F;  4BY9 D;  1W41 A;  5GIP C;  3NVK E;  3MCA B;  3CCM F;  3SIU A;  2HVY D;  1VQ5 F;  3NVI B;  2OHW A;  4NUT A;  3CC2 F;  1W40 A;  3CXC F;  1YIJ F;  1QVG F;  3VMF B;  1K8A H;  1W3E X;  2LBX A;  3JCM M;  3NK6 A;  2KTV A;  1K73 H;  1GO0 A;  3G71 F;  3PAF A;  3CCV F;  2I6D A;  3CMA F;  1SDS A;  3LWQ C;  2CZW A;  3GYQ A;  1JJ2 F;  1VQL F;  5GIN C;  5EO3 A;  1VQ9 F;  1VQK F; 
#chains in the Genus database with same CATH topology
 5IJ0 B;  1X7O A;  3C9R A;  3WGK A;  1KNJ A;  3RYH B;  5LXT A;  1U40 A;  2BTO A;  3C9S A;  1Z5W A;  3HWU A;  2LBT A;  1CN7 A;  3CC7 F;  3E22 A;  2QTP A;  2ZOV A;  5FLX M;  4O2B B;  5HP7 A;  3F6M A;  1IV3 A;  3FPI A;  4EI9 A;  4PWT A;  1TVK B;  3LWO C;  3LME A;  1M90 H;  3RYI A;  2RHH A;  1PXW A;  5BMV A;  1GO1 A;  1VQN F;  4B62 A;  3VYT C;  4G4X A;  1U3L A;  4C8G A;  1Q81 H;  1H47 A;  3WJQ A;  5FNV A;  2RB9 A;  4ZHV A;  3HKE A;  2CVL A;  4BVR A;  2UYN B;  2KGW A;  2Q1X A;  1KC8 H;  3CCJ F;  3MBM A;  3E20 B;  2HS3 A;  3RYI B;  3DDN A;  3IKF A;  1W2B F;  1JY8 A;  2FC3 A;  3JAK A;  3I56 F;  5IT9 M;  2PHN A;  3IKE A;  1KNK A;  3E1Y A;  2IQQ A;  3KJJ A;  1XHO A;  5FNV B;  3F0F A;  3ZP7 A;  5DCV A;  1VQ7 F;  1W42 A;  1ZWZ A;  3GHZ A;  3JAS B;  5KX5 B;  1VQO F;  3WPX A;  5MN5 A;  2BO1 A;  1X25 A;  3KE1 A;  3CD6 F;  2QEX F;  4X1K A;  2OTJ F;  3ZP4 A;  2GZL A;  3HKC A;  3HJW C;  1E7K A;  5CA1 A;  3LFO A;  1X52 A;  3V7Q A;  4X3M A;  5G4U C;  2VAW A;  2ALE A;  5HP8 A;  2QI2 A;  3JAT B;  4I55 A;  3I3F A;  4HNA A;  2LBW A;  2BTQ B;  3JAR B;  5JVD A;  1YHQ F;  4LNU A;  2H8E A;  3ZO8 A;  3NVK E;  5HWE A;  3MCA B;  1TUB A;  3NVI B;  3D00 A;  3HKC B;  2HRU A;  3JAL A;  4M8I A;  4O4H B;  1YIJ F;  2UYK A;  3VMF B;  1K8A H;  1W3E X;  4TV8 B;  3P0Z A;  3K2X A;  2Z1E A;  2KTV A;  3NK6 A;  4TV9 A;  1GO0 A;  4EB6 B;  1VK3 A;  5KMG B;  4HNA B;  4NQ3 A;  1T0A A;  1VQL F;  2P6Y A;  5JVD B;  1COM A;  4LNU B;  5HY2 A;  3WJR A;  4ZHW A;  2NMU A;  5CA0 B;  1TUB B;  2OZB A;  3M4S A;  1RQ7 A;  5LA6 A;  1VQ6 F;  5HY4 A;  1RLG A;  2OTL F;  1VHA A;  3K12 A;  3S03 A;  4C8I A;  4XCQ A;  4TZZ A;  4ZOL A;  1FFX B;  4IIJ B;  