3TD4A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with diaminopimelate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
SHMELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein,peptide binding protein
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td4A00
3S06A 3TD4A 2ZOVA 3CYPB 2HQSC 3IMPA 2ZVYA 1R1MA 3S0YA 3WPXA 4ZHYB 2N48A 3S0WA 5EAZA 4PWTA 4ZHVA 4R40B 2ZF8A 2LBTA 3OONA 3KHNA 5EB0A 4ZHWA 3S0HA 3S03A 4G4ZA 4ERHA 4G4XA 4B5CA 4RHAA 2MQEA 2LCAA 4B62A 1OAPA 4G4VA 2W8BC 4G4WA 3TD5A 2L26A 3WPWA 3TD3A 3S02A 5EB1B 2AIZP 3LDTA 3CYQA 4G4YA 2KGWA 2ZVZA 2K1SA 4G88A
chains in the Genus database with same CATH superfamily
4ZI7A 3P10A 5LXTB 3C9SA 5C8YB 4XCQA 4BVRA 5ITZA 3VI6A 3WPXA 2R751 1W55A 3E20B 1PXWA 5GONB 1Q82H 3N4YA 1W59A 1T0AA 1VQ6F 3LMEA 4IHJB 2H8CA 5C8YA 3CCRF 1RQ2A 3MDOA 5IJ9A 5DCVA 3WXMB 4O4HA 3ELCA 5EO3A 3U0OA 3LWRC 3WGJA 3LWVC 1YQNA 3JAWB 2VAWA 1K73H 4C8EA 2DYYA 3KJKA 2ZF8A 3CB2A 2AIFA 4YJ3A 1U40A 1ODEA 4YJ2A 1Q8RA 2Q1XA 3NK7A 3NVKE 3WGLA 4G4VA 2VAMA 1RQ7A 1X52A 5EB1B 3V7QA 3T80A 5BMVB 1JFFB 3FBAA 4G4YA 3VOBA 1QU9A 4F6RB 3LWPC 4TUYA 3N2KA 1K9MH 3RYIB 3L7QA 5EYPB 4O4JB 4PWTA 5CB4B 5BMVA 1U3LA 2NMUA 1JFFA 3I7TA 2HRUA 1W57A 4C4WC 3HKDB 5HXUA 3DC2A 3RA6A 1W5AA 4C8GA 3HKBA 2OZBA 3RYIA 3IKFA 3OBYA 3N4ZA 1VQ5F 1M90H 1ZWZA 3F6MA 3IR9A 2CVLA 3JASB 2Z1UA 5G4VC 4BT6A 1RA4A 3E22B 1J7HA 2AMTA 2YYEA 3MCQA 1GX1A 2CHSA 4C82A 5A2QM 4TV8A 1FNKA 1W2BF 3CCMF 4BT7A 4ZHWA 1Z5WA 1VQ4F 2UYJA 3JASA 3HAXD 2QI2A 3E22A 2LCAA 3HKEB 2Z1EA 2OTMA 3VTIC 4O2BB 4EB6A 2UYNA 5EIBD 2GVIA 2L26A 1RLUA 2CW4A 5LOVA 2P6YA 3NMUC 3O85A 4TV9A 3QHDA 3UT5B 3NK6A 3VYSC 3R0PA 1QVFF 1M1KH 4X20B 5JVDB 2I6DA 3M4SA 3V7EA 5KX5B 2RHHA 4O4IA 3B6NA 3JARA 1Q86H 5HP7A 1DT9A 3ON1A 3OONA 3I56F 1E7KA 3UT5A 5GANK 3S03A 1W41A 2Q1YA 4RHAA 4ZI7B 3KJJA 3SIVA 2PMPA 2JNBA 1T0KB 1NJIH 3HKCA 3GYQA 3HTNA 5MN6A 1VK3A 3LDTA 2HP3A 5GAPK 5FJ4C 5HY1A 1XBIA 2OTJF 3CD6F 2VAPA 3E1YA 5HY0A 5GIOC 3ERNA 2RHJA 4BT3A 1KQSF 3OW2F 3ESJA 3K12A 4EI9A 3JAMM 4B45A 3KHNA 5IJ9B 1QAHA 4I50A 4I55A 1SA0A 5HY4A 1SZQA 