5GANK

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ganK00
3O85A 1GO1A 3LWOC 3CCEF 2OTJF 2QA4F 3AGKA 1VQ4F 5GAPK 2ALEA 2CZWA 3CPQA 5EWRA 3LWRC 1VQ8F 1JJ2F 3G71F 2I6DA 1W42A 3VMFB 1VQ7F 2KG4A 2QEXF 3JCMM 1RLGA 1K73H 3VI6A 3PAFA 5G4UC 3CXCF 4X3LA 3MCAB 1VQOF 1GZ0A 3CC4F 1XBIA 5GANK 1W41A 1K8AH 1W40A 3LWPC 3WXMB 1RA4A 1M90H 2OZBA 1YJWF 1YJNF 2AIFA 2QI2A 1X52A 2HVYD 1IPAA 3CCMF 3J81M 1SDSA 3NVKE 2OHWA 3CG6A 1VQLF 1KC8H 3V7QA 5GIOC 2KTUA 1VQ9F 3LFOA 1K9MH 3RA6A 4BW0B 1N8RH 3NK7A 2KTVA 3CD6F 1KD1H 1YJ9F 3ON1A 3CPWF 3J80M 3CCQF 3CMAF 3CCVF 1Q81H 3I55F 3HAXD 1VQ6F 2OTLF 3GYQA 3E20B 1VQKF 2VGNA 3CCUF 1T0KB 3NVIB 3PLAC 5GIPC 2BO1A 3I56F 3N4YA 3CCRF 3CMEF 1GO0A 2VGMA 1S72F 1YIJF 3HJWC 4TZZA 3LWVC 4NUTA 3IR9A 1VQMF 3CCJF 1ZWZA 5G4VC 3CC2F 1NMUB 5A2QM 3SIVA 1X7OA 3LWQC 4LCKA 1QVFF 3RA5A 1Q86H 3SIUA 1NJIH 5GINC 1W3EX 3OW2F 1CK2A 2FC3A 1X7PA 1YITF 1QVGF 3V7EA 3JAMM 5FLXM 1VQPF 1VQ5F 3N4ZA 1YHQF 1YI2F 3NK6A 4X3MA 1W2BF 1CN7A 5FJ4C 1Q7YH 3OBYA 3G6EF 3FFMA 5IT9M 1PXWA 2LBWA 1KQSF 1H7MA 3OBWA 5EO3A 1M1KH 3CCLF 3NMUC 2WALA 3CC7F 1Q82H 3CCSF 3J7AR 4BY9D 1DT9A 3E1YA 1VQNF 2LBXA 5DCVA 2JNBA 4C4WC 3G4SF 1E7KA
chains in the Genus database with same CATH superfamily
2VAMA 3WGNA 1W5AA 2CZWA 2RHJA 3CPQA 5EWRA 3LWRC 1VQ8F 3RYCB 4C81A 4YJ2A 4F6RA 3JCMM 3PAFA 3RYHA 1XBIA 3HTNA 2GVIA 1VHAA 3KIZA 1FFXB 3HKDA 4U3JA 1VK3A 3N2KA 5FNVB 4YJ3A 3K2XA 2AIFA 3DC2A 2H8CA 4ERHA 3ELCA 4R40B 1IPAA 1U3PA 3U0OA 2V9YA 3R0PA 1SDSA 3CYPB 3RYIA 4X1IA 5IYZB 3V7QA 4LNUB 2UYNB 1X25A 4EI8A 1VQ9F 4WBNA 3IEQA 3P10A 1U40A 4BW0B 3LYBA 3NK7A 2LCAA 4IHJA 1KD1H 4I55A 3CPWF 1TVKB 3CCVF 4IHJB 1QD9A 2ZVZA 4EI9A 4B46A 1RQ7A 2CWJA 4O2AB 1YQNA 3MBMA 2RHHA 2LBTA 3N4YA 2PMPA 1T0AA 1TUBB 5KMGB 1YIJF 5EZYB 3V4DA 3WGKA 3ZP7A 5CA1A 1DBFA 3S06A 4TZZA 3T80A 1SA0A 5LXTB 4NUTA 3IR9A 3WGLA 4TV9B 3VOBA 4NWOB 4BT3A 1H48A 3SIUA 5EIBD 3JALB 1CK2A 3Q8HA 2K1SA 1YITF 4ZOLA 5FLXM 3RYFA 4HNAA 3M1XA 2DT4A 4X3MA 5LA6B 3OBYA 3N2GA 1W59A 3VOAA 2CW4A 2CHSA 5HP8A 3WPWA 4C8EA 1KQSF 3CYQA 4G4VA 3NMUC 4O4HA 4BT2A 