3TD4A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with diaminopimelate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
b'SHMELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
molecule tags Membrane protein,peptide binding protein
source organism Acinetobacter baumannii
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td4A00
4G4VA 3LDTA 4G88A 2K1SA 4G4YA 4PWTA 2ZVYA 3S0HA 4ZHYB 2LCAA 4R40B 3OONA 3WPXA 3S02A 5EAZA 1OAPA 2L26A 3CYPB 3KHNA 1R1MA 2AIZP 5EB0A 3S0WA 3TD4A 5EB1B 4ERHA 3TD5A 4B62A 3S03A 2KGWA 4G4ZA 3TD3A 4RHAA 2MQEA 3IMPA 4ZHWA 3S06A 3WPWA 4G4WA 4B5CA 3CYQA 2HQSC 2N48A 2ZOVA 4ZHVA 4G4XA 2W8BC 3S0YA 2LBTA 2ZVZA 2ZF8A
chains in the Genus database with same CATH superfamily
4WBNA 3K0TA 3HKCB 2K1SA 2BTUA 1YJWF 4PWTA 3CD6F 5EYPB 3CC4F 5EYPA 3CCRF 1S72F 1KNKA 1RA4A 1IV2A 3RYHA 1VQMF 3CCQF 5JH7B 5EZYA 3M84A 1M90H 4TV8A 1W581 4U3JB 4ZK7A 5MN4A 1NMUB 4BW0B 3JARB 1VQ8F 3VCZA 2LBXA 2N48A 3F0EA 1W57A 4NQ3A 1VQNF 4ZOLA 1CLIA 2Z1UA 3RA6A 3CC2F 3IEQA 1W3EX 5J2UB 1KNJA 2CZWA 2HP3A 1DBFA 3JAWA 2QEXF 5EAZA 1XBIA 3C9RA 3CYPB 2RB9A 3V7EA 2QA4F 1FSZA 4EB6A 3ON1A 1U3PA 2AIFA 1YI2F 5LXTB 3VYUC 1YIJF 3S06A 2G9IA 3CCSF 5ITZA 3CPWF 1W5BA 3CG6A 3K12A 4G4XA 5MN5A 5CA1B 4TUYB 1YGYA 2ALEA 2ZVYA 3S0HA 3M4SA 1OFUA 3HJWC 5J2UA 3WJPA 3P10A 4C4WC 4BT4A 1QVFF 2HP0B 3HKBA 2IQQA 2R751 2CHTA 2UYKA 2H6LA 2UYNA 4NWOB 2HP0A 1IPAA 3HKBB 1K8AH 1VQPF 4DXDA 2VGNA 3QHDA 3CYQA 1VQKF 2QTPA 3JALA 5HY1A 5JH7A 3WXMB 1JY8A 1VHAA 4BT7A 3HKEA 3F0FA 1H48A 3LFOA 5LA6A 2Q1YA 1NQ3A 3CCUF 4TUYA 5JVDA 1K9MH 2WALA 4YJ2B 3K14A 2BTOA 3GHZA 3MCAB 1X52A 3QUWA 2DYYA 4ZHQA 4G4ZA 1GO1A 2AMTA 3O85A 3TD3A 1SA0B 2YYEA 4HNAA 3IMPA 3VYSC 1QU9A 3KE1A 4X20A 1Q81H 1JN1A 5FJ4C 3JAWB 2VXYA 4XCQA 4X1IB 3FD5A 2LCAA 1W55A 3WGNA 4ZOLB 3D54A 3HWUA 3B6NA 3DC2A 4BT2A 3JAMM 3TD5A 2KGWA 1FNKA 3UT5B 1H47A 1FFXA 5EIBC 4ZHWA 2Z01A 3JAKB 2R6R1 3D00A 4O4IB 4X1YA 2CHSA 2OTMA 1YJNF 2KTUA 3SIVA 1VQ4F 4EI8A 2UZHA 5C8YB 3V3TA 3T80A 3FBAA 1X25A 5KX5A 3RYCA 3RYCB 3CC7F 3J7AR 4WBNB 4C81A 5EWRA 4LNUA 5CA0B 5C8YA 4TZZA 4C8GA 2HS4A 