4O4L B;  3IMP A;  4YJ2 A;  2VAP A;  3JAW A;  5LP6 B;  4I4T B;  2PMP A;  3J80 M;  5LA6 B;  3CCU F;  2Z01 A;  4YJ3 B;  3U0O A;  2HX0 A;  4U3J A;  3MCQ A;  2K1S A;  3KJK A;  4ZHY B;  5C8Y B;  3FD5 A;  4ZOL B;  2DYY A;  4X3L A;  5EIB D;  3FD6 A;  2GLZ A;  5J2U A;  1Z5V A;  4BT2 A;  5IYZ B;  2L26 A;  4YJ2 B;  3I7T A;  5EB0 A;  2Z1U A;  5EZY A;  3RYF A;  3CPQ A;  3VOB A;  3V7E A;  4DRX B;  3NMU C;  5JH7 A;  3CYP B;  5EAZ A;  2CW4 A;  2BTU A;  2ZAU A;  3RA6 A;  3K14 A;  3I55 F;  5LXT B;  3OON A;  3S0H A;  3TD4 A;  4B46 A;  4TUY A;  4B45 A;  3J7A R;  3E22 B;  3CCL F;  1YJ9 F;  3CCE F;  1T0K B;  4EI7 A;  3G4S F;  5A2Q M;  3B6N A;  4WBN A;  5J2U B;  4BT4 A;  4ZHQ A;  3RYF B;  1W55 A;  3G6E F;  1H7M A;  4KWE A;  2HP3 A;  5BMV B;  5JH7 B;  5J2T A;  3ON1 A;  1YIT F;  1JFF A;  5LOV A;  5HY0 A;  1VQ8 F;  1YJW F;  2Z1F A;  1W58 1;  1U3P A;  2KG4 A;  4C82 A;  3CME F;  5ITZ A;  3HKE B;  5CB4 A;  1QAH A;  1QD9 A;  4WBN B;  2RHO A;  4ZHQ B;  1FNK A;  3HKD A;  1W41 A;  4U39 A;  1ODE A;  3SIU A;  5HXZ A;  4IHJ A;  3CC2 F;  3T80 A;  1QVG F;  1JFF B;  4G4W A;  3JAK B;  5LOV B;  3BYQ A;  3JCM M;  3G71 F;  5GON A;  3IEQ A;  5HY1 A;  2N48 A;  3WPW A;  2I6D A;  2VAM A;  4G88 A;  3GYQ A;  5EO3 A;  3CB2 A;  2DT4 A;  2IG8 A;  3VO8 A;  4X20 A;  3WGL A;  4F6R A;  2B33 A;  4IHJ B;  2UYJ A;  5EB1 B;  3JVH A;  1KD1 H;  4X1K B;  3OBY A;  2OTM A;  1IV4 A;  5GON B;  2H8C A;  2GVI A;  2WAL A;  3Q8H A;  5CA1 B;  1XBI A;  2VXY A;  1IV1 A;  4BW0 B;  3C8L A;  1YQN A;  5MN6 A;  3S0Y A;  3UT5 A;  4O2A A;  3CCQ F;  3C9U A;  1GZ0 A;  4FFB A;  4I55 B;  2UYP A;  1VQ4 F;  4F6R B;  2UZH A;  1VQV A;  5EYP A;  3LWR C;  2VGN A;  4X1I A;  2CHS A;  3TD5 A;  1NJI H;  1YJN F;  3JAL B;  3WGN A;  1NQ3 A;  2R6R 1;  4O4J A;  1X7P A;  5G4V C;  4TV9 B;  3AGK A;  3S06 A;  5IJ9 A;  4R40 B;  3JAM M;  5AVM A;  1Q82 H;  1OAP A;  4B5C A;  3OBW A;  3S02 A;  3P4E A;  5LYJ A;  1GX1 A;  5GIO C;  3CG6 A;  4X1Y A;  3SIV A;  4X1I B;  4BT7 A;  1CLI A;  4ZI7 A;  1IV2 A;  1IPA A;  3CCR F;  2YXZ A;  3QUW A;  4O4J B;  5IJ0 A;  3R0P A;  5EWR A;  1DT9 A;  2VGM A;  1OFU A;  2ZOD A;  