3KHNA 3HWUA 3CCSF 1YGYA 4BY9D 3K12A 1VH8A 2CSLA 3HKBA 4O4HB 3DDNA 2HS4A 4FFBA 2HP0B 3VIUA 1XHOA 5KX5A 4O2BA 5J2UB 3AGKA 1VQ4F 4BT4A 3FBAA 1UI9A 4I4TA 2HS3A 1JJ2F 2ZF8A 3G71F 3S0WA 3VMFB 3ESJA 2QEXF 1W55A 3QTYA 5JQGB 4IIJA 4BVSA 5G4UC 5CA0A 4X3LA 3S03A 3E22A 1JD1A 2DYYA 3HKCB 4RQOA 4BVRA 4TV8B 5LOVA 2F9ZC 4TUYA 4B5CA 2N48A 3JARA 3WXMB 3F0DA 1H47A 1RA4A 2BTUA 3QHDA 4X20A 1U43A 3S0HA 3F0GA 2MQEA 3FPIA 1YJWF 1YJNF 1M90H 2YXZA 4O4LB 3KE1A 3M4SA 4X1KB 4I50A 2ZAUA 5MN4A 2IG8A 3J81M 3NVKE 1KC8H 2R6R1 5HP7A 3LFOA 4O4JA 1Z5VA 1W5BA 4E6EA 2KTVA 2UYKA 4YJ2B 5EB1B 5JCOA 3ZP4A 1COMA 4EB6A 4F6RB 3CD6F 3ON1A 3IKFA 3RYHB 3S02A 3CMAF 2BTOA 4BVQA 3KJJA 1FNKA 3GYQA 3WJRA 3FD5A 5GIPC 3HKDB 4U3JB 2BO1A 2HS0A 3N2KB 3I56F 3CCRF 4YJ3B 3F0FA 2KGWA 2CHTA 1KNJA 1VQMF 3TD5A 5LYJA 2Z1FA 3RYIB 4X1IB 2Q1XA 3LWQC 3LMEA 3RA5A 3TD4A 3HKEA 1W3EX 4WBNB 1X7PA 4BVTA 1QVGF 3CB2A 5MN6A 1VQPF 3N4ZA 1W581 3BYQA 2W8BC 2AIZP 4I55B 4X1YA 5B8FA 3GHZA 3V3TA 3NK6A 1XRGA 5FJ4C 1Q7YH 4DRXA 1R1MA 1NQ3A 3FFMA 1PXWA 1W5FA 5JCOC 5CA1B 4BT6A 2WALA 5GONA 1JFFA 2H8EA 1Q82H 1SA0B 1VQNF 2P6YA 5JH7A 2LBXA 2R751 3MQWA 5EB0A 2UZHA 5DCVA 1W5EA 4C4WC 3G4SF 5CB4A 1GO1A 3CCEF 2QA4F 5GAPK 5LP6A 4ZOLB 5BMVA 2RHOA 3JASA 5HWEA 3ERNA 4ZHVA 2I6RA 3UT5A 3RYFB 2KG4A 3IMPA 4HNAB 5J2TA 1RLGA 2Z1EA 5JVDA 1K73H 3D00A 1IV3A 1RLUA 3I7TA 2UYJA 1RQ2A 3MCAB 1VQOF 5GANK 1W41A 3N2GB 3WJPA 3LWPC 2HRUA 1SZQA 4G88A 3VYUC 2OZBA 1IV1A 3VO8A 5MN5A 2G9IA 3JAWA 5HY0A 5HXUA 3HKBB 4B62A 4BT5A 4FFBB 4C8GA 3VYSC 3S0YA 5KX5B 2HRYA 3JATA 4O2BB 2GLZA 3CG6A 4G4WA 4EI7A 2HQSC 5GIOC 2KTUA 2QTPA 1Z5WA 4I4TB 1ONIA 2GZLA 3RA6A 1N8RH 1JN1A 3QUWA 2ZVYA 2AMTA 2OTMA 3P4EA 4IIJB 5CA0B 4ZI7A 1KNKA 3E22B 1Q81H 3K14A 5LOVB 3HAXD 5IJ0A 1VQ6F 1ODEA 1VQKF 4TUYB 2VGNA 5LP6C 3C8LA 3JARB 3KJKA 5EYPA 3CCUF 3NVIB 3PLAC 4ZHQA 4U39A 4X20B 3CMEF 5C8YA 5IJ0B 4O4IA 1GO0A 2VGMA 3HJWC 5ITZA 1UFYA 3JAKA 4I50B 1IV4A 3LWVC 3P0ZA 3C9SA 3F6MA 3C9UA 5G4VC 2IAFA 3B6NA 3CC2F 1NMUB 1X7OA 1QVFF 1Q86H 1OAPA 5GINC 3JVHA 5HY4A 4O4JB 5HXZA 1U3LA 2UYPA 4EB6B 3D01A 4BT7A 