5GANK

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ganK00
2FC3A 1VQ6F 5FLXM 3SIVA 2KG4A 3V7QA 1H7MA 3PAFA 3CCUF 1W40A 2AIFA 3RA5A 3J81M 1VQOF 1NJIH 1YJ9F 2ALEA 2QA4F 5DCVA 4X3LA 3E1YA 1QVGF 3G6EF 1VQ7F 4TZZA 1Q82H 1XBIA 1Q86H 1W3EX 3CC4F 3I56F 3HAXD 3GYQA 3VI6A 1M90H 1K73H 2KTVA 3N4YA 3CCRF 3LWVC 2LBXA 1VQ8F 4X3MA 5FJ4C 1Q7YH 1GO1A 3O85A 2WALA 2I6DA 5G4VC 1YITF 1PXWA 1S72F 5EO3A 4BW0B 1X7PA 1VQ4F 1QVFF 3CD6F 3OBWA 1VQMF 1CK2A 5GIOC 2KTUA 2OHWA 5GANK 1M1KH 1IPAA 1W41A 2JNBA 3N4ZA 1W42A 3VMFB 1W2BF 3CCQF 3CCVF 3RA6A 3G71F 3FFMA 3CXCF 3ON1A 1YJNF 1ZWZA 4NUTA 5A2QM 3PLAC 5EWRA 2CZWA 3WXMB 3CPWF 1VQPF 2OZBA 3OBYA 3CC2F 3J80M 3JCMM 3NK7A 1RA4A 2OTJF 1SDSA 1KD1H 1VQNF 2QEXF 1N8RH 1NMUB 3V7EA 3LFOA 1T0KB 3SIUA 3CCSF 3AGKA 3NK6A 3CMEF 1X7OA 3CPQA 3JAMM 1KC8H 2BO1A 1K9MH 3J7AR 3CCMF 3CG6A 1YHQF 1GZ0A 3LWOC 1CN7A 3I55F 1VQ9F 3IR9A 4LCKA 1JJ2F 3CC7F 3LWRC 3CCLF 1E7KA 1DT9A 1X52A 1RLGA 2VGNA 3E20B 1Q81H 3NVKE 5GINC 1YI2F 3CMAF 2QI2A 3OW2F 3G4SF 2VGMA 1GO0A 3CCJF 5GAPK 1VQLF 2OTLF 5IT9M 3HJWC 3LWQC 5G4UC 3CCEF 1VQ5F 2HVYD 3MCAB 1K8AH 4C4WC 4BY9D 3LWPC 3NMUC 2LBWA 1YIJF 1YJWF 3NVIB 5GIPC 1KQSF 1VQKF
chains in the Genus database with same CATH superfamily
5CB4A 1VQ6F 5LA6A 3D00A 3ESJA 2HP0B 2AIFA 2Z1EA 3QTYA 3RE3A 1VQOF 5HP8A 4M8IA 1W5FA 1YJ9F 4NQ3A 4LNUB 1QVGF 4TV9A 4C8GA 1Q82H 5IJ0B 1XBIA 4BVSA 4O4JA 3HAXD 4O2BA 1FFXA 1K73H 2H6LA 4C8IA 2LCAA 4TUYA 3CCRF 2EWCA 4TV8B 4X3MA 5LXTA 3VYUC 3JATB 1GO1A 3GTZA 5IYZA 1FNKA 4DRXA 3E22B 2WALA 4I4TB 2OTMA 1YGYA 3K2XA 1XV2A 4BW0B 1X7PA 4IHJA 3RYIB 3P0ZA 3B6NA 3HKEB 5HY0A 3KJKA 2OHWA 1M1KH 1W41A 2UYPA 5JVDA 5JCOC 3GHZA 3MCQA 3LMEA 3LDTA 2YXZA 5C8YA 1T0AA 3CXCF 2RHOA 3ON1A 4X1YA 4NUTA 5LOVB 2UYJA 5HXZA 3S06A 1IV2A 4HNAA 4G4VA 3ELCA 1JY8A 2OTJF 1SDSA 4ZHQB 3JARB 3K12A 3VTIC 1JFFB 5KMGB 2QEXF 5BMVA 3V7EA 1T0KB 3D54A 5KX5A 3AGKA 4FFBB 2BTOA 5JH7B 3C8LA 4ZOLA 1COMA 2I6RA 4NWOB 1K9MH 3C9TA 3FD5A 3CG6A 5MN5A 3V3TA 1YHQF 5CA1A 4C81A 5IJ9A 4LCKA 4C82A 3JAWB 5EYPB 2L26A 5J2UA 3M4SA 3K0TA 4O2AA 4X20A 3VOAA 