5GANK

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
b'APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ganK00
1YJ9F 1QVGF 3PLAC 3G4SF 4TZZA 5EWRA 3WXMB 1K8AH 4C4WC 5G4UC 4BW0B 2LBWA 2QA4F 1Q82H 1XBIA 1CN7A 1GO0A 3LWVC 1E7KA 1KC8H 3CCRF 4LCKA 1M90H 2KTUA 1ZWZA 1VQ6F 3LWRC 3SIUA 3CPWF 2ALEA 3SIVA 1PXWA 1JJ2F 1KQSF 1RLGA 2KG4A 3VMFB 3CCVF 3CMEF 3V7QA 4X3MA 3OBYA 4X3LA 1VQOF 1W41A 3I56F 3NVKE 2BO1A 1W2BF 1KD1H 1VQ5F 5DCVA 2AIFA 1X52A 3CCSF 3J80M 1IPAA 1W40A 2LBXA 1VQMF 3G71F 1YITF 3LWOC 2I6DA 3J81M 1SDSA 3O85A 2CZWA 3CCEF 1GO1A 5G4VC 2VGMA 3NK7A 2HVYD 1N8RH 3RA5A 3CCJF 3CD6F 2JNBA 1QVFF 3OBWA 3NVIB 3LWPC 1YHQF 4BY9D 5IT9M 1Q81H 2OZBA 3CC4F 1S72F 3RA6A 5A2QM 3NMUC 2KTVA 1NMUB 2OTLF 1M1KH 1K9MH 1T0KB 3OW2F 3VI6A 3MCAB 1VQNF 5EO3A 1YI2F 3E20B 1VQ4F 3ON1A 3CMAF 1K73H 3I55F 3LWQC 1VQLF 3JCMM 3N4ZA 2OHWA 3PAFA 1NJIH 1Q7YH 1YJWF 1DT9A 3E1YA 1VQ9F 3CC7F 1W42A 3CXCF 1VQPF 2FC3A 5FLXM 3CCMF 2OTJF 3CC2F 3HAXD 1VQ7F 3NK6A 1YIJF 4NUTA 3GYQA 1VQKF 1GZ0A 2QI2A 1H7MA 5GIPC 3CCLF 1YJNF 1W3EX 3LFOA 5GANK 3V7EA 3FFMA 2VGNA 2QEXF 1X7OA 3CPQA 3J7AR 1VQ8F 1RA4A 3CG6A 3AGKA 5FJ4C 5GINC 3N4YA 3CCUF 2WALA 5GAPK 3HJWC 5GIOC 3JAMM 3CCQF 3IR9A 1CK2A 1X7PA 3G6EF 1Q86H
chains in the Genus database with same CATH superfamily
5LP6B 4R40B 3G4SF 1JFFA 1TUBB 5EYPA 4BW0B 3WJRA 2LBWA 4X20A 2CSLA 3GHZA 1KC8H 4LCKA 3WGMA 1SA0B 3KIZA 3SIUA 5J2UA 4ZI7B 2ALEA 3SIVA 1FNKA 1JJ2F 1FFXB 5LOVA 1SA0A 3I3FA 5LP6C 1FNJA 5IYZB 5IJ0B 1CLIA 3I56F 1FFXA 1KD1H 4U3JB 1VQ5F 1KNKA 4WBNB 1VHAA 5IYZA 3HKEA 3I7TA 1W40A 5CA1A 2LBXA 3V3TA 3K12A 3LWOC 2H8EA 4U3JA 3RYIB 5KX5A 3JARA 1TVKA 2HP0B 2CZWA 4LNUB 1RQ7A 5G4VC 3D00A 3RYHB 3GTZA 1W5AA 3HTNA 1N8RH 3RA5A 4BT5A 3CCJF 2JNBA 1H48A 1SZQA 5EB1B 5C8YB 3LWPC 5J2TA 1YHQF 1Q81H 4LNUA 3CC4F 1S72F 4O4LB 2EWCA 3S02A 4XCQA 4G4ZA 3MDOA 1M1KH 4PWTA 4O4HB 1VQNF 