3TD4A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with diaminopimelate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
SHMELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein,peptide binding protein
molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td4A00
5EAZA 4G4XA 5EB1B 4G88A 3KHNA 2HQSC 2ZOVA 3S0WA 4ERHA 3TD5A 2LCAA 1R1MA 3S0YA 4ZHWA 2W8BC 3TD4A 2KGWA 2MQEA 5EB0A 3S03A 2AIZP 4G4ZA 1OAPA 3OONA 2N48A 3TD3A 4PWTA 2L26A 3CYPB 4B62A 3S02A 4B5CA 4ZHYB 4G4VA 4RHAA 3WPWA 2ZVYA 4R40B 4G4YA 2K1SA 3IMPA 4G4WA 3S06A 3S0HA 2ZVZA 3WPXA 4ZHVA 2LBTA 3CYQA 2ZF8A 3LDTA
chains in the Genus database with same CATH superfamily
3L7QA 5GONB 1K8AH 1YITF 1VQ7F 4O4HA 3V7EA 5KX5B 2WALA 1W42A 3C9TA 5GIOC 3FBAA 1TUBB 5C8YB 4RQOA 3ELCA 5CB4B 1VK3A 5ITZA 3CXCF 3RYHB 5LXTA 4ZHYB 3CCRF 4C82A 3QUWA 2Z1TA 3PAFA 4DRXB 2OZBA 2ZVYA 4I50B 2JNBA 3ESJA 2RB9A 3MDOA 3IKEA 5IT9M 3CMAF 3E22B 5GANK 2DYYA 3WJPA 1RLUA 4EB6A 4BY9D 1VQ9F 3VYUC 3S0YA 1PXWA 3D54A 3MBMA 4IIJB 4ZK7A 1YI2F 2N48A 3TD3A 3LWQC 4YJ3B 3G6EF 3JAKB 3LWRC 2QA4F 1W3EX 4LNUB 5EZYA 4O4IB 4TUYA 5LP6C 1H48A 4LCKA 2ZODA 4O2BB 2VGMA 1JN1A 4NUTA 4ZHVA 5MN5A 1VQKF 1YIJF 1Q81H 5EAZA 5EB1B 2H8CA 5BMVB 5IJ9B 1JFFA 1GO1A 2GVIA 5IJ0B 5EWRA 4O4LA 1OAPA 4IHJB 2Z1EA 3K14A 2CHSA 4PWTA 3D00A 3CYPB 3D01A 4O2AB 1QVGF 5JQGA 1X7PA 3C9RA 1W55A 1GX1A 2ZVZA 3VCZA 3VO8A 1E7KA 3JCMM 5JCOC 1TVKB 1NMUB 4TV8B 1OFUA 3NK6A 3P10A 3P4EA 1Q8RA 3ZP4A 1VQMF 3FD6A 1CLIA 4G4ZA 4ZOLB 2HS3A 1T0AA 3JAWB 2B33A 3E20B 3G4SF 1VQVA 3CC4F 3WPWA 3JVHA 1CN7A 2BTUA 2Z1UA 5FNVB 1Q7YH 2HRUA 1KNKA 1M1KH 1UI9A 4X1IB 3V3TA 2R6R1 3VTIC 1H7MA 3JAMM 3KHNA 4BVSA 1SA0B 1X25A 1DBFA 2LCAA 4BT4A 2VAWA 2MQEA 2QEXF 4C8IA 2LBXA 3LWOC 3I3FA 4WBNB 2CW4A 1W581 2RHLA 2KG4A 3DDNA 1VHAA 2AMTA 1VQLF 5DCVA 5EYPA 3JALA 3CC2F 5GAPK 2EWCA 4ZI7B 2HP0B 2LBWA 4R40B 2RHOA 1GO0A 5CA0A 3S0HA 1VQ5F 3RYCA 3I7TA 3N2GB 3HTNA 5JH7A 3NVIB 3N4YA 4X3LA 1RA4A 5GIPC 2IAFA 4X1YA 2V9YA 3G71F 2DT4A 5A2QM 5HY4A 3HKBA 3LYBA 2W8BC 5MN6A 4KWEA 4EI9A 2CWJA 2ZAUA 4U3JB 5HP8A 4BW0B 1FFXB 1X52A 4NWOB 