5GANK

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ganK00
3SIVA 3V7EA 3VMFB 3CMAF 1DT9A 3NK7A 1VQOF 3CC2F 1T0KB 3GYQA 3LWRC 1YI2F 3NMUC 3CCLF 5FJ4C 3CMEF 3CCEF 5G4UC 2WALA 1VQ9F 1GO1A 3SIUA 2QEXF 4X3LA 5GINC 1NMUB 2VGMA 3LWPC 3I56F 3CCVF 3I55F 4X3MA 2KTVA 1CN7A 3FFMA 1Q86H 5EO3A 1VQ7F 1KC8H 3CCUF 1K8AH 1X7PA 1S72F 1YJWF 5GANK 1CK2A 3J80M 1IPAA 5GIOC 1VQ4F 3NVIB 3E20B 1W41A 4TZZA 2LBXA 2QI2A 3CCRF 3HAXD 1RLGA 5GAPK 3J7AR 3G6EF 1YJ9F 1Q81H 1QVGF 3CG6A 1YIJF 3OW2F 3CC4F 1N8RH 1Q7YH 1M1KH 2I6DA 2OTLF 2OZBA 2LBWA 2OTJF 3O85A 2OHWA 1VQ8F 1XBIA 1K9MH 3CPQA 3WXMB 4C4WC 3MCAB 3PLAC 3RA6A 3PAFA 2HVYD 3OBWA 3LWQC 3CD6F 3LFOA 1W40A 1YJNF 1VQKF 2CZWA 1X7OA 5IT9M 1KQSF 2JNBA 1Q82H 3LWOC 1GZ0A 2FC3A 3AGKA 3VI6A 1VQPF 3CC7F 2KG4A 5GIPC 3IR9A 1W3EX 3OBYA 5EWRA 3V7QA 1K73H 1M90H 2KTUA 5FLXM 1JJ2F 1YHQF 1X52A 5DCVA 3N4ZA 3ON1A 4LCKA 4NUTA 3J81M 1SDSA 1VQMF 1E7KA 4BW0B 1GO0A 1YITF 1VQLF 3JAMM 1VQNF 1ZWZA 5G4VC 2VGNA 5A2QM 3HJWC 3E1YA 3CPWF 3NVKE 1VQ6F 2BO1A 3JCMM 3CCMF 2ALEA 1KD1H 2QA4F 3LWVC 1H7MA 1PXWA 1W42A 1RA4A 3G71F 3RA5A 3N4YA 1QVFF 3NK6A 1NJIH 1VQ5F 3CCJF 2AIFA 1W2BF 4BY9D 3CXCF 3CCQF 3G4SF 3CCSF
chains in the Genus database with same CATH superfamily
3RYHB 3VMFB 5LA6A 4BVRA 1VQOF 1T0KB 4KWEA 4B45A 3MDOA 1YI2F 3CCLF 3IKFA 1YQNA 1VQ9F 3SIUA 1JFFA 2IAFA 4X3LA 4BT2A 3GTZA 4X20B 4TV8A 4C8EA 5J2UA 5IJ9B 2VGMA 4B46A 3I56F 2CHTA 3VYSC 4X1IA 3ZO8A 4O4HA 3L7QA 5J2TA 3S0YA 4FFBA 5BMVA 1YJWF 4BVQA 5HY4A 3E20B 1OAPA 4BVTA 5LYJB 4U3JB 4G4ZA 4I55B 1YJ9F 1QVGF 3OW2F 5EYPA 1Q7YH 4O2AB 3D54A 3RE3A 3JAWA 1M1KH 2OTLF 5JCOC 1KNJA 3LMEA 3FBAA 4YJ2A 2UYKA 4G4YA 1PF5A 1W55A 3JAKA 5HY1A 4TUYB 5EB0A 1TVKA 3WJRA 3MCAB 3WXMB 2Q1YA 4RHAA 3RA6A 3PAFA 4DRXA 5HY2A 3LFOA 1W40A 5KMGA 1YJNF 4EB6A 3T80A 3VOBA 3MBMA 1W5BA 4TV9B 4BT3A 4WBNA 2RB9A 3TD5A 2V9YA 3CC7F 3ZP4A 1JD1A 5GIPC 3OBYA 2CSLA 2VXYA 2H8CA 3CYQA 4XCQA 1JJ2F 5HY0A 5KX5A 2K1SA 3N2GB 3B6NA 4I4TB 2HS3A 4O4LA 4X1KB 3RYIA 1VH8A 3JAMM 1VQNF 1W5AA 1ZWZA 2VGNA 2BTOA 5A2QM 3E1YA 3NVKE 4R40B 2Z1TA 1W57A 1VQ6F 