3F6MA 3JASB 3G4SF 4BVTA 1XHOA 3CCJF 2UYNB 3S0WA 3MBMA 2OTLF 2VXYA 3Q8HA 5JQGB 2GVIA 3IKFA 4X1IA 2MQEA 3HKBA 5G4UC 1SZQA 4YJ3B 2ZVZA 4YJ2B 4C4WC 3NMUC 2LBWA 1DBFA 1YIJF 3JAKB 4F6RB 5GIPC 5FLXM 2IAFA 3UT5B 4U39A 5HXUA 3CCUF 4I55A 4B62A 5GONA 3RA5A 1NJIH 2ALEA 5EIBD 5DCVA 3S0HA 5LP6A 1W5AA 3RYFB 5FNVA 3G6EF 4TZZA 3JALA 1U40A 1Q86H 3K14A 2HS0A 3N4YA 3LWVC 1TUBB 2LBXA 1H48A 5FJ4C 3O85A 2IG8A 1PXWA 1Z5WA 1S72F 1UFYA 2CW4A 4EI9A 3CD6F 2HQSC 4ZHYB 2BTUA 4KWEA 4I50B 1CK2A 3C9SA 2KTUA 1FNJA 4EI8A 1UI9A 4EB6A 2UYKA 1ONIA 3N4ZA 4BT5A 5IT9M 3VMFB 4BVQA 1W2BF 3CCQF 4G4WA 3HKDA 3CCVF 4PWTA 4TUYB 4E6EA 4O4LA 1Z5VA 3F0DA 3IKEA 5HY1A 3RYCA 4WBNA 1YJNF 3PLAC 3FPIA 2CZWA 4O4IB 5ITZA 3CPWF 4U3JA 3OBYA 3J80M 3BYQA 3JCMM 3NK7A 1RA4A 3FD6A 5EZYB 3QHDA 1KD1H 2HP0A 1W5EA 3SIUA 1NQ3A 1VH8A 2P6YA 2F9ZC 3CMEF 1YQNA 3CPQA 4LNUA 2DYYA 3DC2A 5AVMA 2RHHA 3DDNA 5IJ0A 5MN6A 1U3PA 2H8CA 5B8FA 1RQ2A 3IEWA 1E7KA 1DT9A 4R40B 3NVKE 3VO8A 4TV8A 1TVKB 2VAMA 3CMAF 2PMPA 3JATA 3E22A 4I4TA 3ZOPA 4EI7A 3V4DA 4X1KB 1XRGA 1GO0A 3RYIA 5GAPK 3HKEA 2CHSA 3N2GB 3WPXA 4BT3A 2CVLA 2CWJA 4BT2A 4BVRA 5EB0A 3WJRA 3JVHA 5CA0B 3HJWC 4BT7A 3I7TA 1VQ5F 2Z1UA 2RHJA 1K8AH 1KNKA 3F0FA 1YJWF 5EAZA 3CB2A 1CLIA 2N48A 2ZVYA 5LOVA 2H8EA 1H7MA 2R6R1 3HKCB 3I3FA 4ZHQA 3F0EA 3JARA 1JFFA 5KMGA 3VOBA 1FSZA 4FFBA 1X25A 5JH7A 3F0GA 3CC4F 2ZAUA 3U0OA 3QUWA 3VI6A 1M90H 2KTVA 3KIZA 5HY2A 1W57A 5LP6C 1VQ8F 2Z01A 4ERHA 4IIJB 2Z1TA 3VIUA 3WGJA 3JAWA 5LYJB 1SA0B 5EYPA 3CYPB 3RYHB 5J2TB 3FBAA 5G4VC 1R1MA 3VCZA 4O4HB 4C8EA 1VQMF 2ZF8A 3JALB 1JD1A 5GIOC 3JASA 2UZHA 4ZI7B 2UYNA 3KJJA 4B5CA 3ERNA 1VQVA 5JQGA 1H47A 3N2KB 3FFMA 3IMPA 5CB4B 2VAPA 5LA6B 4YJ3A 5A2QM 5EWRA 1Q8RA 3WXMB 4YJ2A 4ZHVA 2K1SA 4RHAA 3T80A 3JAKA 4F6RA 2LBTA 2W8BC 3CC2F 3UT5A 3M1XA 2GLZA 2CSLA 4TV9B 1NMUB 5EIBC 3LFOA 1J7HA 4O4JB 5EB1B 3JAMM 4G88A 3RYFA 4O2BB 1FFXB 1W5BA 3ZP7A 1GZ0A 3LWOC 1VQ9F 3IR9A 2HRUA 3HWUA 3M84A 3WGKA 5LXTB 2RB9A 5IYZB 3LWRC 4DRXB 1X52A 1RLGA 3S02A 3E20B 1TUBA 5HY4A 4IHJB 1KNJA 2HP3A 2GZLA 2HRYA 3HTNA 1VQLF 5JVDB 4I50A 2IQQA 