5LP6C 4O4HB 1W5BA 3V3TA 1OAPA 3I55F 3FD5A 2VXYA 4IIJA 2AIZP 3LFOA 4FFBB 2Z01A 5CA1A 4X3MA 1K8AH 3CCSF 2LBWA 2HRYA 3LWQC 3F0GA 3D00A 1IV1A 4YJ3B 1CN7A 1W40A 4YJ2B 4ZK7A 3S0YA 1H47A 2IAFA 5JCOA 4FFBA 2KG4A 3D54A 3GHZA 5EB0A 5LA6A 2WALA 4X1KB 5HY2A 3WGMA 4G4ZA 3ZP7A 3G6EF 4RQOA 4ZOLA 4TUYB 5HXZA 3N2KB 1GO0A 3RYCA 5IJ0A 1VQNF 3VOAA 3M84A 1GO1A 3Q8HA 4X1KA 3CCQF 3VMFB 3WJPA 2GLZA 1X25A 5AVMA 2ZVYA 2Z1TA 3HKBB 1UI9A 2HP0B 5J2UA 2H6LA 3CCVF 2OHWA 5IYZA 1KD1H 5LP6A 4BT4A 3CCEF 2I6RA 4I4TA 4HNAA 2UZHA 3JATA 2KTVA 3M1XA 3RYFA 4BT2A 2BO1A 2HP0A 1Z5VA 3JALB 3MQWA 5EIBC 2VGMA 1X7OA 3SIUA 1QVGF 4U39A 2FC3A 3K0TA 1JY8A 4TV8B 4X1IA 3G4SF 1TUBA 2ZODA 5J2TB 1YHQF 3HJWC 4BVQA 3JCMM 3CC4F 3JALA 5FLXM 3RA5A 3F0DA 3KE1A 3C9TA 4EB6B 5EAZA 2UYNB 4O2AA 5LOVB 1W581 3N2GA 4LNUA 2G9IA 5J2TA 4TV9B 3CPQA 2QEXF 3ZOPA 3VYUC 2RB9A 2MQEA 3FPIA 3P4EA 3VCZA 1VHAA 5EZYA 5KMGB 3J80M 3IEQA 5B8FA 1SDSA 4O4IB 2RHOA 1W42A 3JARB 1H48A 1Q7YH 1YIJF 3CXCF 1YI2F 2BTUA 5KMGA 3VO8A 3S0WA 1IV4A 1FFXA 3HKCB 3D01A 3IEWA 3HWUA 2GZLA 5CA0A 4ERHA 3WJQA 5G4UC 2BTQB 1DBFA 3WJRA 1VQ8F 1VQLF 1XRGA 4O4LA 1KNKA 4C81A 5EWRA 1VQ7F 2R6R1 1TVKA 5IT9M 3LYBA 2HS3A 5JH7A 3S06A 3WGKA 4I50B 4I55B 1SA0B 2BTOA 2ZAUA 4X1YB 4DRXB 3CMEF 2N48A 1FNJA 4TZZA 3I3FA 3DDNA 3MCAB 1RLGA 2PHNA 3PAFA 1U43A 2FGYA 4IIJB 3K14A 3F0EA 5CA1B 3QUWA 1JD1A 3CCUF 3VIUA 4X1YA 1QD9A 3FD6A 4DRXA 5JQGA 1KC8H 3VYTC 4G4WA 3JAKA 1U3PA 2V9YA 2HX0A 3NVIB 1OFUA 2K1SA 5LA6B 3J7AR 3TD4A 5LYJA 2ALEA 4ZHQA 2OTLF 3QTYA 2UYKA 3C8LA 1YJWF 4ZOLB 4ZHYB 5FNVA 3ZP4A 3RYCB 2UYPA 5IJ0B 3S0HA 4WBNB 2HS4A 5LXTA 2QTPA 2Z1FA 3CC7F 1YJNF 3EORA 4X3LA 4B62A 2EWCA 2F9ZC 5GONA 1UFYA 5J2UB 2CHTA 3C9UA 3K2XA 3CPWF 4E6EA 5IYZB 4EI7A 1VQMF 5LP6B 1X7PA 3WGNA 4WBNA 4IHJA 4NQ3A 3J81M 2RHLA 4KWEA 4BVSA 1JJ2F 3CYPB 1R1MA 4HNAB 4I4TB 3JATB 3RYFB 3G71F 1NQ3A 2DT4A 2QA4F 5HWEA 1CK2A 1IV2A 2IQQA 4X1IB 4G4XA 3RYHB 3JAWA 1TUBB 1XHOA 1CLIA 1VQ9F 3FFMA 3WPWA 4C8IA 1COMA 4M8IA 3S02A 3CCJF 4NUTA 1IPAA 3CCLF 2CZWA 4O2AB 2KGWA 1VQKF 4EI8A 3RYHA 1Q81H 3N2GB 4LNUB 1W5FA 2HQSC 3IMPA 4BW0B 3KIZA 