4IHJA 5HXUA 4IIJB 5IJ0A 1PXWA 2AIZP 1RA4A 5FNVA 3N4YA 3HKEB 4ZOLA 5IYZA 3HWUA 2ZODA 1H47A 4X1YB 3K2XA 1VQ5F 2AIFA 5CA0B 5B8FA 3U0OA 3CCVF 3WJPA 2VAPA 2Z01A 3SIVA 5CA0A 3NK7A 4PWTA 3WGNA 3I7TA 1Z5WA 3CC2F 3GYQA 2RHOA 4ZOLB 3LWRC 2L26A 4BT5A 2WALA 4ZHWA 5IJ0B 2H6LA 2KGWA 4HNAA 1SA0B 1X25A 3ZP7A 1IV3A 1ONIA 2W8BC 4X3MA 1CN7A 3K0TA 3UT5A 1KC8H 3IEWA 2BTQB 3KHNA 2F9ZC 1S72F 4C82A 2ZAUA 1IPAA 3RYIB 5GIOC 3NVIB 3LYBA 4O2BA 3N2GA 1RLUA 2LBXA 1COMA 2QI2A 3CCRF 3HAXD 2AMTA 5CB4A 5MN4A 3LDTA 4O2BB 3N2KA 1Q8RA 1YIJF 1W5FA 5GONB 5GONA 4B62A 1N8RH 3F0DA 3N2KB 5HP8A 3BYQA 3UT5B 2Q1XA 1R1MA 3IMPA 2Z1FA 4ZI7A 1VHAA 3VCZA 4C4WC 5JH7A 2P6YA 3PLAC 4HNAB 3FD6A 1U40A 3OBWA 2NMUA 1UI9A 3C9UA 3QHDA 3FD5A 5C8YA 4BT4A 3JAKB 2CZWA 5IT9M 4YJ2B 2JNBA 3LWOC 4O2AA 3M4SA 2FC3A 5EYPB 1SA0A 1SZQA 3MQWA 3AGKA 1VQPF 4I55A 3HKDA 4DXDA 3VIUA 1W3EX 2KTUA 3HKDB 5HP7A 1W59A 4LCKA 1QAHA 4NUTA 1U43A 1IV4A 4ZHVA 2LCAA 2DT4A 3KIZA 1E7KA 1SDSA 4BW0B 4X1YA 4M8IA 5IYZB 4FFBB 3HKEA 3HJWC 5C8YB 2IG8A 4O4HB 4X1IB 4ZK7A 3JVHA 2BO1A 2GLZA 3JCMM 2ALEA 5IJ9A 2QA4F 5J2UB 4G4WA 5EB1B 3EORA 1H7MA 5JH7B 4IIJA 3F0FA 2YYEA 1W5EA 4ZI7B 2PMPA 5JCOA 3G71F 1YGYA 3K14A 2GVIA 4BY9D 4X1KA 3ZOPA 3D00A 2MQEA 3S0HA 4I4TA 5ITZB 1ODEA 1DT9A 3WPXA 3CMAF 4G4VA 4EB6B 5KX5B 5CB4B 3WGLA 4BVSA 3CMEF 3CCEF 5G4UC 3D01A 3S03A 1RQ7A 1GO1A 3C8LA 3C9TA 3KE1A 2QEXF 2ZVYA 2HX0A 4ZHYB 3M84A 4C8IA 1TVKB 3LWPC 4TV9A 1H48A 4WBNB 2KTVA 3FFMA 1Q86H 5KMGB 2CW4A 4B5CA 3CCUF 1K8AH 2HRUA 2Z1EA 1X7PA 1XHOA 3JAWB 4DRXB 1CK2A 5EIBD 2FGYA 3P0ZA 3F6MA 1W41A 4TZZA 1DBFA 2HP3A 2UZHA 3ERNA 2RHLA 1VQVA 4TUYA 3M1XA 1RLGA 2UYJA 2CVLA 4NQ3A 2DYYA 3S0WA 3WGKA 1FSZA 2I6DA 4EI9A 5BMVB 2OZBA 5LP6C 3KJJA 3VTIC 5J2TB 5LYJA 3S02A 3QTYA 1VQ8F 4EI8A 5FNVB 1XBIA 1K9MH 3CPQA 3CB2A 1JFFB 2GZLA 4IHJB 1KNKA 3C9RA 1JN1A 3KJKA 1VQKF 4O4IB 1X7OA 3WPWA 2CHSA 3F0GA 3RYHA 2VAWA 4O4LB 2ZOVA 3WJQA 4TV8B 1U3PA 2HQSC 2OTMA 3Q8HA 2LBTA 3DDNA 3P4EA 4E6EA 4I50A 1K73H 5EWRA 1TUBA 2BTUA 3V7QA 2EWCA 5FLXM 5MN6A 1X52A 5DCVA 2ZVZA 3ON1A 1XV2A 3JARB 4BT6A 3J81M 3VOAA 