3WPWA 2HX0A 3P4EA 2Q1XA 3LWQC 1QAHA 5C8YB 3CCEF 2KGWA 4X1YB 3WJQA 3P10A 4BY9D 1ODEA 3VYSC 2V9YA 4G4YA 5HWEA 1KQSF 1VQKF 2FC3A 3SIVA 4HNAB 3ZO8A 2DT4A 2KG4A 4O4IA 3V7QA 3ZP4A 3PAFA 1W40A 5BMVB 5KX5B 3J81M 3MDOA 5EZYA 1QD9A 2QA4F 4X3LA 4ZOLB 3E1YA 1U3LA 1JN1A 4XCQA 1VQ7F 3WGNA 1W3EX 1PF5A 5CA1B 3I56F 5IJ9B 2BTQB 1W59A 3GYQA 3TD3A 3TD5A 4DXDA 2ZODA 3IEQA 1Q7YH 5J2UB 4RQOA 2YYEA 1RQ7A 4O2AB 1IV3A 1U43A 2I6DA 2PHNA 4X20B 5JCOA 1YITF 5EO3A 1TVKA 4B45A 1VQ4F 1QVFF 1OAPA 3OBWA 1VK3A 2VAWA 2NMUA 1RLUA 4X1KA 5GANK 1IPAA 4X1IB 2JNBA 1W42A 3HKBB 2RHLA 3VYTC 1IV1A 3N2GA 3TD4A 4BT4A 5CA0A 3RA6A 2FGYA 3G71F 3OONA 1ZWZA 2B33A 2Q1YA 4G4XA 3CYQA 1W55A 2QTPA 5HP7A 3S03A 4I55B 1VQPF 2OZBA 3C9RA 5GONB 5LP6B 1VQNF 1N8RH 5FNVB 2CHTA 3CCSF 3NK6A 1GX1A 3HKCA 1X7OA 5MN4A 3S0YA 2AMTA 1KC8H 2AIZP 2BO1A 2G9IA 3J7AR 3CCMF 1VHAA 4G4ZA 1CN7A 3I55F 3WJPA 1JJ2F 3CC7F 2HS3A 3R0PA 3C9UA 3CCLF 2VGNA 1Q81H 5GINC 2HS4A 1YI2F 3KE1A 4IIJA 4B46A 2QI2A 3LYBA 5LYJA 1SA0A 3RYHA 5J2TA 3WGLA 3OW2F 2VGMA 4EB6B 4ZK7A 2ZOVA 2Z1FA 3KHNA 4O4HA 1QU9A 3HKDB 1W581 3D01A 4O4LB 4ZHWA 3EORA 3MQWA 3RYCB 4ZI7A 2HVYD 3MCAB 1IV4A 4WBNB 3WGMA 4BT6A 3LWPC 2R751 5ITZB 3N2KA 3NVIB 1OFUA 4U3JB 3L7QA
chains in the Genus database with same CATH topology
2FC3A 1VQ6F 5FLXM 3SIVA 2KG4A 3D00A 3V7QA 1H7MA 3PAFA 5HXUA 3CCUF 1W40A 2AIFA 3RA5A 3J81M 1VQOF 1NJIH 1YJ9F 2ALEA 2QA4F 5DCVA 4X3LA 4NQ3A 3E1YA 4XCQA 1QVGF 3G6EF 1VQ7F 4TZZA 1Q82H 1XBIA 4BVSA 1Q86H 1W3EX 3CC4F 3I56F 3HAXD 3GYQA 3VI6A 1M90H 1K73H 2KTVA 3N4YA 3CCRF 3LWVC 5HY2A 2LBXA 1VQ8F 4X3MA 5FJ4C 1Q7YH 1GO1A 3O85A 2WALA 2I6DA 5G4VC 1YITF 1PXWA 1S72F 5EO3A 4BW0B 1X7PA 4EI9A 1VQ4F 1QVFF 3CD6F 3OBWA 1VQMF 1CK2A 5HY0A 5GIOC 2KTUA 4EI8A 2OHWA 5GANK 1M1KH 1IPAA 1W41A 2JNBA 3N4ZA 1W42A 3VMFB 4BVQA 1W2BF 3CCQF 3CCVF 3RA6A 2FGYA 3G71F 5HY1A 3FFMA 3CXCF 3ON1A 1YJNF 1ZWZA 4NUTA 5A2QM 3PLAC 5EWRA 2CZWA 3WXMB 3CPWF 5HXZA 1VQPF 2OZBA 3OBYA 3CC2F 3J80M 3JCMM 3NK7A 1RA4A 2OTJF 1SDSA 1KD1H 2GLZA 1VQNF 2QEXF 1N8RH 1NMUB 3V7EA 3LFOA 1T0KB 3SIUA 2F9ZC 3CCSF 3AGKA 