3RYCA 3M84A 1VQVA 1W2BF 3G6EF 5IT9M 2Z1TA 1Q8RA 1H7MA 1FFXA 2ZODA 2Z01A 3OBWA 3IKEA 5EO3A 3CCLF 1M1KH 3RE3A 5FNVA 3CC7F 2YYEA 1DT9A 3E1YA 5LYJB 4G4ZA 3EORA 2VAWA 1FSZA 2JNBA 4C8IA 3WGMA 3IEWA 3HKEB 1E7KA 3O85A 3LWOC 2OTJF 5IYZA 1JY8A 2ALEA 2VXYA 2UYNA 4LNUA 3WGJA 5EAZA 3WPXA 4X1YB 3TD3A 2I6DA 1W42A 4G4XA 1VQ7F 3LDTA 3VI6A 3FD6A 3GTZA 1GX1A 1TVKA 3CXCF 2HP3A 2NMUA 4DXDA 1GZ0A 4O2AA 4DRXB 1K8AH 3CC4F 2VAPA 1W57A 1W40A 3ZOPA 3C9TA 5GONB 1JFFB 2PHNA 1TUBA 5KMGA 2L26A 5EZYA 1X52A 1QU9A 2QI2A 2HVYD 4ZHWA 1IV2A 5JH7B 3OONA 3CCMF 5LXTA 4TV9A 2Z1UA 2BTQB 2Q1YA 3L7QA 5CB4B 2OHWA 1VQLF 2RHLA 4G4YA 5LP6B 5BMVB 2B33A 3JALA 4KWEA 5IJ9A 3JASB 2EWCA 1K9MH 3D54A 3UT5B 4B45A 5J2TB 5JVDB 1OFUA 5IJ9B 1YJ9F 2RB9A 2IQQA 3J80M 3MDOA 3CCQF 3VTIC 2FGYA 3WJQA 3I55F 2OTLF 3E20B 5LA6A 1T0KB 4M8IA 1PF5A 5AVMA 1S72F 3JAWB 3F0EA 4NQ3A 3CCJF 1ZWZA 3JATB 5A2QM 1CLIA 3SIVA 4ZHYB 4LCKA 1QAHA 4RHAA 2HP0A 4C82A 1NJIH 3OW2F 2FC3A 2ZOVA 5J2UA 3V7EA 4ZK7A 3JAMM 2H6LA 1VQ5F 1YHQF 1YI2F 4ZI7B 1J7HA 1XV2A 5JQGA 3VCZA 1CN7A 5EYPB 3HKCA 4ZHQB 4TV8A 3K0TA 2LBWA 3VYTC 5C8YB 3C9RA 4O4IB 5ITZB 1FNJA 3JAKB 5HY2A 2CVLA 3J7AR 2HX0A 4O4LA 4X1KA 5HY1A 3ZO8A 5EIBC 4PWTA 3MCQA 4XCQA 3I3FA
chains in the Genus database with same CATH topology
3O85A 1GO1A 3LWOC 3CCEF 2OTJF 2QA4F 3AGKA 1VQ4F 5GAPK 2ALEA 2CZWA 3CPQA 5EWRA 3LWRC 5HWEA 1JJ2F 1VQ8F 3G71F 2I6DA 1W42A 3VMFB 1VQ7F 2KG4A 2QEXF 3JCMM 1RLGA 1K73H 3VI6A 3PAFA 3D00A 4BVSA 5G4UC 3CXCF 4X3LA 3MCAB 1VQOF 1GZ0A 3CC4F 1XBIA 4BVRA 1W41A 5GANK 1K8AH 2F9ZC 1W40A 3LWPC 3WXMB 1RA4A 1M90H 2OZBA 1YJWF 1YJNF 2AIFA 2QI2A 1X52A 2HVYD 5HY0A 5HXUA 1IPAA 3CCMF 3J81M 1SDSA 3NVKE 2OHWA 2GLZA 3CG6A 1VQLF 1KC8H 3V7QA 4EI7A 5GIOC 2KTUA 4EI8A 3LFOA 1VQ9F 1K9MH 3RA6A 4BW0B 1N8RH 3NK7A 2KTVA 3CD6F 1KD1H 1YJ9F 3ON1A 3CPWF 3J80M 3CCQF 3CMAF 2FGYA 3CCVF 1Q81H 4EI9A 4BVQA 3I55F 3HAXD 1VQ6F 2OTLF 3GYQA 3E20B 1VQKF 2VGNA 3CCUF 1T0KB 3NVIB 3PLAC 5GIPC 2BO1A 3I56F 3N4YA 3CCRF 3CMEF 1GO0A 2VGMA 1S72F 1YIJF 3HJWC 4TZZA 4NQ3A 3LWVC 4NUTA 3IR9A 1VQMF 3CCJF 1ZWZA 5G4VC 