3JATB 1GO0A 5JVDA 5LP6A 5G4VC 1CLIA 3VYTC 1Z5VA 5AVMA 3VO8A 1JY8A 3CPWF 2HRYA 3CCMF 3I3FA 1J7HA 2R6R1 5MN5A 1FNKA 1W42A 2UYNB 1IV2A 3V4DA 3HKBB 3JALA 3WGMA 3RA5A 4C81A 3CCJF 2HS0A 3CXCF 3CCQF 3G4SF 3FPIA 4G88A 3CCSF 2R751 4RQOA 4NWOB 5LOVB 3V7EA 4U3JA 1FNJA 4G4XA 3NMUC 3HKCA 5FJ4C 3GHZA 1UFYA 2N48A 3K12A 1NQ3A 4F6RB 5GINC 1FFXB 1NMUB 4O4JA 3V3TA 3RYFA 2HP0A 2HS4A 1GX1A 3IKEA 3I55F 1QD9A 5EO3A 1VQ7F 2RHHA 3TD3A 5LP6B 2CWJA 4YJ3B 2B33A 5GANK 3J80M 5EAZA 5JQGB 5LXTB 2VAMA 4X20A 3JATA 1VQ4F 3JASB 3E22B 5EZYA 2Z1UA 3WGJA 3OONA 4U39A 1IV1A 4LNUB 1U3LA 1T0AA 1XRGA 1TUBB 4I50B 5GAPK 3C9SA 3TD4A 3J7AR 5LA6B 3F0EA 5EZYB 3G6EF 3E22A 1Q81H 3CG6A 3CC4F 5JQGA 2G9IA 3P10A 4YJ3A 2OTJF 2LBWA 3O85A 2OHWA 2YXZA 4O4IA 1W581 3VYUC 4LNUA 3RYFB 2H8EA 4O4JB 4ZHQA 3JASA 3QUWA 2IQQA 4F6RA 2HVYD 5LXTA 4EI7A 2UYPA 3LWQC 3CD6F 2ZF8A 3RYCB 1KQSF 2RHJA 5CA1B 2HP0B 1Q82H 1GZ0A 1QU9A 1FFXA 1VK3A 3IEQA 3VI6A 2PHNA 3S06A 2KG4A 3IR9A 1M90H 3HKCB 3ELCA 3HKBA 3JALB 1YHQF 5HXZA 2UYNA 3CYPB 3N4ZA 5LOVA 3HTNA 4ERHA 3MCQA 5CA1A 5HWEA 1VQMF 1OFUA 2I6RA 1YITF 1VQLF 3RYCA 1KD1H 3R0PA 3JARA 3LWVC 4ZHQB 3ESJA 1RQ2A 1QVFF 2QTPA 3NK6A 5JVDB 1NJIH 5ITZA 3DC2A 4C8GA 1W2BF 5EIBC 4BT7A
chains in the Genus database with same CATH topology
3SIVA 3V7EA 3VMFB 4BVRA 1DT9A 3NK7A 3CMAF 1VQOF 3CC2F 1T0KB 3GYQA 3LWRC 1YI2F 3NMUC 3CCLF 5FJ4C 4BVSA 3CMEF 3CCEF 5G4UC 2WALA 1VQ9F 1GO1A 3SIUA 2QEXF 4X3LA 5GINC 1NMUB 2VGMA 3LWPC 3V3TA 3I56F 3CCVF 3I55F 4X3MA 2KTVA 1CN7A 3FFMA 3G4SF 1Q86H 5EO3A 1VQ7F 1KC8H 3CCUF 1K8AH 2F9ZC 1X7PA 1S72F 1YJWF 4BVQA 1CK2A 5GANK 1IPAA 3J80M 2FGYA 5HY4A 5GIOC 1VQ4F 3NVIB 3E20B 1W41A 4TZZA 2LBXA 2QI2A 3CCRF 3HAXD 4BVTA 1RLGA 5GAPK 3J7AR 4NQ3A 3G6EF 1YJ9F 1Q81H 1QVGF 3CG6A 1YIJF 3OW2F 3CC4F 1N8RH 1Q7YH 1M1KH 2I6DA 4EI9A 2OTLF 2OZBA 2LBWA 2OTJF 3O85A 2OHWA 1VQ8F 4EI8A 5HY1A 1XBIA 1K9MH 3CPQA 3WXMB 4C4WC 3MCAB 3PLAC 3RA6A 3PAFA 2HVYD 3OBWA 4EI7A 5HY2A 3LWQC 3CD6F 3LFOA 1W40A 1YJNF 1VQKF 2CZWA 1X7OA 5IT9M 1KQSF 2JNBA 1Q82H 3LWOC 1GZ0A 2FC3A 3AGKA 3VI6A 1VQPF 3CC7F 2KG4A 