3NK6A 3CMEF 1X7OA 3CPQA 3JAMM 1KC8H 2BO1A 1K9MH 3J7AR 3CCMF 3CG6A 1YHQF 3V3TA 1GZ0A 3LWOC 1CN7A 3I55F 1VQ9F 3IR9A 4LCKA 1JJ2F 3CC7F 3LWRC 3CCLF 1E7KA 1DT9A 1X52A 1RLGA 2VGNA 3E20B 1Q81H 3NVKE 5GINC 1YI2F 3CMAF 5HY4A 2QI2A 4EI7A 3OW2F 3G4SF 2VGMA 4BVTA 1GO0A 3CCJF 5GAPK 1VQLF 2OTLF 4BVRA 5IT9M 3HJWC 3LWQC 5G4UC 3CCEF 1VQ5F 2HVYD 3MCAB 1K8AH 4C4WC 4BY9D 3LWPC 3NMUC 2LBWA 1YIJF 1YJWF 5HWEA 3NVIB 5GIPC 1KQSF 1VQKF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FC3 A;  1VQ6 F;  5FLX M;  3SIV A;  2KG4 A;  3V7Q A;  1H7M A;  3PAF A;  3CCU F;  1W40 A;  2AIF A;  3RA5 A;  3J81 M;  1VQO F;  1NJI H;  1YJ9 F;  2ALE A;  2QA4 F;  5DCV A;  4X3L A;  3E1Y A;  1QVG F;  3G6E F;  1VQ7 F;  4TZZ A;  1Q82 H;  1XBI A;  1Q86 H;  1W3E X;  3CC4 F;  3I56 F;  3HAX D;  3GYQ A;  3VI6 A;  1M90 H;  1K73 H;  2KTV A;  3N4Y A;  3CCR F;  3LWV C;  2LBX A;  1VQ8 F;  4X3M A;  5FJ4 C;  1Q7Y H;  1GO1 A;  3O85 A;  2WAL A;  2I6D A;  5G4V C;  1YIT F;  1PXW A;  1S72 F;  5EO3 A;  4BW0 B;  1X7P A;  1VQ4 F;  1QVF F;  3CD6 F;  3OBW A;  1VQM F;  1CK2 A;  5GIO C;  2KTU A;  2OHW A;  5GAN K;  1M1K H;  1IPA A;  1W41 A;  2JNB A;  3N4Z A;  1W42 A;  3VMF B;  1W2B F;  3CCQ F;  3CCV F;  3RA6 A;  3G71 F;  3FFM A;  3CXC F;  3ON1 A;  1YJN F;  1ZWZ A;  4NUT A;  5A2Q M;  3PLA C;  5EWR A;  2CZW A;  3WXM B;  3CPW F;  1VQP F;  2OZB A;  3OBY A;  3CC2 F;  3J80 M;  3JCM M;  3NK7 A;  1RA4 A;  2OTJ F;  1SDS A;  1KD1 H;  1VQN F;  2QEX F;  1N8R H;  1NMU B;  3V7E A;  3LFO A;  1T0K B;  3SIU A;  3CCS F;  3AGK A;  3NK6 A;  3CME F;  1X7O A;  3CPQ A;  3JAM M;  1KC8 H;  2BO1 A;  1K9M H;  3J7A R;  3CCM F;  3CG6 A;  1YHQ F;  1GZ0 A;  3LWO C;  1CN7 A;  3I55 F;  1VQ9 F;  3IR9 A;  4LCK A;  1JJ2 F;  3CC7 F;  3LWR C;  3CCL F;  1E7K A;  1DT9 A;  1X52 A;  1RLG A;  2VGN A;  3E20 B;  1Q81 H;  3NVK E;  5GIN C;  1YI2 F;  3CMA F;  2QI2 A;  3OW2 F;  3G4S F;  2VGM A;  1GO0 A;  3CCJ F;  5GAP K;  1VQL F;  2OTL F;  5IT9 M;  3HJW C;  3LWQ C;  5G4U C;  3CCE F;  1VQ5 F;  2HVY D;  3MCA B;  1K8A H;  4C4W C;  4BY9 D;  3LWP C;  3NMU C;  2LBW A;  1YIJ F;  1YJW F;  3NVI B;  5GIP C;  1KQS F;  1VQK F; 