4X20B 4BT5A 3JATA 1W2BF 2L26A 2I6DA 3WJRA 2OHWA 3KJJA 3M4SA 3DC2A 1N8RH 2F9ZC 1YJWF 3HKDB 4DXDA 5MN4A 2VXYA 3KJKA 1FSZA 4G4XA 3HKCA 4TV9B 1K73H 3RYCB 3FPIA 5JVDA 4C4WC 1YHQF 2OTMA 1QD9A 1M90H 3JASB 4F6RA 3UT5A 3AGKA 1W57A 3WGMA 4O4HB 4X1KA 2HRYA 2Q1XA 1S72F 3CC7F 5HP7A 3HAXD 3F6MA 5IYZA 5ITZB 2P6YA 4NQ3A 3ON1A 1VQNF 2UYJA 1JY8A 5LXTB 5KMGA 5FJ4C 1IV3A 3WGKA 3TD4A 2IG8A 2KGWA 4EB6B 3HKEA 3OONA 4I4TA 2YXZA 3F0DA 5LYJA 1Z5VA 4E6EA 2UYNA 4M8IA 3IKFA 3M84A 3RYIA 1FNJA 3M1XA 3ZO8A 2PMPA 3I55F 2K1SA 3N2KA 3HWUA 4HNAA 3IMPA 3VOAA 3WPXA 2HX0A 5IYZB 5EZYB 4TUYB 1U40A 2UZHA 3WGNA 3ZP7A 4FFBA 3CCLF 5CA1A 3VIUA 5AVMA 3IR9A 3GTZA 1W5BA 1VQ8F 5G4UC 5LP6A 3EORA 3P0ZA 1JFFB 3CPWF 3JARA 3CCUF 1VQOF 2FC3A 5EIBD 2RHHA 4O4LB 5LYJB 3NK7A 3IEQA 3GHZA 4ZHQA 4B46A 1VQ6F 4YJ2A 5LA6A 5JQGB 1YJ9F 3CMEF 4C8GA 1RQ7A 3F0GA 3LMEA 4XCQA 5EB0A 3U0OA 5HY1A 2UYPA 3FFMA 3PLAC 3HJWC 5JCOA 3N4ZA 5LP6B 2VAPA 3O85A 3K2XA 5GONA 3JARB 1Q82H 4G4WA 5KX5A 1IV2A 1TUBA 5C8YA 4EI7A 1QVFF 4G88A 5CB4A 1K9MH 4BT7A 2Z01A 1U3PA 2BTOA 4DRXA 5J2TA 3RA5A 4I50A 3BYQA 2CVLA 3RE3A 2FGYA 3WJQA 3I56F 3CCVF 3E22A 3KE1A 4B5CA 5FLXM 2HS0A 3WXMB 3F0FA 4C8EA 3VYSC 3CB2A 1YQNA 1U43A 1XBIA 3NMUC 1VH8A 1ODEA 3R0PA 2IQQA 1W41A 1XV2A 5EYPB 3JALB 1GZ0A 4BT6A 3CCEF 1VQ4F 1NQ3A 1YGYA 3LFOA 3K0TA 4IIJA 1KQSF 1H47A 3CD6F 2ZOVA 1NJIH 5CA0B 1W5FA 3C9SA 4YJ3A 3VYTC 4ZHWA 5JH7B 1T0KB 4I55A 3JAKA 4LNUA 1IV1A 4X1YB 4O4IA 4X3MA 2CZWA 3HKBB 4B62A 4O2BA 2NMUA 5J2TB 3E1YA 3QHDA 1U3LA 4RHAA 4G4YA 2Z1FA 3K12A 3JATB 2HP3A 5BMVA 5IJ9A 3MCQA 2OTJF 3VI6A 3J80M 2I6RA 2LBTA 3CYQA 4BVRA 3CCSF 1J7HA 3VMFB 5IJ0A 4ERHA 3CCQF 4IHJA 4O4JA 3RA6A 1R1MA 3KIZA 3J7AR 3HKCB 3RYFA 4O2AA 5HY0A 3C8LA 5JVDB 1RLGA 4I55B 3S02A 4F6RB 3UT5B 1KD1H 1JD1A 1W40A 1UFYA 3ZOPA 5HWEA 1TVKA 3QTYA 2YYEA 4TV8A 4X1KB 5GINC 2GZLA 3WGLA 5EIBC 3S06A 1VQPF 1QU9A 3FD5A 1DT9A 5LOVA 2BO1A 3LDTA 1FNKA 2HQSC 3F0EA 3MCAB 4ZOLA 3CCJF 2PHNA 2UYKA 3JAWA 1CK2A 5KMGB 1QAHA 3LWPC 2AIFA 2AIZP 3OBYA 1W59A 4O4JB 1PF5A 1X7OA 5FNVA 5HXUA 2ALEA 4G4VA 3RYFB 4X1IA 3WGJA 2RHJA 1SZQA 5HY2A 3HKEB 4I4TB 