3CC2F 1NMUB 5A2QM 3SIVA 1X7OA 3LWQC 4LCKA 1QVFF 3RA5A 1Q86H 3SIUA 1NJIH 5GINC 1W3EX 3OW2F 5HY4A 1CK2A 2FC3A 5HXZA 1X7PA 1YITF 4BVTA 1QVGF 3V7EA 3JAMM 5FLXM 1VQPF 1VQ5F 3N4ZA 1YHQF 1YI2F 3V3TA 3NK6A 4X3MA 1W2BF 1CN7A 5FJ4C 1Q7YH 3OBYA 3G6EF 3FFMA 5IT9M 1PXWA 2LBWA 1KQSF 1H7MA 3OBWA 5EO3A 1M1KH 3CCLF 3NMUC 2WALA 3CC7F 5HY2A 1Q82H 3CCSF 3J7AR 4BY9D 1DT9A 3E1YA 1VQNF 5HY1A 2LBXA 5DCVA 2JNBA 4XCQA 4C4WC 3G4SF 1E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O85 A;  1GO1 A;  3LWO C;  3CCE F;  2OTJ F;  2QA4 F;  3AGK A;  1VQ4 F;  5GAP K;  2ALE A;  2CZW A;  3CPQ A;  5EWR A;  3LWR C;  1VQ8 F;  1JJ2 F;  3G71 F;  2I6D A;  1W42 A;  3VMF B;  1VQ7 F;  2KG4 A;  2QEX F;  3JCM M;  1RLG A;  1K73 H;  3VI6 A;  3PAF A;  5G4U C;  3CXC F;  4X3L A;  3MCA B;  1VQO F;  1GZ0 A;  3CC4 F;  1XBI A;  5GAN K;  1W41 A;  1K8A H;  1W40 A;  3LWP C;  3WXM B;  1RA4 A;  1M90 H;  2OZB A;  1YJW F;  1YJN F;  2AIF A;  2QI2 A;  1X52 A;  2HVY D;  1IPA A;  3CCM F;  3J81 M;  1SDS A;  3NVK E;  2OHW A;  3CG6 A;  1VQL F;  1KC8 H;  3V7Q A;  5GIO C;  2KTU A;  1VQ9 F;  3LFO A;  1K9M H;  3RA6 A;  4BW0 B;  1N8R H;  3NK7 A;  2KTV A;  3CD6 F;  1KD1 H;  1YJ9 F;  3ON1 A;  3CPW F;  3J80 M;  3CCQ F;  3CMA F;  3CCV F;  1Q81 H;  3I55 F;  3HAX D;  1VQ6 F;  2OTL F;  3GYQ A;  3E20 B;  1VQK F;  2VGN A;  3CCU F;  1T0K B;  3NVI B;  3PLA C;  5GIP C;  2BO1 A;  3I56 F;  3N4Y A;  3CCR F;  3CME F;  1GO0 A;  2VGM A;  1S72 F;  1YIJ F;  3HJW C;  4TZZ A;  3LWV C;  4NUT A;  3IR9 A;  1VQM F;  3CCJ F;  1ZWZ A;  5G4V C;  3CC2 F;  1NMU B;  5A2Q M;  3SIV A;  1X7O A;  3LWQ C;  4LCK A;  1QVF F;  3RA5 A;  1Q86 H;  3SIU A;  1NJI H;  5GIN C;  1W3E X;  3OW2 F;  1CK2 A;  2FC3 A;  1X7P A;  1YIT F;  1QVG F;  3V7E A;  3JAM M;  5FLX M;  1VQP F;  1VQ5 F;  3N4Z A;  1YHQ F;  1YI2 F;  3NK6 A;  4X3M A;  1W2B F;  1CN7 A;  5FJ4 C;  1Q7Y H;  3OBY A;  3G6E F;  3FFM A;  5IT9 M;  1PXW A;  2LBW A;  1KQS F;  1H7M A;  3OBW A;  5EO3 A;  1M1K H;  3CCL F;  3NMU C;  2WAL A;  3CC7 F;  1Q82 H;  3CCS F;  3J7A R;  4BY9 D;  1DT9 A;  3E1Y A;  1VQN F;  2LBX A;  5DCV A;  2JNB A;  4C4W C;  3G4S F;  1E7K A; 