#chains in the Genus database with same CATH topology
 5CB4 A;  1VQ6 F;  5LA6 A;  3D00 A;  3ESJ A;  2HP0 B;  2AIF A;  2Z1E A;  3QTY A;  3RE3 A;  1VQO F;  5HP8 A;  4M8I A;  1W5F A;  1YJ9 F;  4NQ3 A;  4LNU B;  1QVG F;  4TV9 A;  4C8G A;  1Q82 H;  5IJ0 B;  1XBI A;  4BVS A;  4O4J A;  3HAX D;  4O2B A;  1FFX A;  1K73 H;  2H6L A;  4C8I A;  2LCA A;  4TUY A;  3CCR F;  2EWC A;  4TV8 B;  4X3M A;  5LXT A;  3VYU C;  3JAT B;  1GO1 A;  3GTZ A;  5IYZ A;  1FNK A;  4DRX A;  3E22 B;  2WAL A;  4I4T B;  2OTM A;  1YGY A;  3K2X A;  1XV2 A;  4BW0 B;  1X7P A;  4IHJ A;  3RYI B;  3P0Z A;  3B6N A;  3HKE B;  5HY0 A;  3KJK A;  2OHW A;  1M1K H;  1W41 A;  2UYP A;  5JVD A;  5JCO C;  3GHZ A;  3MCQ A;  3LME A;  3LDT A;  2YXZ A;  5C8Y A;  1T0A A;  3CXC F;  2RHO A;  3ON1 A;  4X1Y A;  4NUT A;  5LOV B;  2UYJ A;  5HXZ A;  3S06 A;  1IV2 A;  4HNA A;  4G4V A;  3ELC A;  1JY8 A;  2OTJ F;  1SDS A;  4ZHQ B;  3JAR B;  3K12 A;  3VTI C;  1JFF B;  5KMG B;  2QEX F;  5BMV A;  3V7E A;  1T0K B;  3D54 A;  5KX5 A;  3AGK A;  4FFB B;  2BTO A;  5JH7 B;  3C8L A;  4ZOL A;  1COM A;  2I6R A;  4NWO B;  1K9M H;  3C9T A;  3FD5 A;  3CG6 A;  5MN5 A;  3V3T A;  1YHQ F;  5CA1 A;  4C81 A;  5IJ9 A;  4LCK A;  4C82 A;  3JAW B;  5EYP B;  2L26 A;  5J2U A;  3M4S A;  3K0T A;  4O2A A;  4X20 A;  3VOA A;  3F6M A;  3JAS B;  3G4S F;  4BVT A;  1XHO A;  3CCJ F;  2UYN B;  3S0W A;  3MBM A;  2OTL F;  2VXY A;  3Q8H A;  5JQG B;  2GVI A;  3IKF A;  4X1I A;  2MQE A;  3HKB A;  5G4U C;  1SZQ A;  4YJ3 B;  2ZVZ A;  4YJ2 B;  4C4W C;  3NMU C;  2LBW A;  1DBF A;  1YIJ F;  3JAK B;  4F6R B;  5GIP C;  5FLX M;  2IAF A;  3UT5 B;  4U39 A;  5HXU A;  3CCU F;  4I55 A;  4B62 A;  5GON A;  3RA5 A;  1NJI H;  2ALE A;  5EIB D;  5DCV A;  3S0H A;  5LP6 A;  1W5A A;  3RYF B;  5FNV A;  3G6E F;  4TZZ A;  3JAL A;  1U40 A;  1Q86 H;  3K14 A;  2HS0 A;  3N4Y A;  3LWV C;  1TUB B;  2LBX A;  1H48 A;  5FJ4 C;  3O85 A;  2IG8 A;  1PXW A;  1Z5W A;  1S72 F;  1UFY A;  2CW4 A;  4EI9 A;  3CD6 F;  