3S02A 2OTJF 3CXCF 1CN7A 2RHOA 5G4VC 3HKEB 1W2BF 2ZODA 4YJ3A 3RYIA 4C8IA 3JAKA 2MQEA 5BMVB 5EIBD 4O4HB 2OTLF 4G4WA 4I55A 3CMEF 3VI6A 3OW2F 3CB2A 3WGLA 3LWPC 5LYJB 4IIJA 4BVSA 2LBTA 2P6YA 2HVYD 3LDTA 5CB4B 2EWCA 5J2TB 3GYQA 3FFMA 3WGKA 2L26A 5KX5B 5B8FA 2H8CA 2OZBA 3N4ZA 4ZI7B 3NMUC 2Q1XA 3C9UA 2RHJA 2UYJA 1DT9A 3F0GA 3HTNA 1JD1A 3BYQA 4B5CA 2GLZA 3VTIC 3N2KA 3M1XA 2OHWA 3S0YA 3I56F 3VOBA 3OBWA 2HRYA 1PF5A 1SDSA 5HY2A 2V9YA 2ZAUA 4IIJB 3VO8A 5LYJA 5GAPK 1H7MA 3I7TA 3RA5A 1VQ5F 3LWRC 3S0WA 1VQLF 2KG4A 3IKFA 3JASA 1M1KH 4BVTA 3OBYA 3J80M 3ERNA 2Z1EA 3IKEA 3P4EA 3VIUA 3JARA 3CPQA 2KTVA 1UI9A 1YITF 3P0ZA 4U3JA 2HS0A 1ODEA 3VYTC 2GZLA 5MN6A 5GANK 5A2QM 3ELCA 3KJKA 4LNUB 3CMAF 3WGJA 1TUBB 3LYBA 4F6RA 4YJ2A 2PMPA 3D01A 1Q82H 3JCMM 4FFBB 1RQ2A 5CA1A 1GZ0A 2VAMA 4X3MA 5LA6B 4F6RB 1W5FA 3KHNA 5JQGA 2PHNA 1E7KA 3Q8HA 3KIZA 3TD4A 4X1YB 3G6EF 1KD1H 3RYFA 4B62A 2LBWA 2CVLA 1FFXB 4I4TB 5IJ0A 2GVIA 1YQNA 2UYNB 1GX1A 4EB6B 5HY4A 1ONIA 1QAHA 2YXZA 3MBMA 3V4DA 3FD6A 3EORA 3K2XA 1SZQA 4O2BB 3N2GA 5G4UC 3C8LA 2AIZP 2BTQB 2RHLA 5HY0A 3E22B 3C9SA 3MCQA 4HNAB 3J81M 2FC3A 3JATA 1XRGA 5IT9M 3JATB 4RQOA 1IV3A 3VMFB 5JQGB 4ZHVA 2FGYA 3HAXD 1VQ9F 1XHOA 2ZVZA 4G4VA 1NJIH 3E20B 1KQSF 3GTZA 4G4YA 3HKCA 3ZP7A 1W5EA 3C9TA 4BVQA 1TUBA 4B46A 3WPXA 4NUTA 3N2GB 1OAPA 1YHQF 4O2BA 1RLGA 1YJ9F 2IAFA 5AVMA 3HKDB 3LWQC 3PLAC 4I55B 5LP6C 5JCOC 2BO1A 5HWEA 1Q7YH 3I55F 4O2AB 1RQ7A 3JASB 1W42A 1XV2A 1FNJA 1J7HA 1UFYA 1IV4A 3V7QA 4G88A 5GINC 3NVKE 1X7OA 5IJ9A 3AGKA 3RE3A 1Q86H 4B45A 1JFFA 1T0AA 4X1KB 1COMA 1K73H 3N2KB 2CSLA 3ESJA 3CCLF 4ERHA 5ITZB 2JNBA 3DDNA 2CW4A 5LXTA 3ZOPA 5KMGA 1VQ6F 1W59A 5IYZA 3E22A 3MDOA 3UT5A 2HX0A 5HP8A 5GONB 4X3LA 3NK6A 4KWEA 4IHJB 3LWOC 2CWJA 5FNVA 2H8EA 3KJJA 3R0PA 5CB4A 4C8EA 3U0OA 3OONA 1TVKB 2IG8A 5HP7A 3LWVC 1VQ7F 5EB1B 2VGMA 3QTYA 3IEWA 4O4LB 1W41A 1W40A 1Z5VA 3LMEA 4TV8B 5JCOA 5LP6A 1PXWA 3I3FA 5EZYB 4YJ3B 3RYHB 5KMGB 1VK3A 4ZI7A 1VH8A 4LCKA 5DCVA 1U3LA 4FFBA 2ZF8A 4O4JA 5LOVA 4O4JB 4BT6A 3F0DA 5JVDB 4ZHYB 2HRUA 5IJ9B 4M8IA 1T0KB 4E6EA 3MQWA 5EB0A 3CCMF 4DRXA 4O4IA 2QI2A 