5GIPC 3IR9A 1W3EX 3OBYA 5EWRA 3V7QA 1K73H 1M90H 2KTUA 4XCQA 5FLXM 1YHQF 1X52A 5HXZA 1JJ2F 5DCVA 3N4ZA 5HY0A 3ON1A 4LCKA 4NUTA 3J81M 1SDSA 1VQMF 5HWEA 4BW0B 1E7KA 1GO0A 1YITF 1VQLF 3JAMM 1VQNF 1ZWZA 5G4VC 2VGNA 5A2QM 3HJWC 3E1YA 3CPWF 3NVKE 1VQ6F 2BO1A 2GLZA 3JCMM 5HXUA 3CCMF 2ALEA 1KD1H 2QA4F 3LWVC 1H7MA 1PXWA 1W42A 1RA4A 3G71F 3RA5A 3N4YA 1QVFF 3NK6A 1NJIH 1VQ5F 3CCJF 2AIFA 1W2BF 4BY9D 3CXCF 3CCQF 3D00A 3CCSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIV A;  3V7E A;  3VMF B;  3CMA F;  1DT9 A;  3NK7 A;  1VQO F;  3CC2 F;  1T0K B;  3GYQ A;  3LWR C;  1YI2 F;  3NMU C;  3CCL F;  5FJ4 C;  3CME F;  3CCE F;  5G4U C;  2WAL A;  1VQ9 F;  1GO1 A;  3SIU A;  2QEX F;  4X3L A;  5GIN C;  1NMU B;  2VGM A;  3LWP C;  3I56 F;  3CCV F;  3I55 F;  4X3M A;  2KTV A;  1CN7 A;  3FFM A;  1Q86 H;  5EO3 A;  1VQ7 F;  1KC8 H;  3CCU F;  1K8A H;  1X7P A;  1S72 F;  1YJW F;  5GAN K;  1CK2 A;  3J80 M;  1IPA A;  5GIO C;  1VQ4 F;  3NVI B;  3E20 B;  1W41 A;  4TZZ A;  2LBX A;  2QI2 A;  3CCR F;  3HAX D;  1RLG A;  5GAP K;  3J7A R;  3G6E F;  1YJ9 F;  1Q81 H;  1QVG F;  3CG6 A;  1YIJ F;  3OW2 F;  3CC4 F;  1N8R H;  1Q7Y H;  1M1K H;  2I6D A;  2OTL F;  2OZB A;  2LBW A;  2OTJ F;  3O85 A;  2OHW A;  1VQ8 F;  1XBI A;  1K9M H;  3CPQ A;  3WXM B;  4C4W C;  3MCA B;  3PLA C;  3RA6 A;  3PAF A;  2HVY D;  3OBW A;  3LWQ C;  3CD6 F;  3LFO A;  1W40 A;  1YJN F;  1VQK F;  2CZW A;  1X7O A;  5IT9 M;  1KQS F;  2JNB A;  1Q82 H;  3LWO C;  1GZ0 A;  2FC3 A;  3AGK A;  3VI6 A;  1VQP F;  3CC7 F;  2KG4 A;  5GIP C;  3IR9 A;  1W3E X;  3OBY A;  5EWR A;  3V7Q A;  1K73 H;  1M90 H;  2KTU A;  5FLX M;  1JJ2 F;  1YHQ F;  1X52 A;  5DCV A;  3N4Z A;  3ON1 A;  4LCK A;  4NUT A;  3J81 M;  1SDS A;  1VQM F;  1E7K A;  4BW0 B;  1GO0 A;  1YIT F;  1VQL F;  3JAM M;  1VQN F;  1ZWZ A;  5G4V C;  2VGN A;  5A2Q M;  3HJW C;  3E1Y A;  3CPW F;  3NVK E;  1VQ6 F;  2BO1 A;  3JCM M;  3CCM F;  2ALE A;  1KD1 H;  2QA4 F;  3LWV C;  1H7M A;  1PXW A;  1W42 A;  1RA4 A;  3G71 F;  3RA5 A;  3N4Y A;  1QVF F;  3NK6 A;  1NJI H;  1VQ5 F;  3CCJ F;  2AIF A;  1W2B F;  4BY9 D;  3CXC F;  3CCQ F;  3G4S F;  3CCS F; 
