5GANK

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ganK00
1VQ9F 3OBYA 4X3MA 1PXWA 2FC3A 3G4SF 1YJNF 3CMAF 3CCEF 1W3EX 3LWPC 5GAPK 5G4VC 3NVKE 3V7EA 1M90H 3CC2F 4TZZA 3CCQF 3N4ZA 5IT9M 1VQ7F 1VQMF 3MCAB 4LCKA 1ZWZA 1T0KB 1VQLF 1YJ9F 1CK2A 1YITF 3CCVF 1W41A 2OHWA 1K8AH 3JAMM 1K73H 3V7QA 3CXCF 3NK7A 1VQ8F 1GO0A 5GIPC 3CPWF 1VQKF 3JCMM 1VQ6F 3CMEF 5A2QM 1QVGF 3VI6A 2QI2A 4BW0B 2KTVA 4NUTA 5DCVA 1VQPF 1YJWF 3FFMA 1Q86H 3J7AR 2QA4F 1KQSF 1N8RH 1GZ0A 2LBWA 1KD1H 3CC7F 3LWQC 1M1KH 2VGNA 2QEXF 3NVIB 3RA6A 2KG4A 2OTJF 3J80M 2LBXA 5GINC 2HVYD 1YI2F 2WALA 3SIVA 3NK6A 3ON1A 2I6DA 1W40A 1VQ5F 5G4UC 3RA5A 5EWRA 3J81M 3E20B 3SIUA 1S72F 3CPQA 3CC4F 1VQNF 1YIJF 3PLAC 3CCLF 3NMUC 3E1YA 3CG6A 3OW2F 2BO1A 3LFOA 1NMUB 3CCJF 1CN7A 3PAFA 3CCUF 4X3LA 1X7OA 3AGKA 1SDSA 2KTUA 3G71F 3N4YA 4C4WC 2CZWA 3CCMF 1GO1A 5GANK 1H7MA 3OBWA 2JNBA 5FJ4C 5GIOC 1RA4A 3WXMB 1W42A 1JJ2F 1RLGA 1Q82H 2ALEA 1VQ4F 3CCSF 1E7KA 3HAXD 3IR9A 3HJWC 1Q7YH 3VMFB 1W2BF 2OZBA 2VGMA 3LWVC 1DT9A 1YHQF 1QVFF 1XBIA 1VQOF 3LWRC 3GYQA 1K9MH 1KC8H 1IPAA 4BY9D 3LWOC 1Q81H 3G6EF 3CCRF 3CD6F 1X7PA 1X52A 2AIFA 2OTLF 3O85A 5EO3A 1NJIH 3I56F 3I55F 5FLXM
chains in the Genus database with same CATH superfamily
3GTZA 5LYJB 3OBYA 4X3MA 2HS4A 5C8YA 2FC3A 1YJNF 3CMAF 2Q1YA 5LXTA 5GAPK 5JVDB 2V9YA 2ZF8A 4TZZA 3CCQF 3N4ZA 2OTMA 2NMUA 1OAPA 4YJ2A 4LCKA 4BVQA 4ZHVA 3WGNA 3C9UA 3V3TA 1CK2A 3CCVF 4O4IB 5HY0A 5FNVA 3U0OA 5EAZA 3RYFA 2HRUA 1K8AH 3ELCA 3HTNA 4R40B 4B5CA 3JAWA 3M1XA 4ZHWA 3CXCF 1SZQA 3JATB 1GO0A 2LCAA 3HKCB 3E22B 2QI2A 3HKDB 2KTVA 4DRXA 5MN6A 1JFFA 1VQPF 1YJWF 4O2AB 3FFMA 4O4HB 3J7AR 5LOVB 3ZP7A 2QA4F 3N2KB 1KQSF 4ZOLA 4TUYA 2LBWA 4G4VA 1W5AA 4I4TA 3NVIB 4ZHQA 3RA6A 3R0PA 2LBXA 2CHTA 2IQQA 2DYYA 3P4EA 5JQGB 3S03A 1TVKB 3SIVA 1U43A 1VQ5F 4EI7A 3RA5A 2CWJA 2RHLA 3DC2A 5IJ0A 3KHNA 3VYSC 1S72F 3PLAC 4BT2A 3E1YA 2H8CA 4IIJA 1FNKA 5MN4A 2ZODA 1X7OA 3AGKA 4X3LA 1SDSA 5EIBC 2H8EA 4O4JB 5CB4A 2KGWA 1Q8RA 1R1MA 2CZWA 4I55A 3CYQA 5GANK 5IJ9A 3HWUA 4I50B 1W42A 1TUBB 1JJ2F 1J7HA 3F0FA 3WPWA 1KNKA 