3NVKE 2CSLA 2CHTA 1ZWZA 1SA0A 2UYNB 1YJNF 3RYIB 2OTLF 4BVTA 5J2UA 1KNJA 3MQWA 1IPAA 3S0WA 3N2KB 4WBNA 3LWVC 1KC8H 4HNAB 2GLZA 3TD5A 2KTVA 5LOVB 2H8EA 2HS4A 4TZZA 3OBWA 4BT3A 3S03A 4ZI7A 3V7QA 2HP0A 5EO3A 2VAMA 1ONIA 1COMA 1XRGA 1Z5WA 1RQ2A 2KTUA 4FFBB 3SIUA 5CA1B 3T80A 3SIVA 2QI2A 3N2GA 3GYQA 2BTQB 2R751 5G4VC 4BT2A 4EI8A 4BVQA 3IEWA 3CPQA 1JJ2F 2QTPA 5B8FA 3CCMF 2ZF8A 4U3JA 1W5EA 3OW2F 1FFXA 3B6NA 4B45A 4X20A 3Q8HA 4ZHQB 5J2UB 4YJ2B 1W5AA 2H6LA 5LA6B 3RYHA 5HXZA 3V4DA 2HVYD 3J81M 3HKDA 3VOBA 1SDSA 2Q1YA 4C81A 1XHOA 4U39A 3C9UA 3CG6A 1Q86H 1IV4A 2G9IA 4TV9A 3ERNA 3JASA 2VGNA
chains in the Genus database with same CATH topology
5EAZA 4G4XA 5EB1B 4G88A 3KHNA 2HQSC 2ZOVA 3S0WA 4ERHA 3TD5A 2LCAA 1R1MA 3S0YA 4ZHWA 2W8BC 3TD4A 2KGWA 2MQEA 5EB0A 3S03A 2AIZP 4G4ZA 1OAPA 3OONA 2N48A 3TD3A 4PWTA 2L26A 3CYPB 4B62A 3S02A 4B5CA 4ZHYB 4G4VA 4RHAA 3WPWA 2ZVYA 4R40B 4G4YA 2K1SA 3IMPA 4G4WA 3S06A 3S0HA 2ZVZA 3WPXA 4ZHVA 2LBTA 3CYQA 2ZF8A 3LDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAZ A;  4G4X A;  5EB1 B;  4G88 A;  3KHN A;  2HQS C;  2ZOV A;  3S0W A;  4ERH A;  3TD5 A;  2LCA A;  1R1M A;  3S0Y A;  4ZHW A;  2W8B C;  3TD4 A;  2KGW A;  2MQE A;  5EB0 A;  3S03 A;  2AIZ P;  4G4Z A;  1OAP A;  3OON A;  2N48 A;  3TD3 A;  4PWT A;  2L26 A;  3CYP B;  4B62 A;  3S02 A;  4B5C A;  4ZHY B;  4G4V A;  4RHA A;  3WPW A;  2ZVY A;  4R40 B;  4G4Y A;  2K1S A;  3IMP A;  4G4W A;  3S06 A;  3S0H A;  2ZVZ A;  3WPX A;  4ZHV A;  2LBT A;  3CYQ A;  2ZF8 A;  3LDT A; 
#chains in the Genus database with same CATH topology
 3L7Q A;  5GON B;  1K8A H;  1YIT F;  1VQ7 F;  4O4H A;  3V7E A;  5KX5 B;  2WAL A;  1W42 A;  3C9T A;  5GIO C;  3FBA A;  1TUB B;  5C8Y B;  4RQO A;  3ELC A;  5CB4 B;  1VK3 A;  5ITZ A;  3CXC F;  3RYH B;  5LXT A;  4ZHY B;  3CCR F;  4C82 A;  3QUW A;  2Z1T A;  3PAF A;  4DRX B;  2OZB A;  2ZVY A;  4I50 B;  2JNB A;  3ESJ A;  2RB9 A;  3MDO A;  3IKE A;  5IT9 M;  3CMA F;  3E22 B;  5GAN K;  2DYY A;  3WJP A;  1RLU A;  4EB6 A;  4BY9 D;  1VQ9 F;  3VYU C;  3S0Y A;  1PXW A;  3D54 A;  3MBM A;  