3IR9A 4BY9D 3WJRA 1VQOF 3F6MA 2B33A 3WPWA 5HXUA 2RHHA 1IV1A 3HKDA 4C82A 2VAWA 2I6RA 4BT3A 2W8BC 4BVRA 4TV9A 1KC8H 3G71F 1W5AA 1VQVA 1Z5WA 4R40B 2Z1FA 3L7QA 5LOVB 1JJ2F 1U43A 1RLUA 2I6DA 5IYZB 3S03A 3NVIB 4X20B 4I50B 4RHAA 1SA0A 1X7PA 4I50A 2UYPA 3WGMA 5LP6B 3CCJF 2HQSC 5EO3A 4O4LA 3CCEF 4X1KA 1CK2A 1JFFB 3G4SF 5J2TA 1ZWZA 2NMUA 1GO0A 3JVHA 1TVKA 1N8RH 3VOAA 1QVGF 3ZO8A 5GIOC 3E1YA 2HS3A 1Q8RA 4TV9B 2F9ZC 5FLXM 4X1IA 5FNVB 2VAPA 3JALB 1R1MA 4IHJA 4U39A 3WJQA 5GIPC 4O4HA 3PAFA 1U40A 5GONA 4O2AA 1QD9A 2DT4A 5HXZA 3FPIA 5BMVA 3NK7A 3ZP4A 3RYIB 3CCVF 2Z1TA 3SIUA 4BT5A 4DRXB 4I4TA 4EI9A 5IJ0B 2ZOVA 4EI7A 4ZHQB 3RYFB 5CA0A 3N4YA
chains in the Genus database with same CATH topology
4G4VA 3LDTA 4G88A 2K1SA 4G4YA 4PWTA 2ZVYA 3S0HA 4ZHYB 2LCAA 4R40B 3OONA 3WPXA 3S02A 5EAZA 1OAPA 2L26A 3CYPB 3KHNA 1R1MA 2AIZP 5EB0A 3S0WA 3TD4A 5EB1B 4ERHA 3TD5A 4B62A 3S03A 2KGWA 4G4ZA 3TD3A 4RHAA 2MQEA 3IMPA 4ZHWA 3S06A 3WPWA 4G4WA 4B5CA 3CYQA 2HQSC 2N48A 2ZOVA 4ZHVA 4G4XA 2W8BC 3S0YA 2LBTA 2ZVZA 2ZF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4V A;  3LDT A;  4G88 A;  2K1S A;  4G4Y A;  4PWT A;  2ZVY A;  3S0H A;  4ZHY B;  2LCA A;  4R40 B;  3OON A;  3WPX A;  3S02 A;  5EAZ A;  1OAP A;  2L26 A;  3CYP B;  3KHN A;  1R1M A;  2AIZ P;  5EB0 A;  3S0W A;  3TD4 A;  5EB1 B;  4ERH A;  3TD5 A;  4B62 A;  3S03 A;  2KGW A;  4G4Z A;  3TD3 A;  4RHA A;  2MQE A;  3IMP A;  4ZHW A;  3S06 A;  3WPW A;  4G4W A;  4B5C A;  3CYQ A;  2HQS C;  2N48 A;  2ZOV A;  4ZHV A;  4G4X A;  2W8B C;  3S0Y A;  2LBT A;  2ZVZ A;  2ZF8 A; 
#chains in the Genus database with same CATH topology
 4WBN A;  3K0T A;  3HKC B;  2K1S A;  2BTU A;  1YJW F;  4PWT A;  3CD6 F;  5EYP B;  3CC4 F;  5EYP A;  3CCR F;  1S72 F;  1KNK A;  1RA4 A;  1IV2 A;  3RYH A;  1VQM F;  3CCQ F;  5JH7 B;  5EZY A;  3M84 A;  1M90 H;  4TV8 A;  1W58 1;  4U3J B;  4ZK7 A;  5MN4 A;  1NMU B;  4BW0 B;  3JAR B;  1VQ8 F;  3VCZ A;  2LBX A;  2N48 A;  3F0E A;  1W57 A;  4NQ3 A;  1VQN F;  4ZOL A;  1CLI A;  2Z1U A;  3RA6 A;  3CC2 F;  3IEQ A;  1W3E X;  5J2U B;  1KNJ A;  2CZW A;  