3HKBB 3RE3A 3C8LA 5BMVA 4C81A 1W5EA 3JASA 2RB9A 1DT9A 1YHQF 2RHJA 3M84A 4BT6A 1XBIA 2HQSC 4YJ3A 3VYUC 1XV2A 1KC8H 4ZI7B 3LWOC 3BYQA 5LA6A 3G6EF 2OTLF 3O85A 5FNVB 3RYFB 5ITZA 3I56F 3C9SA 3I7TA 3VCZA 3WGMA 5FLXM 1VQ9F 2YYEA 3G4SF 1H48A 1VH8A 3JAKA 5G4VC 3UT5A 2HX0A 5EYPB 3V7EA 3VTIC 1DBFA 2QTPA 1VQMF 2CVLA 2GVIA 3F0EA 1FNJA 2VAPA 4F6RB 4ZOLB 2UYPA 3P10A 5HP7A 4LNUA 1K73H 1VQVA 3B6NA 5J2TB 1QD9A 4ZHQB 3WJQA 4TV8A 3CPWF 1VQKF 1IV2A 3IKEA 5DCVA 4C8IA 5JCOA 3RYHB 3RYIB 2FGYA 4FFBB 4BT4A 4U39A 1FFXA 4NWOB 4HNAB 4RQOA 3HKEA 1GZ0A 5KMGB 1KD1H 3CC7F 3LWQC 2HP0B 2QEXF 5J2UA 2OTJF 3J80M 3JALA 3N2GA 3WGJA 4O4LA 5EZYA 5IYZB 2WALA 3S0WA 5HXUA 1W40A 2R751 3FD6A 3VO8A 5HY2A 3TD3A 3D54A 3J81M 5LP6A 3SIUA 1VQNF 4TV9B 4ERHA 3JARB 1YIJF 3S0YA 3IMPA 1QAHA 5KX5A 4X1IA 3OW2F 4O2BB 4G4ZA 2BTQB 1NMUB 2L26A 1ODEA 1SA0B 3ZO8A 1IV1A 5CA1A 1W5FA 2KTUA 2Z1FA 1U40A 3VOAA 2CSLA 1GO1A 1H7MA 5GONB 2JNBA 3VOBA 4C8EA 4YJ3B 3RYCB 2IG8A 2BTOA 1Z5WA 5LA6B 5LP6C 3MBMA 2VAMA 5B8FA 2ALEA 5ITZB 2R6R1 5JH7A 3CCSF 4X20B 4RHAA 3IR9A 4B62A 4X1YA 4KWEA 2Z1EA 1QVFF 5LYJA 1W57A 3K2XA 2I6RA 2GZLA 1W55A 3V4DA 1JY8A 3K12A 1IPAA 2UYKA 1X7PA 2AIFA 4ZHYB 2PMPA 3I55F 1PF5A 3KE1A 1W3EX 4IHJB 4X1KB 1RLUA 3KJJA 5IT9M 1VQ7F 3MCAB 5C8YB 2CHSA 1ZWZA 1T0KB 3JATA 3QHDA 4M8IA 1YJ9F 2G9IA 4C82A 5LXTB 3HKCA 2OHWA 3FBAA 3MDOA 3TD5A 3TD4A 1FFXB 3FPIA 3HKDA 3JAMM 3P0ZA 3V7QA 4YJ2B 4EB6A 2Q1XA 3IEWA 3MCQA 3K14A 3NK7A 4O2AA 1VQ8F 5GIPC 5LOVA 1YQNA 3JCMM 1VQ6F 1KNJA 1UFYA 3F0DA 1QVGF 4BW0B 4NUTA 2BTUA 3JAWB 1X25A 3ZOPA 2B33A 1Q86H 5HXZA 2ZOVA 1N8RH 4DRXB 4U3JA 1JFFB 5LP6B 1TVKA 5CA0A 1COMA 1Z5VA 3VIUA 4TUYB 3GHZA 2RHHA 2Z1TA 3KIZA 4I4TB 1QU9A 5CA1B 2I6DA 3NK6A 4PWTA 2W8BC 5G4UC 4B45A 2UYNA 3DDNA 2DT4A 3LYBA 3E20B 4BVSA 3CC4F 3CPQA 2Z01A 5EIBD 3NMUC 2YXZA 3VYTC 3CG6A 3LFOA 3MQWA 3F0GA 3OONA 5IJ0B 1CN7A 3PAFA 3CCUF 4EI9A 4I50A 4E6EA 3I3FA 1TUBA 4WBNA 3Q8HA 3CCMF 4IIJB 2IAFA 3OBWA 3HKBA 3F6MA 1RA4A 3WJRA 3WXMB 4B46A 1RQ7A 4NQ3A 5JCOC 5CB4B 3EORA 3WGLA 4I55B 5IJ9B 4BT7A 3KJKA 5HY4A 1VQ4F 1NQ3A 4G4YA 4ZI7A 