4U3JB 5EZYB 3RE3A 2CWJA 4R40B 5MN4A 2B33A 4BVTA 4F6RA 4B5CA 1YITF 4U3JA 5EYPA 5GIPC 4O4JA 5CB4A 2YXZA 2CSLA 3HKDA 1N8RH 3CYQA 5GINC 1FFXB 3BYQA 3C9RA 1YGYA 5CA0B 2LBXA 5MN5A 2ZOVA 3P0ZA 5HP8A 4DXDA 1XV2A 4ZHVA 2VGNA 3JVHA 2LBTA 4BY9D 1KNJA 4O4LB 1W5EA 1TVKB 1H7MA 4NWOB 5JH7B 3F0FA 4BT5A 2W8BC 1S72F 1FSZA 3TD3A 1JN1A 3MBMA 1YJ9F 1GZ0A 3ZO8A 4B46A 4G88A 3PLAC 3CC2F 3HKEA 1VQOF 4O2BA 3LWOC 4LCKA 1IV3A 3CG6A 5JQGB 3AGKA 1NMUB 2IG8A 3JAKB 1VH8A 3V4DA 3GTZA 2KTUA 3OBWA 4X20A 5JCOC 5JVDA 5KX5A 5LYJB 1ONIA 2H8EA 1W3EX 5ITZB 4ZHQB 3TD5A 2HVYD 2HS0A 5FNVB 1VQVA 1PF5A 3IKEA 2ZVZA 3CMAF 1VQPF
chains in the Genus database with same CATH topology
3S06A 3TD4A 2ZOVA 3CYPB 2HQSC 3IMPA 2ZVYA 1R1MA 3S0YA 3WPXA 4ZHYB 2N48A 3S0WA 5EAZA 4PWTA 4ZHVA 4R40B 2ZF8A 2LBTA 3OONA 3KHNA 5EB0A 4ZHWA 3S0HA 3S03A 4G4ZA 4ERHA 4G4XA 4B5CA 4RHAA 2MQEA 2LCAA 4B62A 1OAPA 4G4VA 2W8BC 4G4WA 3TD5A 2L26A 3WPWA 3TD3A 3S02A 5EB1B 2AIZP 3LDTA 3CYQA 4G4YA 2KGWA 2ZVZA 2K1SA 4G88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S06 A;  3TD4 A;  2ZOV A;  3CYP B;  2HQS C;  3IMP A;  2ZVY A;  1R1M A;  3S0Y A;  3WPX A;  4ZHY B;  2N48 A;  3S0W A;  5EAZ A;  4PWT A;  4ZHV A;  4R40 B;  2ZF8 A;  2LBT A;  3OON A;  3KHN A;  5EB0 A;  4ZHW A;  3S0H A;  3S03 A;  4G4Z A;  4ERH A;  4G4X A;  4B5C A;  4RHA A;  2MQE A;  2LCA A;  4B62 A;  1OAP A;  4G4V A;  2W8B C;  4G4W A;  3TD5 A;  2L26 A;  3WPW A;  3TD3 A;  3S02 A;  5EB1 B;  2AIZ P;  3LDT A;  3CYQ A;  4G4Y A;  2KGW A;  2ZVZ A;  2K1S A;  4G88 A; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  3P10 A;  5LXT B;  3C9S A;  5C8Y B;  4XCQ A;  4BVR A;  5ITZ A;  3VI6 A;  3WPX A;  2R75 1;  1W55 A;  3E20 B;  1PXW A;  5GON B;  1Q82 H;  3N4Y A;  1W59 A;  1T0A A;  1VQ6 F;  3LME A;  4IHJ B;  2H8C A;  5C8Y A;  3CCR F;  1RQ2 A;  3MDO A;  5IJ9 A;  5DCV A;  3WXM B;  4O4H A;  3ELC A;  5EO3 A;  3U0O A;  3LWR C;  3WGJ A;  3LWV C;  1YQN A;  3JAW B;  2VAW A;  1K73 H;  4C8E A;  2DYY A;  3KJK A;  2ZF8 A;  3CB2 A;  2AIF A;  4YJ3 A;  1U40 A;  1ODE A;  4YJ2 A;  1Q8R A;  2Q1X A;  3NK7 