2HP3 A;  1DBF A;  3JAW A;  2QEX F;  5EAZ A;  1XBI A;  3C9R A;  3CYP B;  2RB9 A;  3V7E A;  2QA4 F;  1FSZ A;  4EB6 A;  3ON1 A;  1U3P A;  2AIF A;  1YI2 F;  5LXT B;  3VYU C;  1YIJ F;  3S06 A;  2G9I A;  3CCS F;  5ITZ A;  3CPW F;  1W5B A;  3CG6 A;  3K12 A;  4G4X A;  5MN5 A;  5CA1 B;  4TUY B;  1YGY A;  2ALE A;  2ZVY A;  3S0H A;  3M4S A;  1OFU A;  3HJW C;  5J2U A;  3WJP A;  3P10 A;  4C4W C;  4BT4 A;  1QVF F;  2HP0 B;  3HKB A;  2IQQ A;  2R75 1;  2CHT A;  2UYK A;  2H6L A;  2UYN A;  4NWO B;  2HP0 A;  1IPA A;  3HKB B;  1K8A H;  1VQP F;  4DXD A;  2VGN A;  3QHD A;  3CYQ A;  1VQK F;  2QTP A;  3JAL A;  5HY1 A;  5JH7 A;  3WXM B;  1JY8 A;  1VHA A;  4BT7 A;  3HKE A;  3F0F A;  1H48 A;  3LFO A;  5LA6 A;  2Q1Y A;  1NQ3 A;  3CCU F;  4TUY A;  5JVD A;  1K9M H;  2WAL A;  4YJ2 B;  3K14 A;  2BTO A;  3GHZ A;  3MCA B;  1X52 A;  3QUW A;  2DYY A;  4ZHQ A;  4G4Z A;  1GO1 A;  2AMT A;  3O85 A;  3TD3 A;  1SA0 B;  2YYE A;  4HNA A;  3IMP A;  3VYS C;  1QU9 A;  3KE1 A;  4X20 A;  1Q81 H;  1JN1 A;  5FJ4 C;  3JAW B;  2VXY A;  4XCQ A;  4X1I B;  3FD5 A;  2LCA A;  1W55 A;  3WGN A;  4ZOL B;  3D54 A;  3HWU A;  3B6N A;  3DC2 A;  4BT2 A;  3JAM M;  3TD5 A;  2KGW A;  1FNK A;  3UT5 B;  1H47 A;  1FFX A;  5EIB C;  4ZHW A;  2Z01 A;  3JAK B;  2R6R 1;  3D00 A;  4O4I B;  4X1Y A;  2CHS A;  2OTM A;  1YJN F;  2KTU A;  3SIV A;  1VQ4 F;  4EI8 A;  2UZH A;  5C8Y B;  3V3T A;  3T80 A;  3FBA A;  1X25 A;  5KX5 A;  3RYC A;  3RYC B;  3CC7 F;  3J7A R;  4WBN B;  4C81 A;  5EWR A;  4LNU A;  5CA0 B;  5C8Y A;  4TZZ A;  4C8G A;  2HS4 A;  3S02 A;  2OTJ F;  3CXC F;  1CN7 A;  2RHO A;  5G4V C;  3HKE B;  1W2B F;  2ZOD A;  4YJ3 A;  3RYI A;  4C8I A;  3JAK A;  2MQE A;  5BMV B;  5EIB D;  4O4H B;  2OTL F;  4G4W A;  4I55 A;  3CME F;  3VI6 A;  3OW2 F;  3CB2 A;  3WGL A;  3LWP C;  5LYJ B;  4IIJ A;  4BVS A;  2LBT A;  2P6Y A;  2HVY D;  3LDT A;  5CB4 B;  2EWC A;  5J2T B;  3GYQ A;  3FFM A;  3WGK A;  2L26 A;  5KX5 B;  5B8F A;  2H8C A;  2OZB A;  3N4Z A;  4ZI7 B;  3NMU C;  2Q1X A;  3C9U A;  2RHJ A;  2UYJ A;  1DT9 A;  3F0G A;  3HTN A;  1JD1 A;  3BYQ A;  4B5C