1Q7YH 3VMFB 2OZBA 2VGMA 3LWVC 1XHOA 1UI9A 2K1SA 2ZVZA 3ZP4A 3LWRC 2VXYA 5BMVB 2CW4A 1JD1A 2HP3A 3JASB 2LBTA 4BY9D 3CCRF 1W581 3CD6F 5EYPA 5EO3A 4BT5A 4BVTA 1H47A 1OFUA 1PXWA 3S06A 4EB6B 3CCEF 3LWPC 4G4WA 3NVKE 2N48A 5EB1B 1ONIA 4F6RA 1M90H 3CC2F 3S0HA 2EWCA 1U3LA 5J2TA 3C9TA 3D01A 1IV3A 5HY1A 1VQLF 2HS0A 1T0AA 1YITF 1W41A 3JAKB 3JVHA 3UT5B 3K0TA 3IEQA 4U3JB 1IV4A 3RYHA 3C9RA 1YGYA 5CA0B 3RYIA 1U3PA 4FFBA 5JVDA 2GLZA 3CMEF 4HNAA 5A2QM 3LDTA 5EB0A 2AMTA 3VI6A 5KMGA 4LNUB 2HP0A 3ESJA 5HP8A 3WPXA 3CYPB 3IKFA 4O4IA 4TV8B 2RHOA 2AIZP 1FSZA 2MQEA 1W59A 2UYNB 4EI8A 5IYZA 1M1KH 2PHNA 2VGNA 3L7QA 2UYJA 2KG4A 3CB2A 3E22A 5GINC 3HKEB 4BVRA 2HVYD 1YI2F 2ZAUA 4O4HA 1VHAA 4TV9A 3JARA 3FD5A 3ON1A 3QUWA 3ERNA 2Z1UA 5J2UB 4WBNB 3N2KA 4O2BA 3JALB 4G88A 5EWRA 3N2GB 4O4LB 1SA0A 5EZYB 3QTYA 2HS3A 1JN1A 3CCLF 1RQ2A 4BT3A 4ZK7A 5HWEA 2BO1A 2H6LA 5JQGA 4DXDA 3CCJF 2HRYA 5GONA 1W5BA 1XRGA 3RYCA 4G4XA 5KX5B 3G71F 4X1IB 3N4YA 5AVMA 4C4WC 5FJ4C 5GIOC 2UZHA 4X20A 2ZVYA 3D00A 1RLGA 1CLIA 3LMEA 1Q82H 2VAWA 4XCQA 3T80A 3S02A 1E7KA 3HAXD 3HJWC 4O4JA 1W2BF 3M4SA 3WGKA 3WJPA 2F9ZC 5MN5A 1VQOF 3GYQA 1K9MH 5JH7B 1Q81H 4X1YB 1X52A 1GX1A 1VK3A 2P6YA 4IHJA 4X1KA 4C8GA 1NJIH
chains in the Genus database with same CATH topology
1VQ9F 3OBYA 4X3MA 4BVTA 1PXWA 2FC3A 3G4SF 1YJNF 3CMAF 3CCEF 1W3EX 3LWPC 5GAPK 5G4VC 3NVKE 3V7EA 1M90H 3CC2F 4TZZA 3CCQF 3N4ZA 5IT9M 1VQ7F 1VQMF 3MCAB 4LCKA 4BVQA 1ZWZA 1T0KB 3V3TA 5HY1A 1YJ9F 1VQLF 1CK2A 1YITF 3CCVF 5HY0A 1W41A 2OHWA 1K8AH 3JAMM 1K73H 3V7QA 3CXCF 3NK7A 1VQ8F 1GO0A 5GIPC 3CPWF 1VQKF 3JCMM 2GLZA 1VQ6F 3CMEF 5A2QM 1QVGF 3VI6A 2QI2A 4BW0B 2KTVA 4NUTA 5DCVA 1VQPF 1YJWF 3FFMA 1Q86H 3J7AR 2FGYA 2QA4F 5HXZA 1KQSF 1N8RH 1GZ0A 2LBWA 1KD1H 4EI8A 3CC7F 3LWQC 1M1KH 2VGNA 2QEXF 3NVIB 3RA6A 2KG4A 2OTJF 3J80M 2LBXA 5GINC 4BVRA 2HVYD 1YI2F 2WALA 3SIVA 3NK6A 3ON1A 2I6DA 5HXUA 1W40A 1VQ5F 4EI7A 3RA5A 5G4UC 5EWRA 5HY2A 3J81M 3E20B 4BVSA 3SIUA 1S72F 3CPQA 3CC4F 1VQNF 1YIJF 3PLAC 3CCLF 3NMUC 3E1YA 3CG6A 5HWEA 3OW2F 2BO1A 3LFOA 1NMUB 3CCJF 1CN7A 3PAFA 