#chains in the Genus database with same CATH topology
 3RYH B;  3VMF B;  5LA6 A;  4BVR A;  1VQO F;  1T0K B;  4KWE A;  4B45 A;  3MDO A;  1YI2 F;  3CCL F;  3IKF A;  1YQN A;  1VQ9 F;  3SIU A;  1JFF A;  2IAF A;  4X3L A;  4BT2 A;  3GTZ A;  4X20 B;  4TV8 A;  4C8E A;  5J2U A;  5IJ9 B;  2VGM A;  4B46 A;  3I56 F;  2CHT A;  3VYS C;  4X1I A;  3ZO8 A;  4O4H A;  3L7Q A;  5J2T A;  3S0Y A;  4FFB A;  5BMV A;  1YJW F;  4BVQ A;  5HY4 A;  3E20 B;  1OAP A;  4BVT A;  5LYJ B;  4U3J B;  4G4Z A;  4I55 B;  1YJ9 F;  1QVG F;  3OW2 F;  5EYP A;  1Q7Y H;  4O2A B;  3D54 A;  3RE3 A;  3JAW A;  1M1K H;  2OTL F;  5JCO C;  1KNJ A;  3LME A;  3FBA A;  4YJ2 A;  2UYK A;  4G4Y A;  1PF5 A;  1W55 A;  3JAK A;  5HY1 A;  4TUY B;  5EB0 A;  1TVK A;  3WJR A;  3MCA B;  3WXM B;  2Q1Y A;  4RHA A;  3RA6 A;  3PAF A;  4DRX A;  5HY2 A;  3LFO A;  1W40 A;  5KMG A;  1YJN F;  4EB6 A;  3T80 A;  3VOB A;  3MBM A;  1W5B A;  4TV9 B;  4BT3 A;  4WBN A;  2RB9 A;  3TD5 A;  2V9Y A;  3CC7 F;  3ZP4 A;  1JD1 A;  5GIP C;  3OBY A;  2CSL A;  2VXY A;  2H8C A;  3CYQ A;  4XCQ A;  1JJ2 F;  5HY0 A;  5KX5 A;  2K1S A;  3N2G B;  3B6N A;  4I4T B;  2HS3 A;  4O4L A;  4X1K B;  3RYI A;  1VH8 A;  3JAM M;  1VQN F;  1W5A A;  1ZWZ A;  2VGN A;  2BTO A;  5A2Q M;  3E1Y A;  3NVK E;  4R40 B;  2Z1T A;  1W57 A;  1VQ6 F;  4IHJ A;  5HXU A;  4IIJ B;  5IJ0 A;  1PXW A;  2AIZ P;  1RA4 A;  5FNV A;  3N4Y A;  3HKE B;  4ZOL A;  5IYZ A;  3HWU A;  2ZOD A;  1H47 A;  4X1Y B;  3K2X A;  1VQ5 F;  2AIF A;  5CA0 B;  5B8F A;  3U0O A;  3CCV F;  3WJP A;  2VAP A;  2Z01 A;  3SIV A;  5CA0 A;  3NK7 A;  4PWT A;  3WGN A;  3I7T A;  1Z5W A;  3CC2 F;  3GYQ A;  2RHO A;  4ZOL B;  3LWR C;  2L26 A;  4BT5 A;  2WAL A;  4ZHW A;  5IJ0 B;  2H6L A;  2KGW A;  4HNA A;  1SA0 B;  1X25 A;  3ZP7 A;  1IV3 A;  1ONI A;  2W8B C;  4X3M A;  1CN7 A;  3K0T A;  3UT5 A;  1KC8 H;  3IEW A;  2BTQ B;  3KHN A;  2F9Z C;  1S72 F;  4C82 A;  2ZAU A;  1IPA A;  3RYI B;  5GIO C;  3NVI B;  3LYB A;  4O2B A;  3N2G A;  1RLU A;  