2HQS C;  4ZHY B;  2BTU A;  4KWE A;  4I50 B;  1CK2 A;  3C9S A;  2KTU A;  1FNJ A;  4EI8 A;  1UI9 A;  4EB6 A;  2UYK A;  1ONI A;  3N4Z A;  4BT5 A;  5IT9 M;  3VMF B;  4BVQ A;  1W2B F;  3CCQ F;  4G4W A;  3HKD A;  3CCV F;  4PWT A;  4TUY B;  4E6E A;  4O4L A;  1Z5V A;  3F0D A;  3IKE A;  5HY1 A;  3RYC A;  4WBN A;  1YJN F;  3PLA C;  3FPI A;  2CZW A;  4O4I B;  5ITZ A;  3CPW F;  4U3J A;  3OBY A;  3J80 M;  3BYQ A;  3JCM M;  3NK7 A;  1RA4 A;  3FD6 A;  5EZY B;  3QHD A;  1KD1 H;  2HP0 A;  1W5E A;  3SIU A;  1NQ3 A;  1VH8 A;  2P6Y A;  2F9Z C;  3CME F;  1YQN A;  3CPQ A;  4LNU A;  2DYY A;  3DC2 A;  5AVM A;  2RHH A;  3DDN A;  5IJ0 A;  5MN6 A;  1U3P A;  2H8C A;  5B8F A;  1RQ2 A;  3IEW A;  1E7K A;  1DT9 A;  4R40 B;  3NVK E;  3VO8 A;  4TV8 A;  1TVK B;  2VAM A;  3CMA F;  2PMP A;  3JAT A;  3E22 A;  4I4T A;  3ZOP A;  4EI7 A;  3V4D A;  4X1K B;  1XRG A;  1GO0 A;  3RYI A;  5GAP K;  3HKE A;  2CHS A;  3N2G B;  3WPX A;  4BT3 A;  2CVL A;  2CWJ A;  4BT2 A;  4BVR A;  5EB0 A;  3WJR A;  3JVH A;  5CA0 B;  3HJW C;  4BT7 A;  3I7T A;  1VQ5 F;  2Z1U A;  2RHJ A;  1K8A H;  1KNK A;  3F0F A;  1YJW F;  5EAZ A;  3CB2 A;  1CLI A;  2N48 A;  2ZVY A;  5LOV A;  2H8E A;  1H7M A;  2R6R 1;  3HKC B;  3I3F A;  4ZHQ A;  3F0E A;  3JAR A;  1JFF A;  5KMG A;  3VOB A;  1FSZ A;  4FFB A;  1X25 A;  5JH7 A;  3F0G A;  3CC4 F;  2ZAU A;  3U0O A;  3QUW A;  3VI6 A;  1M90 H;  2KTV A;  3KIZ A;  5HY2 A;  1W57 A;  5LP6 C;  1VQ8 F;  2Z01 A;  4ERH A;  4IIJ B;  2Z1T A;  3VIU A;  3WGJ A;  3JAW A;  5LYJ B;  1SA0 B;  5EYP A;  3CYP B;  3RYH B;  5J2T B;  3FBA A;  5G4V C;  1R1M A;  3VCZ A;  4O4H B;  4C8E A;  1VQM F;  2ZF8 A;  3JAL B;  1JD1 A;  5GIO C;  3JAS A;  2UZH A;  4ZI7 B;  2UYN A;  3KJJ A;  4B5C A;  3ERN A;  1VQV A;  5JQG A;  1H47 A;  3N2K B;  3FFM A;  3IMP A;  5CB4 B;  2VAP A;  5LA6 B;  4YJ3 A;  5A2Q M;  5EWR A;  1Q8R A;  3WXM B;  4YJ2 A;  4ZHV A;  2K1S A;  4RHA A;  3T80 A;  3JAK A;  4F6R A;  2LBT A;  2W8B C;  3CC2 F;  3UT5 A;  3M1X A;  2GLZ A;  2CSL A;  4TV9 B;  1NMU B;  5EIB C;  3LFO A;  1J7H A;  4O4J B;  