A;  2GLZ A;  3VTI C;  3N2K A;  3M1X A;  2OHW A;  3S0Y A;  3I56 F;  3VOB A;  3OBW A;  2HRY A;  1PF5 A;  1SDS A;  5HY2 A;  2V9Y A;  2ZAU A;  4IIJ B;  3VO8 A;  5LYJ A;  5GAP K;  1H7M A;  3I7T A;  3RA5 A;  1VQ5 F;  3LWR C;  3S0W A;  1VQL F;  2KG4 A;  3IKF A;  3JAS A;  1M1K H;  4BVT A;  3OBY A;  3J80 M;  3ERN A;  2Z1E A;  3IKE A;  3P4E A;  3VIU A;  3JAR A;  3CPQ A;  2KTV A;  1UI9 A;  1YIT F;  3P0Z A;  4U3J A;  2HS0 A;  1ODE A;  3VYT C;  2GZL A;  5MN6 A;  5GAN K;  5A2Q M;  3ELC A;  3KJK A;  4LNU B;  3CMA F;  3WGJ A;  1TUB B;  3LYB A;  4F6R A;  4YJ2 A;  2PMP A;  3D01 A;  1Q82 H;  3JCM M;  4FFB B;  1RQ2 A;  5CA1 A;  1GZ0 A;  2VAM A;  4X3M A;  5LA6 B;  4F6R B;  1W5F A;  3KHN A;  5JQG A;  2PHN A;  1E7K A;  3Q8H A;  3KIZ A;  3TD4 A;  4X1Y B;  3G6E F;  1KD1 H;  3RYF A;  4B62 A;  2LBW A;  2CVL A;  1FFX B;  4I4T B;  5IJ0 A;  2GVI A;  1YQN A;  2UYN B;  1GX1 A;  4EB6 B;  5HY4 A;  1ONI A;  1QAH A;  2YXZ A;  3MBM A;  3V4D A;  3FD6 A;  3EOR A;  3K2X A;  1SZQ A;  4O2B B;  3N2G A;  5G4U C;  3C8L A;  2AIZ P;  2BTQ B;  2RHL A;  5HY0 A;  3E22 B;  3C9S A;  3MCQ A;  4HNA B;  3J81 M;  2FC3 A;  3JAT A;  1XRG A;  5IT9 M;  3JAT B;  4RQO A;  1IV3 A;  3VMF B;  5JQG B;  4ZHV A;  2FGY A;  3HAX D;  1VQ9 F;  1XHO A;  2ZVZ A;  4G4V A;  1NJI H;  3E20 B;  1KQS F;  3GTZ A;  4G4Y A;  3HKC A;  3ZP7 A;  1W5E A;  3C9T A;  4BVQ A;  1TUB A;  4B46 A;  3WPX A;  4NUT A;  3N2G B;  1OAP A;  1YHQ F;  4O2B A;  1RLG A;  1YJ9 F;  2IAF A;  5AVM A;  3HKD B;  3LWQ C;  3PLA C;  4I55 B;  5LP6 C;  5JCO C;  2BO1 A;  5HWE A;  1Q7Y H;  3I55 F;  4O2A B;  1RQ7 A;  3JAS B;  1W42 A;  1XV2 A;  1FNJ A;  1J7H A;  1UFY A;  1IV4 A;  3V7Q A;  4G88 A;  5GIN C;  3NVK E;  1X7O A;  5IJ9 A;  3AGK A;  3RE3 A;  1Q86 H;  4B45 A;  1JFF A;  1T0A A;  4X1K B;  1COM A;  1K73 H;  3N2K B;  2CSL A;  3ESJ A;  3CCL F;  4ERH A;  5ITZ B;  2JNB A;  3DDN A;  2CW4 A;  5LXT A;  3ZOP A;  5KMG A;  1VQ6 F;  1W59 A;  5IYZ A;  3E22 A;  3MDO A;  3UT5 A;  2HX0 A;  5HP8 A;  5GON B;  4X3L A;  3NK6 A;  4KWE A;  4IHJ B;  3LWO C;  2CWJ A;  5FNV A;  2H8E A;  3KJJ A;  