2LBX A;  1COM A;  2QI2 A;  3CCR F;  3HAX D;  2AMT A;  5CB4 A;  5MN4 A;  3LDT A;  4O2B B;  3N2K A;  1Q8R A;  1YIJ F;  1W5F A;  5GON B;  5GON A;  4B62 A;  1N8R H;  3F0D A;  3N2K B;  5HP8 A;  3BYQ A;  3UT5 B;  2Q1X A;  1R1M A;  3IMP A;  2Z1F A;  4ZI7 A;  1VHA A;  3VCZ A;  4C4W C;  5JH7 A;  2P6Y A;  3PLA C;  4HNA B;  3FD6 A;  1U40 A;  3OBW A;  2NMU A;  1UI9 A;  3C9U A;  3QHD A;  3FD5 A;  5C8Y A;  4BT4 A;  3JAK B;  2CZW A;  5IT9 M;  4YJ2 B;  2JNB A;  3LWO C;  4O2A A;  3M4S A;  2FC3 A;  5EYP B;  1SA0 A;  1SZQ A;  3MQW A;  3AGK A;  1VQP F;  4I55 A;  3HKD A;  4DXD A;  3VIU A;  1W3E X;  2KTU A;  3HKD B;  5HP7 A;  1W59 A;  4LCK A;  1QAH A;  4NUT A;  1U43 A;  1IV4 A;  4ZHV A;  2LCA A;  2DT4 A;  3KIZ A;  1E7K A;  1SDS A;  4BW0 B;  4X1Y A;  4M8I A;  5IYZ B;  4FFB B;  3HKE A;  3HJW C;  5C8Y B;  2IG8 A;  4O4H B;  4X1I B;  4ZK7 A;  3JVH A;  2BO1 A;  2GLZ A;  3JCM M;  2ALE A;  5IJ9 A;  2QA4 F;  5J2U B;  4G4W A;  5EB1 B;  3EOR A;  1H7M A;  5JH7 B;  4IIJ A;  3F0F A;  2YYE A;  1W5E A;  4ZI7 B;  2PMP A;  5JCO A;  3G71 F;  1YGY A;  3K14 A;  2GVI A;  4BY9 D;  4X1K A;  3ZOP A;  3D00 A;  2MQE A;  3S0H A;  4I4T A;  5ITZ B;  1ODE A;  1DT9 A;  3WPX A;  3CMA F;  4G4V A;  4EB6 B;  5KX5 B;  5CB4 B;  3WGL A;  4BVS A;  3CME F;  3CCE F;  5G4U C;  3D01 A;  3S03 A;  1RQ7 A;  1GO1 A;  3C8L A;  3C9T A;  3KE1 A;  2QEX F;  2ZVY A;  2HX0 A;  4ZHY B;  3M84 A;  4C8I A;  1TVK B;  3LWP C;  4TV9 A;  1H48 A;  4WBN B;  2KTV A;  3FFM A;  1Q86 H;  5KMG B;  2CW4 A;  4B5C A;  3CCU F;  1K8A H;  2HRU A;  2Z1E A;  1X7P A;  1XHO A;  3JAW B;  4DRX B;  1CK2 A;  5EIB D;  2FGY A;  3P0Z A;  3F6M A;  1W41 A;  4TZZ A;  1DBF A;  2HP3 A;  2UZH A;  3ERN A;  2RHL A;  1VQV A;  4TUY A;  3M1X A;  1RLG A;  2UYJ A;  2CVL A;  4NQ3 A;  2DYY A;  3S0W A;  3WGK A;  1FSZ A;  2I6D A;  4EI9 A;  5BMV B;  2OZB A;  5LP6 C;  3KJJ A;  3VTI C;  5J2T B;  5LYJ A;  3S02 A;  3QTY A;  1VQ8 F;  4EI8 A;  5FNV B;  1XBI A;  1K9M H;  3CPQ A;  3CB2 A;  1JFF B;  2GZL A;  4IHJ B;  1KNK A;  3C9R A;  1JN1 A;  3KJK A;  1VQK F;  