5EB1 B;  3JAM M;  4G88 A;  3RYF A;  4O2B B;  1FFX B;  1W5B A;  3ZP7 A;  1GZ0 A;  3LWO C;  1VQ9 F;  3IR9 A;  2HRU A;  3HWU A;  3M84 A;  3WGK A;  5LXT B;  2RB9 A;  5IYZ B;  3LWR C;  4DRX B;  1X52 A;  1RLG A;  3S02 A;  3E20 B;  1TUB A;  5HY4 A;  4IHJ B;  1KNJ A;  2HP3 A;  2GZL A;  2HRY A;  3HTN A;  1VQL F;  5JVD B;  4I50 A;  2IQQ A;  3WPW A;  2HX0 A;  3P4E A;  2Q1X A;  3LWQ C;  1QAH A;  5C8Y B;  3CCE F;  2KGW A;  4X1Y B;  3WJQ A;  3P10 A;  4BY9 D;  1ODE A;  3VYS C;  2V9Y A;  4G4Y A;  5HWE A;  1KQS F;  1VQK F;  2FC3 A;  3SIV A;  4HNA B;  3ZO8 A;  2DT4 A;  2KG4 A;  4O4I A;  3V7Q A;  3ZP4 A;  3PAF A;  1W40 A;  5BMV B;  5KX5 B;  3J81 M;  3MDO A;  5EZY A;  1QD9 A;  2QA4 F;  4X3L A;  4ZOL B;  3E1Y A;  1U3L A;  1JN1 A;  4XCQ A;  1VQ7 F;  3WGN A;  1W3E X;  1PF5 A;  5CA1 B;  3I56 F;  5IJ9 B;  2BTQ B;  1W59 A;  3GYQ A;  3TD3 A;  3TD5 A;  4DXD A;  2ZOD A;  3IEQ A;  1Q7Y H;  5J2U B;  4RQO A;  2YYE A;  1RQ7 A;  4O2A B;  1IV3 A;  1U43 A;  2I6D A;  2PHN A;  4X20 B;  5JCO A;  1YIT F;  5EO3 A;  1TVK A;  4B45 A;  1VQ4 F;  1QVF F;  1OAP A;  3OBW A;  1VK3 A;  2VAW A;  2NMU A;  1RLU A;  4X1K A;  5GAN K;  1IPA A;  4X1I B;  2JNB A;  1W42 A;  3HKB B;  2RHL A;  3VYT C;  1IV1 A;  3N2G A;  3TD4 A;  4BT4 A;  5CA0 A;  3RA6 A;  2FGY A;  3G71 F;  3OON A;  1ZWZ A;  2B33 A;  2Q1Y A;  4G4X A;  3CYQ A;  1W55 A;  2QTP A;  5HP7 A;  3S03 A;  4I55 B;  1VQP F;  2OZB A;  3C9R A;  5GON B;  5LP6 B;  1VQN F;  1N8R H;  5FNV B;  2CHT A;  3CCS F;  3NK6 A;  1GX1 A;  3HKC A;  1X7O A;  5MN4 A;  3S0Y A;  2AMT A;  1KC8 H;  2AIZ P;  2BO1 A;  2G9I A;  3J7A R;  3CCM F;  1VHA A;  4G4Z A;  1CN7 A;  3I55 F;  3WJP A;  1JJ2 F;  3CC7 F;  2HS3 A;  3R0P A;  3C9U A;  3CCL F;  2VGN A;  1Q81 H;  5GIN C;  2HS4 A;  1YI2 F;  3KE1 A;  4IIJ A;  4B46 A;  2QI2 A;  3LYB A;  5LYJ A;  1SA0 A;  3RYH A;  5J2T A;  3WGL A;  3OW2 F;  2VGM A;  4EB6 B;  4ZK7 A;  2ZOV A;  2Z1F A;  3KHN A;  4O4H A;  1QU9 A;  3HKD B;  1W58 1;  3D01 A;  4O4L B;  4ZHW A;  3EOR A;  3MQW A;  3RYC B;  4ZI7 A;  2HVY D;  3MCA B;  1IV4 A;  4WBN B;  3WGM A;  4BT6 A;  3LWP C;  2R75 1;  5ITZ B;  3N2K A;  3NVI B;  1OFU A;  4U3J B;  3L7Q A; 