3CCUF 4X3LA 1X7OA 3AGKA 4EI9A 1SDSA 2KTUA 3G71F 3N4YA 4C4WC 2CZWA 3CCMF 1GO1A 5GANK 1H7MA 3OBWA 2JNBA 5FJ4C 5GIOC 1RA4A 3WXMB 1W42A 4NQ3A 3D00A 1JJ2F 1RLGA 1Q82H 2ALEA 4XCQA 5HY4A 1VQ4F 3CCSF 1E7KA 3HAXD 3IR9A 3HJWC 1Q7YH 3VMFB 1W2BF 2OZBA 2VGMA 3LWVC 2F9ZC 1DT9A 1YHQF 1QVFF 1XBIA 1VQOF 3LWRC 3GYQA 1K9MH 1KC8H 1IPAA 4BY9D 3LWOC 1Q81H 3G6EF 3CCRF 3CD6F 1X7PA 1X52A 2AIFA 2OTLF 3O85A 5EO3A 1NJIH 3I56F 3I55F 5FLXM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 F;  3OBY A;  4X3M A;  1PXW A;  2FC3 A;  3G4S F;  1YJN F;  3CMA F;  3CCE F;  1W3E X;  3LWP C;  5GAP K;  5G4V C;  3NVK E;  3V7E A;  1M90 H;  3CC2 F;  4TZZ A;  3CCQ F;  3N4Z A;  5IT9 M;  1VQ7 F;  1VQM F;  3MCA B;  4LCK A;  1ZWZ A;  1T0K B;  1VQL F;  1YJ9 F;  1CK2 A;  1YIT F;  3CCV F;  1W41 A;  2OHW A;  1K8A H;  3JAM M;  1K73 H;  3V7Q A;  3CXC F;  3NK7 A;  1VQ8 F;  1GO0 A;  5GIP C;  3CPW F;  1VQK F;  3JCM M;  1VQ6 F;  3CME F;  5A2Q M;  1QVG F;  3VI6 A;  2QI2 A;  4BW0 B;  2KTV A;  4NUT A;  5DCV A;  1VQP F;  1YJW F;  3FFM A;  1Q86 H;  3J7A R;  2QA4 F;  1KQS F;  1N8R H;  1GZ0 A;  2LBW A;  1KD1 H;  3CC7 F;  3LWQ C;  1M1K H;  2VGN A;  2QEX F;  3NVI B;  3RA6 A;  2KG4 A;  2OTJ F;  3J80 M;  2LBX A;  5GIN C;  2HVY D;  1YI2 F;  2WAL A;  3SIV A;  3NK6 A;  3ON1 A;  2I6D A;  1W40 A;  1VQ5 F;  5G4U C;  3RA5 A;  5EWR A;  3J81 M;  3E20 B;  3SIU A;  1S72 F;  3CPQ A;  3CC4 F;  1VQN F;  1YIJ F;  3PLA C;  3CCL F;  3NMU C;  3E1Y A;  3CG6 A;  3OW2 F;  2BO1 A;  3LFO A;  1NMU B;  3CCJ F;  1CN7 A;  3PAF A;  3CCU F;  4X3L A;  1X7O A;  3AGK A;  1SDS A;  2KTU A;  3G71 F;  3N4Y A;  4C4W C;  2CZW A;  3CCM F;  1GO1 A;  5GAN K;  1H7M A;  3OBW A;  2JNB A;  5FJ4 C;  5GIO C;  1RA4 A;  3WXM B;  1W42 A;  1JJ2 F;  1RLG A;  1Q82 H;  2ALE A;  1VQ4 F;  3CCS F;  1E7K A;  3HAX D;  3IR9 A;  3HJW C;  1Q7Y H;  3VMF B;  1W2B F;  2OZB A;  2VGM A;  3LWV C;  1DT9 A;  1YHQ F;  1QVF F;  1XBI A;  1VQO F;  3LWR C;  3GYQ A;  1K9M H;  1KC8 H;  1IPA A;  4BY9 D;  3LWO C;  1Q81 H;  3G6E F;  3CCR F;  3CD6 F;  1X7P A;  1X52 A;  2AIF A;  2OTL F;  3O85 A;  5EO3 A;  1NJI H;  3I56 F;  3I55 F;  5FLX M; 