2BTOA 5HY2A 1YI2F 3CMAF 3B6NA 5MN4A 3M4SA 3QHDA 3RYFB 4EI8A 1K73H 3LWQC 3VO8A 3ZO8A 3N4ZA 4G4XA 2VAMA 3F6MA 5MN5A 3JATB 4TUYA 3C8LA 5CA0A 3E1YA 3RYFA 3ESJA 4C82A 1QD9A 2CW4A 1W5EA 3NK6A 5HY0A 2HRUA 3E22B 2UYPA 3GYQA 4ZHQB 1VQKF 1GZ0A 2Z1FA 2ZAUA 3JAWB 1H7MA 5ITZB 4BT2A 3CCLF 3CYPB 5EAZA 4BT6A 2GLZA 3P4EA 3WJPA 3JAWA 3RYCB 5ITZA 2HS3A 2PHNA 1X7OA 4BVQA 1DBFA 1VQ8F 1Z5WA 3TD3A 5HXZA 3M1XA 1IV2A 3LDTA 3JAKB 3TD4A 2Z1EA 2WALA 2MQEA 4O4IB 3VOAA 4ZK7A 5JCOC 5JQGA 2VAPA 3CCQF 1NQ3A 1YJ9F 3JALB 4TZZA 3WXMB 4YJ3B 5G4UC 2QA4F 2GZLA 5CB4B 1CN7A 3JVHA 1E7KA 3CCRF 1M90H 1J7HA 4YJ3A 2KTUA 3UT5B 2RB9A 1U3LA 4I55A 4BT3A 3ZP4A 4IHJA 4C81A 5CB4A 3ERNA 1KQSF 3N2KB 2Z1UA 4EI9A 4I50B 3VMFB 3CMEF 4X1YB 4X3MA 5LYJA 4X1IB 5HY4A 3KJKA 5MN6A 2BO1A 1W2BF 5DCVA 2AIFA 4I50A 3J80M 4X1YA 3VYUC 3WJQA 4X1IA 1XV2A 5FNVA 5GONB 3G71F 4RQOA 4YJ2B 5EB0A 1YITF 5LP6A 3C9UA 1YQNA 3J81M 1GO1A 1Z5VA 3HKDB 1TUBA 2VGMA 1JN1A 3NK7A 4G4WA 4HNAB 5IJ9B 1W55A 2LBTA 3MCQA 4G4YA 3S06A 5IT9M 3QUWA 1FSZA 3KJJA 2H8CA 2ZF8A 2KTVA 4ZI7A 1K9MH 3K14A 3IEWA 2R6R1 3VI6A 4O2AB 3WGLA 4F6RB 2RHJA 5HP7A 3E20B 5EZYB 2OTMA 2YYEA 4B46A 4M8IA 5IJ0A 1UFYA 3I55F 1VQLF 2P6YA 3LYBA 3PAFA 4F6RA 4WBNA 3IEQA 1IV1A 2N48A 1VQ9F 3CC7F 1VQPF 1VK3A 1ODEA 2FC3A 1COMA 2OTJF 3CC2F 4ZHWA 3RYIA 1YIJF 2HP0A 1W5FA 2HQSC 3F0EA 4EI7A 3RYHA 1QU9A 3MQWA 3S0WA 2CVLA 5C8YA 3LFOA 5GANK 3K2XA 1VQVA 4O4LA 3DC2A 2QEXF 2IG8A 4G4VA 5LXTB 2Q1XA 3BYQA 3C9RA 4O4HA 3FBAA 2CHTA 3AGKA 2CHSA 5GINC 3FPIA 5BMVB 1Q8RA 3HJWC 2W8BC 3JAMM 2KGWA 3JATA 3V4DA 1Q86H 3PLAC 3RE3A 2BTQB 5EWRA 1YGYA 4B5CA 2DYYA 1XBIA 3E22A 4TV8B 5JCOA 4O2BB 4ZHQA 2I6RA 3C9SA 2ZODA 3LWRC 2CWJA 3S0YA 3CPWF 4TV8A 4EB6B 4O2BA 1OAPA 3TD5A 3RYCA 2F9ZC 2FGYA 3VOBA 1T0AA 2KG4A 3WPWA 1RLGA 1VH8A 4X3LA 1VQOF 3JAKA 3VYTC 5AVMA 3NVKE 4X1KB 1XRGA 4O4IA 4O4JB 1X52A 3ZP7A 3CCSF 1U40A 3F0DA 1IPAA 2ZOVA 