3WGM A;  4LCK A;  2MQE A;  3DC2 A;  1JD1 A;  3TD3 A;  3LWP C;  2H6L A;  3KHN A;  4G4Y A;  3JAW B;  3C9T A;  3OW2 F;  3WXM B;  1RA4 A;  3RYC A;  1NMU B;  1H48 A;  3ZOP A;  4U3J B;  3CCS F;  3MDO A;  2RHL A;  1JN1 A;  5JCO C;  4G4Z A;  3ERN A;  2IAF A;  1J7H A;  3CYQ A;  1QU9 A;  3VYU C;  4DXD A;  3CCM F;  2HVY D;  2ZVY A;  1VQ5 F;  2UYN A;  1W40 A;  2HS0 A;  1DBF A;  5EZY B;  1FNJ A;  2LBX A;  2F9Z C;  1SZQ A;  3RYC B;  2HQS C;  5JQG A;  3EOR A;  5EIB C;  3CMA F;  5MN4 A;  3HTN A;  3L7Q A;  3F0D A;  1SDS A;  1JJ2 F;  1VQ9 F;  1VQK F;  5HXU A;  3RE3 A;  2CWJ A;  4TUY B;  2LCA A;  5FJ4 C;  4C4W C;  1U43 A;  3HAX D;  2W8B C;  2YYE A;  3D54 A;  1VQM F;  3JAS A;  2ZF8 A;  3N2K A;  5KX5 A;  4BVQ A;  3IEW A;  3CPW F;  1S72 F;  5JCO A;  2HP0 A;  5J2T B;  5JQG B;  1M1K H;  3VTI C;  3HKB A;  4ERH A;  1RQ2 A;  1Q7Y H;  2QA4 F;  3MQW A;  1QVF F;  1UFY A;  3O85 A;  2HS4 A;  1YGY A;  3LWV C;  1YI2 F;  4ZK7 A;  3F0G A;  1K9M H;  5ITZ B;  5CB4 B;  2CHT A;  1VQP F;  3J81 M;  1W5F A;  3VOA A;  3N2K B;  3HKD B;  4BT5 A;  1UI9 A;  3D01 A;  2AIF A;  2HP0 B;  3JAT A;  1N8R H;  3K0T A;  3JAR A;  3HKB B;  3VYS C;  2I6R A;  4E6E A;  1XV2 A;  3N4Y A;  1Q8R A;  3P10 A;  3S0W A;  1VH8 A;  4O4I A;  4O4H A;  3WGJ A;  1W5B A;  3M1X A;  3PLA C;  2G9I A;  5LP6 C;  4TV8 A;  3ELC A;  1Q86 H;  3CC4 F;  4EB6 A;  4BT6 A;  3FFM A;  3NK7 A;  3QHD A;  2EWC A;  1XRG A;  5KMG A;  4X20 B;  3VI6 A;  1W5A A;  4I50 A;  3IR9 A;  4C81 A;  1FSZ A;  1W57 A;  3QTY A;  2R75 1;  2AMT A;  1ONI A;  1CK2 A;  5CA0 A;  5GAN K;  2Q1Y A;  4RQO A;  4O4I B;  4BVS A;  3ESJ A;  2FGY A;  2HRY A;  3RA5 A;  3N4Z A;  1RLU A;  3N2G A;  4G4V A;  3UT5 B;  4O2A B;  2CSL A;  4FFB B;  1SA0 A;  1W5E A;  4I50 B;  3WJP A;  1FFX A;  3GTZ A;  3KIZ A;  4IIJ A;  3M84 A;  5EYP B;  4O4L A;  2ZVZ A;  4BT3 A;  1R1M A;  5LP6 A;  2AIZ P;  1PF5 A;  2JNB A;  5GAP K;  4I4T A;  1KQS F;  3V3T A;  2KTU A;  4C8E A;  4BY9 D;  5GIP C;  4YJ3 A;  3V4D A;  3LDT A;  4NWO B;  5IJ9 B;  3RYH A;  5B8F A;  2OHW A;  3FBA A;  3N2G B;  3VIU A;  4NUT A;  2RHJ A;  2V9Y A;  3F0E A;  5C8Y A;  3CXC F;  4BVT A;  4RHA A;  1SA0 B;  5LYJ B;  4O2B A;  1K73 H;  2Z1T A;  3PAF A;  4X1Y B;  3CCV F;  1W59 A;  5IYZ A;  4EI8 A;  3LWQ C;  2CZW A;  1TVK A;  3VCZ A;  5GIN C;  4ZI7 B;  3LYB A;  4DRX A; 