#chains in the Genus database with same CATH topology
 3GTZ A;  5LYJ B;  3OBY A;  4X3M A;  2HS4 A;  5C8Y A;  2FC3 A;  1YJN F;  3CMA F;  2Q1Y A;  5LXT A;  5GAP K;  5JVD B;  2V9Y A;  2ZF8 A;  4TZZ A;  3CCQ F;  3N4Z A;  2OTM A;  2NMU A;  1OAP A;  4YJ2 A;  4LCK A;  4BVQ A;  4ZHV A;  3WGN A;  3C9U A;  3V3T A;  1CK2 A;  3CCV F;  4O4I B;  5HY0 A;  5FNV A;  3U0O A;  5EAZ A;  3RYF A;  2HRU A;  1K8A H;  3ELC A;  3HTN A;  4R40 B;  4B5C A;  3JAW A;  3M1X A;  4ZHW A;  3CXC F;  1SZQ A;  3JAT B;  1GO0 A;  2LCA A;  3HKC B;  3E22 B;  2QI2 A;  3HKD B;  2KTV A;  4DRX A;  5MN6 A;  1JFF A;  1VQP F;  1YJW F;  4O2A B;  3FFM A;  4O4H B;  3J7A R;  5LOV B;  3ZP7 A;  2QA4 F;  3N2K B;  1KQS F;  4ZOL A;  4TUY A;  2LBW A;  4G4V A;  1W5A A;  4I4T A;  3NVI B;  4ZHQ A;  3RA6 A;  3R0P A;  2LBX A;  2CHT A;  2IQQ A;  2DYY A;  3P4E A;  5JQG B;  3S03 A;  1TVK B;  3SIV A;  1U43 A;  1VQ5 F;  4EI7 A;  3RA5 A;  2CWJ A;  2RHL A;  3DC2 A;  5IJ0 A;  3KHN A;  3VYS C;  1S72 F;  3PLA C;  4BT2 A;  3E1Y A;  2H8C A;  4IIJ A;  1FNK A;  5MN4 A;  2ZOD A;  1X7O A;  3AGK A;  4X3L A;  1SDS A;  5EIB C;  2H8E A;  4O4J B;  5CB4 A;  2KGW A;  1Q8R A;  1R1M A;  2CZW A;  4I55 A;  3CYQ A;  5GAN K;  5IJ9 A;  3HWU A;  4I50 B;  1W42 A;  1TUB B;  1JJ2 F;  1J7H A;  3F0F A;  3WPW A;  1KNK A;  3HKB B;  3RE3 A;  3C8L A;  5BMV A;  4C81 A;  1W5E A;  3JAS A;  2RB9 A;  1DT9 A;  1YHQ F;  2RHJ A;  3M84 A;  4BT6 A;  1XBI A;  2HQS C;  4YJ3 A;  3VYU C;  1XV2 A;  1KC8 H;  4ZI7 B;  3LWO C;  3BYQ A;  5LA6 A;  3G6E F;  2OTL F;  3O85 A;  5FNV B;  3RYF B;  5ITZ A;  3I56 F;  3C9S A;  3I7T A;  3VCZ A;  3WGM A;  5FLX M;  1VQ9 F;  2YYE A;  3G4S F;  1H48 A;  1VH8 A;  3JAK A;  5G4V C;  3UT5 A;  2HX0 A;  5EYP B;  3V7E A;  3VTI C;  1DBF A;  2QTP A;  1VQM F;  2CVL A;  2GVI A;  3F0E A;  1FNJ A;  2VAP A;  4F6R B;  4ZOL B;  2UYP A;  3P10 A;  5HP7 A;  4LNU A;  1K73 H;  1VQV A;  3B6N A;  5J2T B;  1QD9 A;  4ZHQ B;  3WJQ A;  4TV8 A;  3CPW F;  1VQK F;  1IV2 A;  3IKE