3R0P A;  5CB4 A;  4C8E A;  3U0O A;  3OON A;  1TVK B;  2IG8 A;  5HP7 A;  3LWV C;  1VQ7 F;  5EB1 B;  2VGM A;  3QTY A;  3IEW A;  4O4L B;  1W41 A;  1W40 A;  1Z5V A;  3LME A;  4TV8 B;  5JCO A;  5LP6 A;  1PXW A;  3I3F A;  5EZY B;  4YJ3 B;  3RYH B;  5KMG B;  1VK3 A;  4ZI7 A;  1VH8 A;  4LCK A;  5DCV A;  1U3L A;  4FFB A;  2ZF8 A;  4O4J A;  5LOV A;  4O4J B;  4BT6 A;  3F0D A;  5JVD B;  4ZHY B;  2HRU A;  5IJ9 B;  4M8I A;  1T0K B;  4E6E A;  3MQW A;  5EB0 A;  3CCM F;  4DRX A;  4O4I A;  2QI2 A;  3IR9 A;  4BY9 D;  3WJR A;  1VQO F;  3F6M A;  2B33 A;  3WPW A;  5HXU A;  2RHH A;  1IV1 A;  3HKD A;  4C82 A;  2VAW A;  2I6R A;  4BT3 A;  2W8B C;  4BVR A;  4TV9 A;  1KC8 H;  3G71 F;  1W5A A;  1VQV A;  1Z5W A;  4R40 B;  2Z1F A;  3L7Q A;  5LOV B;  1JJ2 F;  1U43 A;  1RLU A;  2I6D A;  5IYZ B;  3S03 A;  3NVI B;  4X20 B;  4I50 B;  4RHA A;  1SA0 A;  1X7P A;  4I50 A;  2UYP A;  3WGM A;  5LP6 B;  3CCJ F;  2HQS C;  5EO3 A;  4O4L A;  3CCE F;  4X1K A;  1CK2 A;  1JFF B;  3G4S F;  5J2T A;  1ZWZ A;  2NMU A;  1GO0 A;  3JVH A;  1TVK A;  1N8R H;  3VOA A;  1QVG F;  3ZO8 A;  5GIO C;  3E1Y A;  2HS3 A;  1Q8R A;  4TV9 B;  2F9Z C;  5FLX M;  4X1I A;  5FNV B;  2VAP A;  3JAL B;  1R1M A;  4IHJ A;  4U39 A;  3WJQ A;  5GIP C;  4O4H A;  3PAF A;  1U40 A;  5GON A;  4O2A A;  1QD9 A;  2DT4 A;  5HXZ A;  3FPI A;  5BMV A;  3NK7 A;  3ZP4 A;  3RYI B;  3CCV F;  2Z1T A;  3SIU A;  4BT5 A;  4DRX B;  4I4T A;  4EI9 A;  5IJ0 B;  2ZOV A;  4EI7 A;  4ZHQ B;  3RYF B;  5CA0 A;  3N4Y A; 
#chains in the Genus database with same CATH homology
 4G4V A;  3LDT A;  4G88 A;  2K1S A;  4G4Y A;  4PWT A;  2ZVY A;  3S0H A;  4ZHY B;  2LCA A;  4R40 B;  3OON A;  3WPX A;  3S02 A;  5EAZ A;  1OAP A;  2L26 A;  3CYP B;  3KHN A;  1R1M A;  2AIZ P;  5EB0 A;  3S0W A;  3TD4 A;  5EB1 B;  4ERH A;  3TD5 A;  4B62 A;  3S03 A;  2KGW A;  4G4Z A;  3TD3 A;  4RHA A;  2MQE A;  3IMP A;  4ZHW A;  3S06 A;  3WPW A;  4G4W A;  4B5C A;  3CYQ A;  2HQS C;  2N48 A;  2ZOV A;  4ZHV A;  4G4X A;  2W8B C;  3S0Y A;  2LBT A;  2ZVZ A;  2ZF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...