A;  3NVK E;  3WGL A;  4G4V A;  2VAM A;  1RQ7 A;  1X52 A;  5EB1 B;  3V7Q A;  3T80 A;  5BMV B;  1JFF B;  3FBA A;  4G4Y A;  3VOB A;  1QU9 A;  4F6R B;  3LWP C;  4TUY A;  3N2K A;  1K9M H;  3RYI B;  3L7Q A;  5EYP B;  4O4J B;  4PWT A;  5CB4 B;  5BMV A;  1U3L A;  2NMU A;  1JFF A;  3I7T A;  2HRU A;  1W57 A;  4C4W C;  3HKD B;  5HXU A;  3DC2 A;  3RA6 A;  1W5A A;  4C8G A;  3HKB A;  2OZB A;  3RYI A;  3IKF A;  3OBY A;  3N4Z A;  1VQ5 F;  1M90 H;  1ZWZ A;  3F6M A;  3IR9 A;  2CVL A;  3JAS B;  2Z1U A;  5G4V C;  4BT6 A;  1RA4 A;  3E22 B;  1J7H A;  2AMT A;  2YYE A;  3MCQ A;  1GX1 A;  2CHS A;  4C82 A;  5A2Q M;  4TV8 A;  1FNK A;  1W2B F;  3CCM F;  4BT7 A;  4ZHW A;  1Z5W A;  1VQ4 F;  2UYJ A;  3JAS A;  3HAX D;  2QI2 A;  3E22 A;  2LCA A;  3HKE B;  2Z1E A;  2OTM A;  3VTI C;  4O2B B;  4EB6 A;  2UYN A;  5EIB D;  2GVI A;  2L26 A;  1RLU A;  2CW4 A;  5LOV A;  2P6Y A;  3NMU C;  3O85 A;  4TV9 A;  3QHD A;  3UT5 B;  3NK6 A;  3VYS C;  3R0P A;  1QVF F;  1M1K H;  4X20 B;  5JVD B;  2I6D A;  3M4S A;  3V7E A;  5KX5 B;  2RHH A;  4O4I A;  3B6N A;  3JAR A;  1Q86 H;  5HP7 A;  1DT9 A;  3ON1 A;  3OON A;  3I56 F;  1E7K A;  3UT5 A;  5GAN K;  3S03 A;  1W41 A;  2Q1Y A;  4RHA A;  4ZI7 B;  3KJJ A;  3SIV A;  2PMP A;  2JNB A;  1T0K B;  1NJI H;  3HKC A;  3GYQ A;  3HTN A;  5MN6 A;  1VK3 A;  3LDT A;  2HP3 A;  5GAP K;  5FJ4 C;  5HY1 A;  1XBI A;  2OTJ F;  3CD6 F;  2VAP A;  3E1Y A;  5HY0 A;  5GIO C;  3ERN A;  2RHJ A;  4BT3 A;  1KQS F;  3OW2 F;  3ESJ A;  3K12 A;  4EI9 A;  3JAM M;  4B45 A;  3KHN A;  5IJ9 B;  1QAH A;  4I50 A;  4I55 A;  1SA0 A;  5HY4 A;  1SZQ A;  5LP6 C;  4O4H B;  1W5B A;  3V3T A;  1OAP A;  3I55 F;  3FD5 A;  2VXY A;  4IIJ A;  2AIZ P;  3LFO A;  4FFB B;  2Z01 A;  5CA1 A;  4X3M A;  1K8A H;  3CCS F;  2LBW A;  2HRY A;  3LWQ C;  3F0G A;  3D00 A;  1IV1 A;  4YJ3 B;  1CN7 A;  1W40 A;  4YJ2 B;  4ZK7 A;  3S0Y A;  1H47 A;  2IAF A;  5JCO A;  4FFB A;  2KG4 A;  3D54 A;  3GHZ A;  5EB0 A;  5LA6 A;  2WAL A;  4X1K B;  5HY2 A;  3WGM A;  4G4Z A;  3ZP7 A;  3G6E F;  4RQO A;  4ZOL A;  4TUY B;  5HXZ A;  3N2K B;  1GO0 