A;  5DCV A;  4C8I A;  5JCO A;  3RYH B;  3RYI B;  2FGY A;  4FFB B;  4BT4 A;  4U39 A;  1FFX A;  4NWO B;  4HNA B;  4RQO A;  3HKE A;  1GZ0 A;  5KMG B;  1KD1 H;  3CC7 F;  3LWQ C;  2HP0 B;  2QEX F;  5J2U A;  2OTJ F;  3J80 M;  3JAL A;  3N2G A;  3WGJ A;  4O4L A;  5EZY A;  5IYZ B;  2WAL A;  3S0W A;  5HXU A;  1W40 A;  2R75 1;  3FD6 A;  3VO8 A;  5HY2 A;  3TD3 A;  3D54 A;  3J81 M;  5LP6 A;  3SIU A;  1VQN F;  4TV9 B;  4ERH A;  3JAR B;  1YIJ F;  3S0Y A;  3IMP A;  1QAH A;  5KX5 A;  4X1I A;  3OW2 F;  4O2B B;  4G4Z A;  2BTQ B;  1NMU B;  2L26 A;  1ODE A;  1SA0 B;  3ZO8 A;  1IV1 A;  5CA1 A;  1W5F A;  2KTU A;  2Z1F A;  1U40 A;  3VOA A;  2CSL A;  1GO1 A;  1H7M A;  5GON B;  2JNB A;  3VOB A;  4C8E A;  4YJ3 B;  3RYC B;  2IG8 A;  2BTO A;  1Z5W A;  5LA6 B;  5LP6 C;  3MBM A;  2VAM A;  5B8F A;  2ALE A;  5ITZ B;  2R6R 1;  5JH7 A;  3CCS F;  4X20 B;  4RHA A;  3IR9 A;  4B62 A;  4X1Y A;  4KWE A;  2Z1E A;  1QVF F;  5LYJ A;  1W57 A;  3K2X A;  2I6R A;  2GZL A;  1W55 A;  3V4D A;  1JY8 A;  3K12 A;  1IPA A;  2UYK A;  1X7P A;  2AIF A;  4ZHY B;  2PMP A;  3I55 F;  1PF5 A;  3KE1 A;  1W3E X;  4IHJ B;  4X1K B;  1RLU A;  3KJJ A;  5IT9 M;  1VQ7 F;  3MCA B;  5C8Y B;  2CHS A;  1ZWZ A;  1T0K B;  3JAT A;  3QHD A;  4M8I A;  1YJ9 F;  2G9I A;  4C82 A;  5LXT B;  3HKC A;  2OHW A;  3FBA A;  3MDO A;  3TD5 A;  3TD4 A;  1FFX B;  3FPI A;  3HKD A;  3JAM M;  3P0Z A;  3V7Q A;  4YJ2 B;  4EB6 A;  2Q1X A;  3IEW A;  3MCQ A;  3K14 A;  3NK7 A;  4O2A A;  1VQ8 F;  5GIP C;  5LOV A;  1YQN A;  3JCM M;  1VQ6 F;  1KNJ A;  1UFY A;  3F0D A;  1QVG F;  4BW0 B;  4NUT A;  2BTU A;  3JAW B;  1X25 A;  3ZOP A;  2B33 A;  1Q86 H;  5HXZ A;  2ZOV A;  1N8R H;  4DRX B;  4U3J A;  1JFF B;  5LP6 B;  1TVK A;  5CA0 A;  1COM A;  1Z5V A;  3VIU A;  4TUY B;  3GHZ A;  2RHH A;  2Z1T A;  3KIZ A;  4I4T B;  1QU9 A;  5CA1 B;  2I6D A;  3NK6 A;  4PWT A;  2W8B C;  5G4U C;  4B45 A;  2UYN A;  3DDN A;  2DT4 A;  3LYB A;  3E20 B;  4BVS A;  3CC4 F;  3CPQ A;  2Z01 A;  5EIB D;  3NMU C;  2YXZ A;  3VYT C;  3CG6 A;  3LFO A;  3MQW A;  3F0G A;  