#chains in the Genus database with same CATH homology
 2FC3 A;  1VQ6 F;  5FLX M;  3SIV A;  2KG4 A;  3D00 A;  3V7Q A;  1H7M A;  3PAF A;  5HXU A;  3CCU F;  1W40 A;  2AIF A;  3RA5 A;  3J81 M;  1VQO F;  1NJI H;  1YJ9 F;  2ALE A;  2QA4 F;  5DCV A;  4X3L A;  4NQ3 A;  3E1Y A;  4XCQ A;  1QVG F;  3G6E F;  1VQ7 F;  4TZZ A;  1Q82 H;  1XBI A;  4BVS A;  1Q86 H;  1W3E X;  3CC4 F;  3I56 F;  3HAX D;  3GYQ A;  3VI6 A;  1M90 H;  1K73 H;  2KTV A;  3N4Y A;  3CCR F;  3LWV C;  5HY2 A;  2LBX A;  1VQ8 F;  4X3M A;  5FJ4 C;  1Q7Y H;  1GO1 A;  3O85 A;  2WAL A;  2I6D A;  5G4V C;  1YIT F;  1PXW A;  1S72 F;  5EO3 A;  4BW0 B;  1X7P A;  4EI9 A;  1VQ4 F;  1QVF F;  3CD6 F;  3OBW A;  1VQM F;  1CK2 A;  5HY0 A;  5GIO C;  2KTU A;  4EI8 A;  2OHW A;  5GAN K;  1M1K H;  1IPA A;  1W41 A;  2JNB A;  3N4Z A;  1W42 A;  3VMF B;  4BVQ A;  1W2B F;  3CCQ F;  3CCV F;  3RA6 A;  2FGY A;  3G71 F;  5HY1 A;  3FFM A;  3CXC F;  3ON1 A;  1YJN F;  1ZWZ A;  4NUT A;  5A2Q M;  3PLA C;  5EWR A;  2CZW A;  3WXM B;  3CPW F;  5HXZ A;  1VQP F;  2OZB A;  3OBY A;  3CC2 F;  3J80 M;  3JCM M;  3NK7 A;  1RA4 A;  2OTJ F;  1SDS A;  1KD1 H;  2GLZ A;  1VQN F;  2QEX F;  1N8R H;  1NMU B;  3V7E A;  3LFO A;  1T0K B;  3SIU A;  2F9Z C;  3CCS F;  3AGK A;  3NK6 A;  3CME F;  1X7O A;  3CPQ A;  3JAM M;  1KC8 H;  2BO1 A;  1K9M H;  3J7A R;  3CCM F;  3CG6 A;  1YHQ F;  3V3T A;  1GZ0 A;  3LWO C;  1CN7 A;  3I55 F;  1VQ9 F;  3IR9 A;  4LCK A;  1JJ2 F;  3CC7 F;  3LWR C;  3CCL F;  1E7K A;  1DT9 A;  1X52 A;  1RLG A;  2VGN A;  3E20 B;  1Q81 H;  3NVK E;  5GIN C;  1YI2 F;  3CMA F;  5HY4 A;  2QI2 A;  4EI7 A;  3OW2 F;  3G4S F;  2VGM A;  4BVT A;  1GO0 A;  3CCJ F;  5GAP K;  1VQL F;  2OTL F;  4BVR A;  5IT9 M;  3HJW C;  3LWQ C;  5G4U C;  3CCE F;  1VQ5 F;  2HVY D;  3MCA B;  1K8A H;  4C4W C;  4BY9 D;  3LWP C;  3NMU C;  2LBW A;  1YIJ F;  1YJW F;  5HWE A;  3NVI B;  5GIP C;  1KQS F;  1VQK F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...