#chains in the Genus database with same CATH topology
 2VAM A;  3WGN A;  1W5A A;  2CZW A;  2RHJ A;  3CPQ A;  5EWR A;  3LWR C;  1VQ8 F;  3RYC B;  4C81 A;  4YJ2 A;  4F6R A;  3JCM M;  3PAF A;  3RYH A;  1XBI A;  3HTN A;  2GVI A;  1VHA A;  3KIZ A;  1FFX B;  3HKD A;  4U3J A;  1VK3 A;  3N2K A;  5FNV B;  4YJ3 A;  3K2X A;  2AIF A;  3DC2 A;  2H8C A;  4ERH A;  3ELC A;  4R40 B;  1IPA A;  1U3P A;  3U0O A;  2V9Y A;  3R0P A;  1SDS A;  3CYP B;  3RYI A;  4X1I A;  5IYZ B;  3V7Q A;  4LNU B;  2UYN B;  1X25 A;  4EI8 A;  1VQ9 F;  4WBN A;  3IEQ A;  3P10 A;  1U40 A;  4BW0 B;  3LYB A;  3NK7 A;  2LCA A;  4IHJ A;  1KD1 H;  4I55 A;  3CPW F;  1TVK B;  3CCV F;  4IHJ B;  1QD9 A;  2ZVZ A;  4EI9 A;  4B46 A;  1RQ7 A;  2CWJ A;  4O2A B;  1YQN A;  3MBM A;  2RHH A;  2LBT A;  3N4Y A;  2PMP A;  1T0A A;  1TUB B;  5KMG B;  1YIJ F;  5EZY B;  3V4D A;  3WGK A;  3ZP7 A;  5CA1 A;  1DBF A;  3S06 A;  4TZZ A;  3T80 A;  1SA0 A;  5LXT B;  4NUT A;  3IR9 A;  3WGL A;  4TV9 B;  3VOB A;  4NWO B;  4BT3 A;  1H48 A;  3SIU A;  5EIB D;  3JAL B;  1CK2 A;  3Q8H A;  2K1S A;  1YIT F;  4ZOL A;  5FLX M;  3RYF A;  4HNA A;  3M1X A;  2DT4 A;  4X3M A;  5LA6 B;  3OBY A;  3N2G A;  1W59 A;  3VOA A;  2CW4 A;  2CHS A;  5HP8 A;  3WPW A;  4C8E A;  1KQS F;  3CYQ A;  4G4V A;  3NMU C;  4O4H A;  4BT2 A;  3KHN A;  3HWU A;  3CCS F;  1YGY A;  4BY9 D;  3K12 A;  1VH8 A;  2CSL A;  3HKB A;  4O4H B;  3DDN A;  2HS4 A;  4FFB A;  2HP0 B;  3VIU A;  1XHO A;  5KX5 A;  4O2B A;  5J2U B;  3AGK A;  1VQ4 F;  4BT4 A;  3FBA A;  1UI9 A;  4I4T A;  2HS3 A;  1JJ2 F;  2ZF8 A;  3G71 F;  3S0W A;  3VMF B;  3ESJ A;  2QEX F;  1W55 A;  3QTY A;  5JQG B;  4IIJ A;  4BVS A;  5G4U C;  5CA0 A;  4X3L A;  3S03 A;  3E22 A;  1JD1 A;  2DYY A;  3HKC B;  4RQO A;  4BVR A;  4TV8 B;  5LOV A;  2F9Z C;  4TUY A;  4B5C A;  2N48 A;  3JAR A;  3WXM B;  3F0D A;  1H47 A;  1RA4 A;  2BTU A;  3QHD A;  4X20 A;  1U43 A;  3S0H A;  3F0G A;  2MQE A;  3FPI A;  1YJW F;  1YJN F;  1M90 H;  2YXZ A;  4O4L B;  