4O4I B;  1X7O A;  3WPW A;  2CHS A;  3F0G A;  3RYH A;  2VAW A;  4O4L B;  2ZOV A;  3WJQ A;  4TV8 B;  1U3P A;  2HQS C;  2OTM A;  3Q8H A;  2LBT A;  3DDN A;  3P4E A;  4E6E A;  4I50 A;  1K73 H;  5EWR A;  1TUB A;  2BTU A;  3V7Q A;  2EWC A;  5FLX M;  5MN6 A;  1X52 A;  5DCV A;  2ZVZ A;  3ON1 A;  1XV2 A;  3JAR B;  4BT6 A;  3J81 M;  3VOA A;  3JAT B;  1GO0 A;  5JVD A;  5LP6 A;  5G4V C;  1CLI A;  3VYT C;  1Z5V A;  5AVM A;  3VO8 A;  1JY8 A;  3CPW F;  2HRY A;  3CCM F;  3I3F A;  1J7H A;  2R6R 1;  5MN5 A;  1FNK A;  1W42 A;  2UYN B;  1IV2 A;  3V4D A;  3HKB B;  3JAL A;  3WGM A;  3RA5 A;  4C81 A;  3CCJ F;  2HS0 A;  3CXC F;  3CCQ F;  3G4S F;  3FPI A;  4G88 A;  3CCS F;  2R75 1;  4RQO A;  4NWO B;  5LOV B;  3V7E A;  4U3J A;  1FNJ A;  4G4X A;  3NMU C;  3HKC A;  5FJ4 C;  3GHZ A;  1UFY A;  2N48 A;  3K12 A;  1NQ3 A;  4F6R B;  5GIN C;  1FFX B;  1NMU B;  4O4J A;  3V3T A;  3RYF A;  2HP0 A;  2HS4 A;  1GX1 A;  3IKE A;  3I55 F;  1QD9 A;  5EO3 A;  1VQ7 F;  2RHH A;  3TD3 A;  5LP6 B;  2CWJ A;  4YJ3 B;  2B33 A;  5GAN K;  3J80 M;  5EAZ A;  5JQG B;  5LXT B;  2VAM A;  4X20 A;  3JAT A;  1VQ4 F;  3JAS B;  3E22 B;  5EZY A;  2Z1U A;  3WGJ A;  3OON A;  4U39 A;  1IV1 A;  4LNU B;  1U3L A;  1T0A A;  1XRG A;  1TUB B;  4I50 B;  5GAP K;  3C9S A;  3TD4 A;  3J7A R;  5LA6 B;  3F0E A;  5EZY B;  3G6E F;  3E22 A;  1Q81 H;  3CG6 A;  3CC4 F;  5JQG A;  2G9I A;  3P10 A;  4YJ3 A;  2OTJ F;  2LBW A;  3O85 A;  2OHW A;  2YXZ A;  4O4I A;  1W58 1;  3VYU C;  4LNU A;  3RYF B;  2H8E A;  4O4J B;  4ZHQ A;  3JAS A;  3QUW A;  2IQQ A;  4F6R A;  2HVY D;  5LXT A;  4EI7 A;  2UYP A;  3LWQ C;  3CD6 F;  2ZF8 A;  3RYC B;  1KQS F;  2RHJ A;  5CA1 B;  2HP0 B;  1Q82 H;  1GZ0 A;  1QU9 A;  1FFX A;  1VK3 A;  3IEQ A;  3VI6 A;  2PHN A;  3S06 A;  2KG4 A;  3IR9 A;  1M90 H;  3HKC B;  3ELC A;  3HKB A;  3JAL B;  1YHQ F;  5HXZ A;  2UYN A;  3CYP B;  3N4Z A;  5LOV A;  3HTN A;  4ERH A;  3MCQ A;  5CA1 A;  5HWE A;  1VQM F;  1OFU A;  2I6R A;  1YIT F;  1VQL F;  3RYC A;  1KD1 H;  3R0P A;  3JAR A;  3LWV C;  4ZHQ B;  3ESJ A;  1RQ2 A;  1QVF F;  2QTP A;  3NK6 A;  5JVD B;  1NJI H;  5ITZ A;  3DC2 A;  4C8G A;  1W2B F;  5EIB C;  4BT7 A; 