3OON A;  5IJ0 B;  1CN7 A;  3PAF A;  3CCU F;  4EI9 A;  4I50 A;  4E6E A;  3I3F A;  1TUB A;  4WBN A;  3Q8H A;  3CCM F;  4IIJ B;  2IAF A;  3OBW A;  3HKB A;  3F6M A;  1RA4 A;  3WJR A;  3WXM B;  4B46 A;  1RQ7 A;  4NQ3 A;  5JCO C;  5CB4 B;  3EOR A;  3WGL A;  4I55 B;  5IJ9 B;  4BT7 A;  3KJK A;  5HY4 A;  1VQ4 F;  1NQ3 A;  4G4Y A;  4ZI7 A;  1Q7Y H;  3VMF B;  2OZB A;  2VGM A;  3LWV C;  1XHO A;  1UI9 A;  2K1S A;  2ZVZ A;  3ZP4 A;  3LWR C;  2VXY A;  5BMV B;  2CW4 A;  1JD1 A;  2HP3 A;  3JAS B;  2LBT A;  4BY9 D;  3CCR F;  1W58 1;  3CD6 F;  5EYP A;  5EO3 A;  4BT5 A;  4BVT A;  1H47 A;  1OFU A;  1PXW A;  3S06 A;  4EB6 B;  3CCE F;  3LWP C;  4G4W A;  3NVK E;  2N48 A;  5EB1 B;  1ONI A;  4F6R A;  1M90 H;  3CC2 F;  3S0H A;  2EWC A;  1U3L A;  5J2T A;  3C9T A;  3D01 A;  1IV3 A;  5HY1 A;  1VQL F;  2HS0 A;  1T0A A;  1YIT F;  1W41 A;  3JAK B;  3JVH A;  3UT5 B;  3K0T A;  3IEQ A;  4U3J B;  1IV4 A;  3RYH A;  3C9R A;  1YGY A;  5CA0 B;  3RYI A;  1U3P A;  4FFB A;  5JVD A;  2GLZ A;  3CME F;  4HNA A;  5A2Q M;  3LDT A;  5EB0 A;  2AMT A;  3VI6 A;  5KMG A;  4LNU B;  2HP0 A;  3ESJ A;  5HP8 A;  3WPX A;  3CYP B;  3IKF A;  4O4I A;  4TV8 B;  2RHO A;  2AIZ P;  1FSZ A;  2MQE A;  1W59 A;  2UYN B;  4EI8 A;  5IYZ A;  1M1K H;  2PHN A;  2VGN A;  3L7Q A;  2UYJ A;  2KG4 A;  3CB2 A;  3E22 A;  5GIN C;  3HKE B;  4BVR A;  2HVY D;  1YI2 F;  2ZAU A;  4O4H A;  1VHA A;  4TV9 A;  3JAR A;  3FD5 A;  3ON1 A;  3QUW A;  3ERN A;  2Z1U A;  5J2U B;  4WBN B;  3N2K A;  4O2B A;  3JAL B;  4G88 A;  5EWR A;  3N2G B;  4O4L B;  1SA0 A;  5EZY B;  3QTY A;  2HS3 A;  1JN1 A;  3CCL F;  1RQ2 A;  4BT3 A;  4ZK7 A;  5HWE A;  2BO1 A;  2H6L A;  5JQG A;  4DXD A;  3CCJ F;  2HRY A;  5GON A;  1W5B A;  1XRG A;  3RYC A;  4G4X A;  5KX5 B;  3G71 F;  4X1I B;  3N4Y A;  5AVM A;  4C4W C;  5FJ4 C;  5GIO C;  2UZH A;  4X20 A;  2ZVY A;  3D00 A;  1RLG A;  1CLI A;  3LME A;  1Q82 H;  2VAW A;  4XCQ A;  3T80 A;  3S02 A;  1E7K A;  3HAX D;  3HJW C;  4O4J A;  1W2B F;  3M4S A;  3WGK A;  3WJP A;  2F9Z C;  5MN5 A;  1VQO F;  3GYQ A;  1K9M H;  5JH7 B;  1Q81 H;  4X1Y B;  1X52 A;  1GX1 A;  1VK3 A;  2P6Y A;  4IHJ A;  4X1K A;  4C8G A;  1NJI H; 