#chains in the Genus database with same CATH homology
 5HY2 A;  1X7O A;  2OZB A;  5FJ4 C;  4C4W C;  3HAX D;  1VQM F;  1VQ6 F;  4BVQ A;  1KD1 H;  5HY4 A;  1RLG A;  1CN7 A;  3CC7 F;  3OBY A;  3CPW F;  1S72 F;  2OTL F;  5FLX M;  2WAL A;  4EI9 A;  4XCQ A;  4TZZ A;  1M1K H;  1XBI A;  1Q7Y H;  3LWO C;  4BW0 B;  2QA4 F;  1M90 H;  1QVF F;  3O85 A;  1VQN F;  1PXW A;  1GO1 A;  3LWV C;  1YI2 F;  1K9M H;  3CCQ F;  1GZ0 A;  1VQ4 F;  1VQP F;  3J81 M;  3J80 M;  3CCU F;  1Q81 H;  3LWR C;  2VGN A;  2AIF A;  1NJI H;  1YJN F;  1N8R H;  4BVR A;  1KC8 H;  4X3L A;  3N4Y A;  1X7P A;  5G4V C;  3CCJ F;  3AGK A;  3E20 B;  1W2B F;  2GLZ A;  3JAM M;  3PLA C;  2FC3 A;  1Q82 H;  3I56 F;  3CPQ A;  3OBW A;  5IT9 M;  3V7E A;  3NMU C;  1Q86 H;  3E1Y A;  5GIO C;  3CC4 F;  3FFM A;  3CG6 A;  3NK7 A;  3SIV A;  3VI6 A;  3RA6 A;  5DCV A;  1VQ7 F;  3I55 F;  1W42 A;  1ZWZ A;  1IPA A;  3CCR F;  3IR9 A;  1VQO F;  3J7A R;  1CK2 A;  1YJ9 F;  3CCL F;  2BO1 A;  5EWR A;  5GAN K;  3CCE F;  1T0K B;  4EI7 A;  3G4S F;  5A2Q M;  1DT9 A;  2VGM A;  4BVS A;  2FGY A;  3G6E F;  3CD6 F;  4LCK A;  1H7M A;  2QEX F;  3RA5 A;  3N4Z A;  3LWP C;  2OTJ F;  3HJW C;  1E7K A;  3ON1 A;  1YIT F;  3OW2 F;  3LFO A;  3WXM B;  1X52 A;  1RA4 A;  3V7Q A;  4X3M A;  5G4U C;  5HY0 A;  1VQ8 F;  1NMU B;  2ALE A;  1YJW F;  2QI2 A;  3CCS F;  2KG4 A;  3CME F;  2JNB A;  2LBW A;  5GAP K;  1KQS F;  3V3T A;  2KTU A;  1YHQ F;  4BY9 D;  1W41 A;  5GIP C;  3NVK E;  5HWE A;  3MCA B;  3CCM F;  3SIU A;  2HVY D;  5HXZ A;  1VQ5 F;  3D00 A;  3NVI B;  2OHW A;  4NUT A;  3CC2 F;  1W40 A;  3CXC F;  1YIJ F;  1QVG F;  3VMF B;  4BVT A;  1K8A H;  1W3E X;  2LBX A;  3JCM M;  2F9Z C;  2KTV A;  3NK6 A;  1K73 H;  1GO0 A;  3G71 F;  5HY1 A;  3PAF A;  3CCV F;  2I6D A;  4EI8 A;  3CMA F;  1SDS A;  3LWQ C;  2CZW A;  3GYQ A;  4NQ3 A;  1JJ2 F;  1VQL F;  5GIN C;  5EO3 A;  1VQ9 F;  5HXU A;  1VQK F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...