4IIJ B;  4ZK7 A;  1YI2 F;  2N48 A;  3TD3 A;  3LWQ C;  4YJ3 B;  3G6E F;  3JAK B;  3LWR C;  2QA4 F;  1W3E X;  4LNU B;  5EZY A;  4O4I B;  4TUY A;  5LP6 C;  1H48 A;  4LCK A;  2ZOD A;  4O2B B;  2VGM A;  1JN1 A;  4NUT A;  4ZHV A;  5MN5 A;  1VQK F;  1YIJ F;  1Q81 H;  5EAZ A;  5EB1 B;  2H8C A;  5BMV B;  5IJ9 B;  1JFF A;  1GO1 A;  2GVI A;  5IJ0 B;  5EWR A;  4O4L A;  1OAP A;  4IHJ B;  2Z1E A;  3K14 A;  2CHS A;  4PWT A;  3D00 A;  3CYP B;  3D01 A;  4O2A B;  1QVG F;  5JQG A;  1X7P A;  3C9R A;  1W55 A;  1GX1 A;  2ZVZ A;  3VCZ A;  3VO8 A;  1E7K A;  3JCM M;  5JCO C;  1TVK B;  1NMU B;  4TV8 B;  1OFU A;  3NK6 A;  3P10 A;  3P4E A;  1Q8R A;  3ZP4 A;  1VQM F;  3FD6 A;  1CLI A;  4G4Z A;  4ZOL B;  2HS3 A;  1T0A A;  3JAW B;  2B33 A;  3E20 B;  3G4S F;  1VQV A;  3CC4 F;  3WPW A;  3JVH A;  1CN7 A;  2BTU A;  2Z1U A;  5FNV B;  1Q7Y H;  2HRU A;  1KNK A;  1M1K H;  1UI9 A;  4X1I B;  3V3T A;  2R6R 1;  3VTI C;  1H7M A;  3JAM M;  3KHN A;  4BVS A;  1SA0 B;  1X25 A;  1DBF A;  2LCA A;  4BT4 A;  2VAW A;  2MQE A;  2QEX F;  4C8I A;  2LBX A;  3LWO C;  3I3F A;  4WBN B;  2CW4 A;  1W58 1;  2RHL A;  2KG4 A;  3DDN A;  1VHA A;  2AMT A;  1VQL F;  5DCV A;  5EYP A;  3JAL A;  3CC2 F;  5GAP K;  2EWC A;  4ZI7 B;  2HP0 B;  2LBW A;  4R40 B;  2RHO A;  1GO0 A;  5CA0 A;  3S0H A;  1VQ5 F;  3RYC A;  3I7T A;  3N2G B;  3HTN A;  5JH7 A;  3NVI B;  3N4Y A;  4X3L A;  1RA4 A;  5GIP C;  2IAF A;  4X1Y A;  2V9Y A;  3G71 F;  2DT4 A;  5A2Q M;  5HY4 A;  3HKB A;  3LYB A;  2W8B C;  5MN6 A;  4KWE A;  4EI9 A;  2CWJ A;  2ZAU A;  4U3J B;  5HP8 A;  4BW0 B;  1FFX B;  1X52 A;  4NWO B;  4X20 B;  4BT5 A;  3JAT A;  1W2B F;  2L26 A;  2I6D A;  3WJR A;  2OHW A;  3KJJ A;  3M4S A;  3DC2 A;  1N8R H;  2F9Z C;  1YJW F;  3HKD B;  4DXD A;  5MN4 A;  2VXY A;  3KJK A;  1FSZ A;  4G4X A;  3HKC A;  4TV9 B;  1K73 H;  3RYC B;  3FPI A;  5JVD A;  4C4W C;  1YHQ F;  2OTM A;  1QD9 A;  1M90 H;  3JAS B;  4F6R A;  3UT5 A;  3AGK A;  1W57 A;  3WGM A;  4O4H B;  4X1K A;  2HRY A;  2Q1X A;  1S72 F;  3CC7 F;  5HP7 A;  3HAX D;  3F6M A;  5IYZ A;  5ITZ B;  2P6Y A;  