3KE1 A;  3M4S A;  4X1K B;  4I50 A;  2ZAU A;  5MN4 A;  2IG8 A;  3J81 M;  3NVK E;  1KC8 H;  2R6R 1;  5HP7 A;  3LFO A;  4O4J A;  1Z5V A;  1W5B A;  4E6E A;  2KTV A;  2UYK A;  4YJ2 B;  5EB1 B;  5JCO A;  3ZP4 A;  1COM A;  4EB6 A;  4F6R B;  3CD6 F;  3ON1 A;  3IKF A;  3RYH B;  3S02 A;  3CMA F;  2BTO A;  4BVQ A;  3KJJ A;  1FNK A;  3GYQ A;  3WJR A;  3FD5 A;  5GIP C;  3HKD B;  4U3J B;  2BO1 A;  2HS0 A;  3N2K B;  3I56 F;  3CCR F;  4YJ3 B;  3F0F A;  2KGW A;  2CHT A;  1KNJ A;  1VQM F;  3TD5 A;  5LYJ A;  2Z1F A;  3RYI B;  4X1I B;  2Q1X A;  3LWQ C;  3LME A;  3RA5 A;  3TD4 A;  3HKE A;  1W3E X;  4WBN B;  1X7P A;  4BVT A;  1QVG F;  3CB2 A;  5MN6 A;  1VQP F;  3N4Z A;  1W58 1;  3BYQ A;  2W8B C;  2AIZ P;  4I55 B;  4X1Y A;  5B8F A;  3GHZ A;  3V3T A;  3NK6 A;  1XRG A;  5FJ4 C;  1Q7Y H;  4DRX A;  1R1M A;  1NQ3 A;  3FFM A;  1PXW A;  1W5F A;  5JCO C;  5CA1 B;  4BT6 A;  2WAL A;  5GON A;  1JFF A;  2H8E A;  1Q82 H;  1SA0 B;  1VQN F;  2P6Y A;  5JH7 A;  2LBX A;  2R75 1;  3MQW A;  5EB0 A;  2UZH A;  5DCV A;  1W5E A;  4C4W C;  3G4S F;  5CB4 A;  1GO1 A;  3CCE F;  2QA4 F;  5GAP K;  5LP6 A;  4ZOL B;  5BMV A;  2RHO A;  3JAS A;  5HWE A;  3ERN A;  4ZHV A;  2I6R A;  3UT5 A;  3RYF B;  2KG4 A;  3IMP A;  4HNA B;  5J2T A;  1RLG A;  2Z1E A;  5JVD A;  1K73 H;  3D00 A;  1IV3 A;  1RLU A;  3I7T A;  2UYJ A;  1RQ2 A;  3MCA B;  1VQO F;  5GAN K;  1W41 A;  3N2G B;  3WJP A;  3LWP C;  2HRU A;  1SZQ A;  4G88 A;  3VYU C;  2OZB A;  1IV1 A;  3VO8 A;  5MN5 A;  2G9I A;  3JAW A;  5HY0 A;  5HXU A;  3HKB B;  4B62 A;  4BT5 A;  4FFB B;  4C8G A;  3VYS C;  3S0Y A;  5KX5 B;  2HRY A;  3JAT A;  4O2B B;  2GLZ A;  3CG6 A;  4G4W A;  4EI7 A;  2HQS C;  5GIO C;  2KTU A;  2QTP A;  1Z5W A;  4I4T B;  1ONI A;  2GZL A;  3RA6 A;  1N8R H;  1JN1 A;  3QUW A;  2ZVY A;  2AMT A;  2OTM A;  3P4E A;  4IIJ B;  5CA0 B;  4ZI7 A;  1KNK A;  3E22 B;  1Q81 H;  3K14 A;  5LOV B;  3HAX D;  5IJ0 A;  1VQ6 F;  1ODE A;  1VQK F;  4TUY B;  2VGN A;  5LP6 C;  3C8L A;  3JAR B;  3KJK A;  5EYP A;  3CCU F;  3NVI B;  3PLA C;  4ZHQ A;  4U39 A;  