A;  3RYC A;  5IJ0 A;  1VQN F;  3VOA A;  3M84 A;  1GO1 A;  3Q8H A;  4X1K A;  3CCQ F;  3VMF B;  3WJP A;  2GLZ A;  1X25 A;  5AVM A;  2ZVY A;  2Z1T A;  3HKB B;  1UI9 A;  2HP0 B;  5J2U A;  2H6L A;  3CCV F;  2OHW A;  5IYZ A;  1KD1 H;  5LP6 A;  4BT4 A;  3CCE F;  2I6R A;  4I4T A;  4HNA A;  2UZH A;  3JAT A;  2KTV A;  3M1X A;  3RYF A;  4BT2 A;  2BO1 A;  2HP0 A;  1Z5V A;  3JAL B;  3MQW A;  5EIB C;  2VGM A;  1X7O A;  3SIU A;  1QVG F;  4U39 A;  2FC3 A;  3K0T A;  1JY8 A;  4TV8 B;  4X1I A;  3G4S F;  1TUB A;  2ZOD A;  5J2T B;  1YHQ F;  3HJW C;  4BVQ A;  3JCM M;  3CC4 F;  3JAL A;  5FLX M;  3RA5 A;  3F0D A;  3KE1 A;  3C9T A;  4EB6 B;  5EAZ A;  2UYN B;  4O2A A;  5LOV B;  1W58 1;  3N2G A;  4LNU A;  2G9I A;  5J2T A;  4TV9 B;  3CPQ A;  2QEX F;  3ZOP A;  3VYU C;  2RB9 A;  2MQE A;  3FPI A;  3P4E A;  3VCZ A;  1VHA A;  5EZY A;  5KMG B;  3J80 M;  3IEQ A;  5B8F A;  1SDS A;  4O4I B;  2RHO A;  1W42 A;  3JAR B;  1H48 A;  1Q7Y H;  1YIJ F;  3CXC F;  1YI2 F;  2BTU A;  5KMG A;  3VO8 A;  3S0W A;  1IV4 A;  1FFX A;  3HKC B;  3D01 A;  3IEW A;  3HWU A;  2GZL A;  5CA0 A;  4ERH A;  3WJQ A;  5G4U C;  2BTQ B;  1DBF A;  3WJR A;  1VQ8 F;  1VQL F;  1XRG A;  4O4L A;  1KNK A;  4C81 A;  5EWR A;  1VQ7 F;  2R6R 1;  1TVK A;  5IT9 M;  3LYB A;  2HS3 A;  5JH7 A;  3S06 A;  3WGK A;  4I50 B;  4I55 B;  1SA0 B;  2BTO A;  2ZAU A;  4X1Y B;  4DRX B;  3CME F;  2N48 A;  1FNJ A;  4TZZ A;  3I3F A;  3DDN A;  3MCA B;  1RLG A;  2PHN A;  3PAF A;  1U43 A;  2FGY A;  4IIJ B;  3K14 A;  3F0E A;  5CA1 B;  3QUW A;  1JD1 A;  3CCU F;  3VIU A;  4X1Y A;  1QD9 A;  3FD6 A;  4DRX A;  5JQG A;  1KC8 H;  3VYT C;  4G4W A;  3JAK A;  1U3P A;  2V9Y A;  2HX0 A;  3NVI B;  1OFU A;  2K1S A;  5LA6 B;  3J7A R;  3TD4 A;  5LYJ A;  2ALE A;  4ZHQ A;  2OTL F;  3QTY A;  2UYK A;  3C8L A;  1YJW F;  4ZOL B;  4ZHY B;  5FNV A;  3ZP4 A;  3RYC B;  2UYP A;  5IJ0 B;  3S0H A;  4WBN B;  2HS4 A;  5LXT A;  2QTP A;  2Z1F A;  3CC7 F;  1YJN F;  3EOR A;  4X3L A;  4B62 A;  2EWC A;  2F9Z C;  5GON A;  1UFY A;  5J2U B;  2CHT A;  3C9U A;  3K2X A;  3CPW F;  4E6E A;  5IYZ B;  4EI7 A;  1VQM F;  5LP6 B;  1X7P A;  3WGN A;  4WBN A;  4IHJ A;  4NQ3 A;  3J81 M;  2RHL A;  4KWE A;  4BVS A;  1JJ2 F;  3CYP B;  1R1M A;  4HNA B;  4I4T B;  3JAT B;  3RYF B;  3G71 F;  1NQ3 A;  2DT4 A;  2QA4 F;  5HWE A;  1CK2 A;  1IV2 A;  2IQQ A;  4X1I B;  4G4X A;  3RYH B;  3JAW A;  1TUB B;  1XHO A;  1CLI A;  1VQ9 F;  3FFM A;  3WPW A;  4C8I A;  1COM A;  4M8I A;  3S02 A;  3CCJ F;  4NUT A;  1IPA A;  3CCL F;  2CZW A;  4O2A B;  2KGW A;  1VQK F;  4EI8 A;  3RYH A;  1Q81 H;  3N2G B;  4LNU B;  1W5F A;  2HQS C;  3IMP A;  4BW0 B;  3KIZ A;  4U3J B;  5EZY B;  3RE3 A;  2CWJ A;  4R40 B;  5MN4 A;  2B33 A;  4BVT A;  4F6R A;  4B5C A;  1YIT F;  4U3J A;  5EYP A;  5GIP C;  4O4J A;  5CB4 A;  2YXZ A;  2CSL A;  3HKD A;  1N8R H;  3CYQ A;  5GIN C;  1FFX B;  3BYQ A;  3C9R A;  1YGY A;  5CA0 B;  2LBX A;  5MN5 A;  2ZOV A;  3P0Z A;  5HP8 A;  4DXD A;  1XV2 A;  4ZHV A;  2VGN A;  3JVH A;  2LBT A;  4BY9 D;  1KNJ A;  4O4L B;  1W5E A;  1TVK B;  1H7M A;  4NWO B;  5JH7 B;  3F0F A;  4BT5 A;  2W8B C;  1S72 F;  1FSZ A;  3TD3 A;  1JN1 A;  3MBM A;  1YJ9 F;  1GZ0 A;  3ZO8 A;  4B46 A;  4G88 A;  3PLA C;  3CC2 F;  3HKE A;  1VQO F;  4O2B A;  3LWO C;  4LCK A;  1IV3 A;  3CG6 A;  5JQG B;  3AGK A;  1NMU B;  2IG8 A;  3JAK B;  1VH8 A;  3V4D A;  3GTZ A;  2KTU A;  3OBW A;  4X20 A;  5JCO C;  5JVD A;  5KX5 A;  5LYJ B;  1ONI A;  2H8E A;  1W3E X;  5ITZ B;  4ZHQ B;  3TD5 A;  2HVY D;  2HS0 A;  5FNV B;  1VQV A;  1PF5 A;  3IKE A;  2ZVZ A;  3CMA F;  1VQP F; 
#chains in the Genus database with same CATH homology
 3S06 A;  3TD4 A;  2ZOV A;  3CYP B;  2HQS C;  3IMP A;  2ZVY A;  1R1M A;  3S0Y A;  3WPX A;  4ZHY B;  2N48 A;  3S0W A;  5EAZ A;  4PWT A;  4ZHV A;  4R40 B;  2ZF8 A;  2LBT A;  3OON A;  3KHN A;  5EB0 A;  4ZHW A;  3S0H A;  3S03 A;  4G4Z A;  4ERH A;  4G4X A;  4B5C A;  4RHA A;  2MQE A;  2LCA A;  4B62 A;  1OAP A;  4G4V A;  2W8B C;  4G4W A;  3TD5 A;  2L26 A;  3WPW A;  3TD3 A;  3S02 A;  5EB1 B;  2AIZ P;  3LDT A;  3CYQ A;  4G4Y A;  2KGW A;  2ZVZ A;  2K1S A;  4G88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...