4NQ3 A;  3ON1 A;  1VQN F;  2UYJ A;  1JY8 A;  5LXT B;  5KMG A;  5FJ4 C;  1IV3 A;  3WGK A;  3TD4 A;  2IG8 A;  2KGW A;  4EB6 B;  3HKE A;  3OON A;  4I4T A;  2YXZ A;  3F0D A;  5LYJ A;  1Z5V A;  4E6E A;  2UYN A;  4M8I A;  3IKF A;  3M84 A;  3RYI A;  1FNJ A;  3M1X A;  3ZO8 A;  2PMP A;  3I55 F;  2K1S A;  3N2K A;  3HWU A;  4HNA A;  3IMP A;  3VOA A;  3WPX A;  2HX0 A;  5IYZ B;  5EZY B;  4TUY B;  1U40 A;  2UZH A;  3WGN A;  3ZP7 A;  4FFB A;  3CCL F;  5CA1 A;  3VIU A;  5AVM A;  3IR9 A;  3GTZ A;  1W5B A;  1VQ8 F;  5G4U C;  5LP6 A;  3EOR A;  3P0Z A;  1JFF B;  3CPW F;  3JAR A;  3CCU F;  1VQO F;  2FC3 A;  5EIB D;  2RHH A;  4O4L B;  5LYJ B;  3NK7 A;  3IEQ A;  3GHZ A;  4ZHQ A;  4B46 A;  1VQ6 F;  4YJ2 A;  5LA6 A;  5JQG B;  1YJ9 F;  3CME F;  4C8G A;  1RQ7 A;  3F0G A;  3LME A;  4XCQ A;  5EB0 A;  3U0O A;  5HY1 A;  2UYP A;  3FFM A;  3PLA C;  3HJW C;  5JCO A;  3N4Z A;  5LP6 B;  2VAP A;  3O85 A;  3K2X A;  5GON A;  3JAR B;  1Q82 H;  4G4W A;  5KX5 A;  1IV2 A;  1TUB A;  5C8Y A;  4EI7 A;  1QVF F;  4G88 A;  5CB4 A;  1K9M H;  4BT7 A;  2Z01 A;  1U3P A;  2BTO A;  4DRX A;  5J2T A;  3RA5 A;  4I50 A;  3BYQ A;  2CVL A;  3RE3 A;  2FGY A;  3WJQ A;  3I56 F;  3CCV F;  3E22 A;  3KE1 A;  4B5C A;  5FLX M;  2HS0 A;  3WXM B;  3F0F A;  4C8E A;  3VYS C;  3CB2 A;  1YQN A;  1U43 A;  1XBI A;  3NMU C;  1VH8 A;  1ODE A;  3R0P A;  2IQQ A;  1W41 A;  1XV2 A;  5EYP B;  3JAL B;  1GZ0 A;  4BT6 A;  3CCE F;  1VQ4 F;  1NQ3 A;  1YGY A;  3LFO A;  3K0T A;  4IIJ A;  1KQS F;  1H47 A;  3CD6 F;  2ZOV A;  1NJI H;  5CA0 B;  1W5F A;  3C9S A;  4YJ3 A;  3VYT C;  4ZHW A;  5JH7 B;  1T0K B;  4I55 A;  3JAK A;  4LNU A;  1IV1 A;  4X1Y B;  4O4I A;  4X3M A;  2CZW A;  3HKB B;  4B62 A;  4O2B A;  2NMU A;  5J2T B;  3E1Y A;  3QHD A;  1U3L A;  4RHA A;  4G4Y A;  2Z1F A;  3K12 A;  3JAT B;  2HP3 A;  5BMV A;  5IJ9 A;  3MCQ A;  2OTJ F;  3VI6 A;  3J80 M;  2I6R A;  2LBT A;  3CYQ A;  4BVR A;  3CCS F;  1J7H A;  3VMF B;  5IJ0 A;  4ERH A;  3CCQ F;  4IHJ A;  4O4J A;  3RA6 A;  1R1M A;  3KIZ A;  3J7A R;  3HKC B;  3RYF A;  4O2A A;  5HY0 A;  3C8L A;  5JVD B;  1RLG A;  4I55 B;  3S02 A;  4F6R B;  3UT5 B;  1KD1 H;  1JD1 A;  1W40 A;  1UFY A;  3ZOP A;  5HWE A;  1TVK A;  3QTY A;  2YYE A;  4TV8 A;  4X1K B;  5GIN C;  2GZL A;  3WGL A;  5EIB C;  3S06 A;  1VQP F;  1QU9 A;  3FD5 A;  1DT9 A;  5LOV A;  2BO1 A;  3LDT A;  1FNK A;  2HQS C;  3F0E A;  3MCA B;  4ZOL A;  3CCJ F;  2PHN A;  2UYK A;  3JAW A;  1CK2 A;  5KMG B;  1QAH A;  3LWP C;  2AIF A;  2AIZ P;  3OBY A;  1W59 A;  4O4J B;  1PF5 A;  1X7O A;  5FNV A;  5HXU A;  2ALE A;  4G4V A;  3RYF B;  4X1I A;  3WGJ A;  2RHJ A;  1SZQ A;  5HY2 A;  3HKE B;  4I4T B;  3NVK E;  2CSL A;  2CHT A;  1ZWZ A;  1SA0 A;  2UYN B;  1YJN F;  3RYI B;  2OTL F;  4BVT A;  5J2U A;  1KNJ A;  3MQW A;  1IPA A;  3S0W A;  3N2K B;  4WBN A;  3LWV C;  1KC8 H;  4HNA B;  2GLZ A;  3TD5 A;  2KTV A;  5LOV B;  2H8E A;  2HS4 A;  4TZZ A;  3OBW A;  4BT3 A;  3S03 A;  4ZI7 A;  3V7Q A;  2HP0 A;  5EO3 A;  2VAM A;  1ONI A;  1COM A;  1XRG A;  1Z5W A;  1RQ2 A;  2KTU A;  4FFB B;  3SIU A;  5CA1 B;  3T80 A;  3SIV A;  2QI2 A;  3N2G A;  3GYQ A;  2BTQ B;  2R75 1;  5G4V C;  4BT2 A;  4EI8 A;  4BVQ A;  3IEW A;  3CPQ A;  1JJ2 F;  2QTP A;  5B8F A;  3CCM F;  2ZF8 A;  4U3J A;  1W5E A;  3OW2 F;  1FFX A;  3B6N A;  4B45 A;  4X20 A;  3Q8H A;  4ZHQ B;  5J2U B;  4YJ2 B;  1W5A A;  2H6L A;  5LA6 B;  3RYH A;  5HXZ A;  3V4D A;  2HVY D;  3J81 M;  3HKD A;  3VOB A;  1SDS A;  2Q1Y A;  4C81 A;  1XHO A;  4U39 A;  3C9U A;  3CG6 A;  1Q86 H;  1IV4 A;  2G9I A;  4TV9 A;  3ERN A;  3JAS A;  2VGN A; 
#chains in the Genus database with same CATH homology
 5EAZ A;  4G4X A;  5EB1 B;  4G88 A;  3KHN A;  2HQS C;  2ZOV A;  3S0W A;  4ERH A;  3TD5 A;  2LCA A;  1R1M A;  3S0Y A;  4ZHW A;  2W8B C;  3TD4 A;  2KGW A;  2MQE A;  5EB0 A;  3S03 A;  2AIZ P;  4G4Z A;  1OAP A;  3OON A;  2N48 A;  3TD3 A;  4PWT A;  2L26 A;  3CYP B;  4B62 A;  3S02 A;  4B5C A;  4ZHY B;  4G4V A;  4RHA A;  3WPW A;  2ZVY A;  4R40 B;  4G4Y A;  2K1S A;  3IMP A;  4G4W A;  3S06 A;  3S0H A;  2ZVZ A;  3WPX A;  4ZHV A;  2LBT A;  3CYQ A;  2ZF8 A;  3LDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...