4X20 B;  3CME F;  5C8Y A;  5IJ0 B;  4O4I A;  1GO0 A;  2VGM A;  3HJW C;  5ITZ A;  1UFY A;  3JAK A;  4I50 B;  1IV4 A;  3LWV C;  3P0Z A;  3C9S A;  3F6M A;  3C9U A;  5G4V C;  2IAF A;  3B6N A;  3CC2 F;  1NMU B;  1X7O A;  1QVF F;  1Q86 H;  1OAP A;  5GIN C;  3JVH A;  5HY4 A;  4O4J B;  5HXZ A;  1U3L A;  2UYP A;  4EB6 B;  3D01 A;  4BT7 A;  3RYC A;  3M84 A;  1VQV A;  1W2B F;  3G6E F;  5IT9 M;  2Z1T A;  1Q8R A;  1H7M A;  1FFX A;  2ZOD A;  2Z01 A;  3OBW A;  3IKE A;  5EO3 A;  3CCL F;  1M1K H;  3RE3 A;  5FNV A;  3CC7 F;  2YYE A;  1DT9 A;  3E1Y A;  5LYJ B;  4G4Z A;  3EOR A;  2VAW A;  1FSZ A;  2JNB A;  4C8I A;  3WGM A;  3IEW A;  3HKE B;  1E7K A;  3O85 A;  3LWO C;  2OTJ F;  5IYZ A;  1JY8 A;  2ALE A;  2VXY A;  2UYN A;  4LNU A;  3WGJ A;  5EAZ A;  3WPX A;  4X1Y B;  3TD3 A;  2I6D A;  1W42 A;  4G4X A;  1VQ7 F;  3LDT A;  3VI6 A;  3FD6 A;  3GTZ A;  1GX1 A;  1TVK A;  3CXC F;  2HP3 A;  2NMU A;  4DXD A;  1GZ0 A;  4O2A A;  4DRX B;  1K8A H;  3CC4 F;  2VAP A;  1W57 A;  1W40 A;  3ZOP A;  3C9T A;  5GON B;  1JFF B;  2PHN A;  1TUB A;  5KMG A;  2L26 A;  5EZY A;  1X52 A;  1QU9 A;  2QI2 A;  2HVY D;  4ZHW A;  1IV2 A;  5JH7 B;  3OON A;  3CCM F;  5LXT A;  4TV9 A;  2Z1U A;  2BTQ B;  2Q1Y A;  3L7Q A;  5CB4 B;  2OHW A;  1VQL F;  2RHL A;  4G4Y A;  5LP6 B;  5BMV B;  2B33 A;  3JAL A;  4KWE A;  5IJ9 A;  3JAS B;  2EWC A;  1K9M H;  3D54 A;  3UT5 B;  4B45 A;  5J2T B;  5JVD B;  1OFU A;  5IJ9 B;  1YJ9 F;  2RB9 A;  2IQQ A;  3J80 M;  3MDO A;  3CCQ F;  3VTI C;  2FGY A;  3WJQ A;  3I55 F;  2OTL F;  3E20 B;  5LA6 A;  1T0K B;  4M8I A;  1PF5 A;  5AVM A;  1S72 F;  3JAW B;  3F0E A;  4NQ3 A;  3CCJ F;  1ZWZ A;  3JAT B;  5A2Q M;  1CLI A;  3SIV A;  4ZHY B;  4LCK A;  1QAH A;  4RHA A;  2HP0 A;  4C82 A;  1NJI H;  3OW2 F;  2FC3 A;  2ZOV A;  5J2U A;  3V7E A;  4ZK7 A;  3JAM M;  2H6L A;  1VQ5 F;  1YHQ F;  1YI2 F;  4ZI7 B;  1J7H A;  1XV2 A;  5JQG A;  3VCZ A;  1CN7 A;  5EYP B;  3HKC A;  4ZHQ B;  4TV8 A;  3K0T A;  2LBW A;  3VYT C;  5C8Y B;  3C9R A;  4O4I B;  5ITZ B;  1FNJ A;  3JAK B;  5HY2 A;  2CVL A;  3J7A R;  2HX0 A;  4O4L A;  4X1K A;  5HY1 A;  3ZO8 A;  5EIB C;  4PWT A;  3MCQ A;  4XCQ A;  3I3F A; 