#chains in the Genus database with same CATH homology
 3SIV A;  3V7E A;  3VMF B;  4BVR A;  1DT9 A;  3NK7 A;  3CMA F;  1VQO F;  3CC2 F;  1T0K B;  3GYQ A;  3LWR C;  1YI2 F;  3NMU C;  3CCL F;  5FJ4 C;  4BVS A;  3CME F;  3CCE F;  5G4U C;  2WAL A;  1VQ9 F;  1GO1 A;  3SIU A;  2QEX F;  4X3L A;  5GIN C;  1NMU B;  2VGM A;  3LWP C;  3V3T A;  3I56 F;  3CCV F;  3I55 F;  4X3M A;  2KTV A;  1CN7 A;  3FFM A;  3G4S F;  1Q86 H;  5EO3 A;  1VQ7 F;  1KC8 H;  3CCU F;  1K8A H;  2F9Z C;  1X7P A;  1S72 F;  1YJW F;  4BVQ A;  1CK2 A;  5GAN K;  1IPA A;  3J80 M;  2FGY A;  5HY4 A;  5GIO C;  1VQ4 F;  3NVI B;  3E20 B;  1W41 A;  4TZZ A;  2LBX A;  2QI2 A;  3CCR F;  3HAX D;  4BVT A;  1RLG A;  5GAP K;  3J7A R;  4NQ3 A;  3G6E F;  1YJ9 F;  1Q81 H;  1QVG F;  3CG6 A;  1YIJ F;  3OW2 F;  3CC4 F;  1N8R H;  1Q7Y H;  1M1K H;  2I6D A;  4EI9 A;  2OTL F;  2OZB A;  2LBW A;  2OTJ F;  3O85 A;  2OHW A;  1VQ8 F;  4EI8 A;  5HY1 A;  1XBI A;  1K9M H;  3CPQ A;  3WXM B;  4C4W C;  3MCA B;  3PLA C;  3RA6 A;  3PAF A;  2HVY D;  3OBW A;  4EI7 A;  5HY2 A;  3LWQ C;  3CD6 F;  3LFO A;  1W40 A;  1YJN F;  1VQK F;  2CZW A;  1X7O A;  5IT9 M;  1KQS F;  2JNB A;  1Q82 H;  3LWO C;  1GZ0 A;  2FC3 A;  3AGK A;  3VI6 A;  1VQP F;  3CC7 F;  2KG4 A;  5GIP C;  3IR9 A;  1W3E X;  3OBY A;  5EWR A;  3V7Q A;  1K73 H;  1M90 H;  2KTU A;  4XCQ A;  5FLX M;  1YHQ F;  1X52 A;  5HXZ A;  1JJ2 F;  5DCV A;  3N4Z A;  5HY0 A;  3ON1 A;  4LCK A;  4NUT A;  3J81 M;  1SDS A;  1VQM F;  5HWE A;  4BW0 B;  1E7K A;  1GO0 A;  1YIT F;  1VQL F;  3JAM M;  1VQN F;  1ZWZ A;  5G4V C;  2VGN A;  5A2Q M;  3HJW C;  3E1Y A;  3CPW F;  3NVK E;  1VQ6 F;  2BO1 A;  2GLZ A;  3JCM M;  5HXU A;  3CCM F;  2ALE A;  1KD1 H;  2QA4 F;  3LWV C;  1H7M A;  1PXW A;  1W42 A;  1RA4 A;  3G71 F;  3RA5 A;  3N4Y A;  1QVF F;  3NK6 A;  1NJI H;  1VQ5 F;  3CCJ F;  2AIF A;  1W2B F;  4BY9 D;  3CXC F;  3CCQ F;  3D00 A;  3CCS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...