#chains in the Genus database with same CATH homology
 1VQ9 F;  3OBY A;  4X3M A;  4BVT A;  1PXW A;  2FC3 A;  3G4S F;  1YJN F;  3CMA F;  3CCE F;  1W3E X;  3LWP C;  5GAP K;  5G4V C;  3NVK E;  3V7E A;  1M90 H;  3CC2 F;  4TZZ A;  3CCQ F;  3N4Z A;  5IT9 M;  1VQ7 F;  1VQM F;  3MCA B;  4LCK A;  4BVQ A;  1ZWZ A;  1T0K B;  3V3T A;  5HY1 A;  1YJ9 F;  1VQL F;  1CK2 A;  1YIT F;  3CCV F;  5HY0 A;  1W41 A;  2OHW A;  1K8A H;  3JAM M;  1K73 H;  3V7Q A;  3CXC F;  3NK7 A;  1VQ8 F;  1GO0 A;  5GIP C;  3CPW F;  1VQK F;  3JCM M;  2GLZ A;  1VQ6 F;  3CME F;  5A2Q M;  1QVG F;  3VI6 A;  2QI2 A;  4BW0 B;  2KTV A;  4NUT A;  5DCV A;  1VQP F;  1YJW F;  3FFM A;  1Q86 H;  3J7A R;  2FGY A;  2QA4 F;  5HXZ A;  1KQS F;  1N8R H;  1GZ0 A;  2LBW A;  1KD1 H;  4EI8 A;  3CC7 F;  3LWQ C;  1M1K H;  2VGN A;  2QEX F;  3NVI B;  3RA6 A;  2KG4 A;  2OTJ F;  3J80 M;  2LBX A;  5GIN C;  4BVR A;  2HVY D;  1YI2 F;  2WAL A;  3SIV A;  3NK6 A;  3ON1 A;  2I6D A;  5HXU A;  1W40 A;  1VQ5 F;  4EI7 A;  3RA5 A;  5G4U C;  5EWR A;  5HY2 A;  3J81 M;  3E20 B;  4BVS A;  3SIU A;  1S72 F;  3CPQ A;  3CC4 F;  1VQN F;  1YIJ F;  3PLA C;  3CCL F;  3NMU C;  3E1Y A;  3CG6 A;  5HWE A;  3OW2 F;  2BO1 A;  3LFO A;  1NMU B;  3CCJ F;  1CN7 A;  3PAF A;  3CCU F;  4X3L A;  1X7O A;  3AGK A;  4EI9 A;  1SDS A;  2KTU A;  3G71 F;  3N4Y A;  4C4W C;  2CZW A;  3CCM F;  1GO1 A;  5GAN K;  1H7M A;  3OBW A;  2JNB A;  5FJ4 C;  5GIO C;  1RA4 A;  3WXM B;  1W42 A;  4NQ3 A;  3D00 A;  1JJ2 F;  1RLG A;  1Q82 H;  2ALE A;  4XCQ A;  5HY4 A;  1VQ4 F;  3CCS F;  1E7K A;  3HAX D;  3IR9 A;  3HJW C;  1Q7Y H;  3VMF B;  1W2B F;  2OZB A;  2VGM A;  3LWV C;  2F9Z C;  1DT9 A;  1YHQ F;  1QVF F;  1XBI A;  1VQO F;  3LWR C;  3GYQ A;  1K9M H;  1KC8 H;  1IPA A;  4BY9 D;  3LWO C;  1Q81 H;  3G6E F;  3CCR F;  3CD6 F;  1X7P A;  1X52 A;  2AIF A;  2OTL F;  3O85 A;  5EO3 A;  1NJI H;  3I56 F;  3I55 F;  5FLX M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...