#chains in the Genus database with same CATH homology
 3O85 A;  1GO1 A;  3LWO C;  3CCE F;  2OTJ F;  2QA4 F;  3AGK A;  1VQ4 F;  5GAP K;  2ALE A;  2CZW A;  3CPQ A;  5EWR A;  3LWR C;  5HWE A;  1JJ2 F;  1VQ8 F;  3G71 F;  2I6D A;  1W42 A;  3VMF B;  1VQ7 F;  2KG4 A;  2QEX F;  3JCM M;  1RLG A;  1K73 H;  3VI6 A;  3PAF A;  3D00 A;  4BVS A;  5G4U C;  3CXC F;  4X3L A;  3MCA B;  1VQO F;  1GZ0 A;  3CC4 F;  1XBI A;  4BVR A;  1W41 A;  5GAN K;  1K8A H;  2F9Z C;  1W40 A;  3LWP C;  3WXM B;  1RA4 A;  1M90 H;  2OZB A;  1YJW F;  1YJN F;  2AIF A;  2QI2 A;  1X52 A;  2HVY D;  5HY0 A;  5HXU A;  1IPA A;  3CCM F;  3J81 M;  1SDS A;  3NVK E;  2OHW A;  2GLZ A;  3CG6 A;  1VQL F;  1KC8 H;  3V7Q A;  4EI7 A;  5GIO C;  2KTU A;  4EI8 A;  3LFO A;  1VQ9 F;  1K9M H;  3RA6 A;  4BW0 B;  1N8R H;  3NK7 A;  2KTV A;  3CD6 F;  1KD1 H;  1YJ9 F;  3ON1 A;  3CPW F;  3J80 M;  3CCQ F;  3CMA F;  2FGY A;  3CCV F;  1Q81 H;  4EI9 A;  4BVQ A;  3I55 F;  3HAX D;  1VQ6 F;  2OTL F;  3GYQ A;  3E20 B;  1VQK F;  2VGN A;  3CCU F;  1T0K B;  3NVI B;  3PLA C;  5GIP C;  2BO1 A;  3I56 F;  3N4Y A;  3CCR F;  3CME F;  1GO0 A;  2VGM A;  1S72 F;  1YIJ F;  3HJW C;  4TZZ A;  4NQ3 A;  3LWV C;  4NUT A;  3IR9 A;  1VQM F;  3CCJ F;  1ZWZ A;  5G4V C;  3CC2 F;  1NMU B;  5A2Q M;  3SIV A;  1X7O A;  3LWQ C;  4LCK A;  1QVF F;  3RA5 A;  1Q86 H;  3SIU A;  1NJI H;  5GIN C;  1W3E X;  3OW2 F;  5HY4 A;  1CK2 A;  2FC3 A;  5HXZ A;  1X7P A;  1YIT F;  4BVT A;  1QVG F;  3V7E A;  3JAM M;  5FLX M;  1VQP F;  1VQ5 F;  3N4Z A;  1YHQ F;  1YI2 F;  3V3T A;  3NK6 A;  4X3M A;  1W2B F;  1CN7 A;  5FJ4 C;  1Q7Y H;  3OBY A;  3G6E F;  3FFM A;  5IT9 M;  1PXW A;  2LBW A;  1KQS F;  1H7M A;  3OBW A;  5EO3 A;  1M1K H;  3CCL F;  3NMU C;  2WAL A;  3CC7 F;  5HY2 A;  1Q82 H;  3CCS F;  3J7A R;  4BY9 D;  1DT9 A;  3E1Y A;  1VQN F;  5HY1 A;  2LBX A;  5DCV A;  2JNB A;  4XCQ A;  4C4W C;  3G4S F;  1E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...