1VQMF 3JALA 4O4JA 1SDSA 3O85A 3FD5A 2HVYD 3Q8HA 3T80A 3M84A 3HKBB 3L7QA 3OBWA 5JH7B 3S0HA 3WGKA 3VIUA 4ERHA 4RHAA 3UT5A 3HKBA 2AMTA 1W581 2L26A 2Q1YA 4B45A 4C8IA 3N2KA 3MCAB 3WPXA 5EO3A 1VQ4F 3ELCA 1W5BA 3ON1A 1IV4A 4FFBB 4C8EA 2UZHA 5B8FA 5HWEA 2YXZA 1NJIH 1Q7YH 5LA6B 5KMGB 2BTUA 1DT9A 1QAHA 3CXCF 3P0ZA 5FLXM 3CCMF 5GONA 5EYPB 4YJ2A 2H6LA 2VAWA 3KE1A 4X20B 3HKDA 5LA6A 1R1MA 4HNAA 2HX0A 5IJ9A 4I4TB 1YJNF 3HKCB 3V7EA 4TV9B 5J2UB 3JASB 4B62A 4I4TA 5LOVB 3CPQA 3HKCA 1KNJA 4O2AA 4TV9A 2LCAA 3CG6A 3JASA 4BVTA 5EZYA 2HP3A 5EIBC 3LMEA 3F0GA 4IIJB 5FJ4C 3N4YA 4DRXB 5HY1A 5GAPK 2RHHA 3IR9A 3HKEB 5CA1B 4E6EA 4IIJA 1QVGF 1W59A 5KX5B 4DRXA 1TVKB 3JARB 1K8AH 4C4WC 1JY8A 3U0OA 3R0PA 1W57A 1Q82H 4C8GA 1GO0A 4G88A 1OFUA 2RHOA 2QTPA 5J2TB 2ZVZA 3LWVC 1ZWZA 1VQ6F 2GVIA 2HS4A 2IQQA 2IAFA 1U43A 1PXWA 5LXTA 5HP8A 3IMPA 4NWOB 2PMPA 5KMGA 4KWEA 2UYKA 3CCVF 3V7QA 3OBYA 2ZVYA 1W41A 5BMVA 4ZHYB 4TUYB 2UYJA 5CA0B 2G9IA 4BVSA 2I6DA 3VCZA 3CCEF 3IKFA 1H47A 3HWUA 3CD6F 1QVFF 4DXDA 3NVIB 2R751 3N2GB 2VXYA 4BY9D 2OZBA 1GX1A 2RHLA 3DDNA 3MBMA 3RA6A 5A2QM 3NMUC 3D54A 4ZOLB 1NMUB 2OTLF 4EB6A 1T0KB 3N2GA 3OW2F 3C9TA 2Z01A 5HXUA 1IV3A 2DT4A 1ONIA 4BVRA 2HRYA 3IKEA 3D01A 3OONA 4ZOLA 5JVDB 1RLUA 3CB2A 4BT4A 3JCMM 3VYSC 2OHWA 5JQGB 3QTYA 2K1SA 4X1KA 3KHNA 1JD1A 3WGNA 3P10A 5JVDA 1YJWF 1W42A 4NQ3A 4U39A 2HS0A 3HAXD 1VQ7F 2NMUA 2Z1TA 3ZOPA 4NUTA 3S03A 2V9YA 2UYNB 2QI2A 3F0FA 5GIPC 1W3EX 5JH7A 3FFMA 2VGNA 3K0TA 4I55B 1PF5A 4IHJB 1XHOA 3VTIC 2UYNA 4ZHVA 1X25A 2AIZP 3J7AR 1RA4A 3FD6A 4BT7A 3CYQA 5LYJB 2B33A 5EIBD 4FFBA 3CCUF 1JFFB 5GIOC 3WGJA 1U3PA 1CK2A 3EORA 1RQ2A 1X7PA 3G6EF 1UI9A 5FNVB
chains in the Genus database with same CATH topology
1YJ9F 1QVGF 3PLAC 3G4SF 4TZZA 5EWRA 3WXMB 1K8AH 4C4WC 5G4UC 4BW0B 2LBWA 2QA4F 1Q82H 1XBIA 1CN7A 1GO0A 3LWVC 1E7KA 1KC8H 3CCRF 4LCKA 1M90H 2KTUA 1ZWZA 1VQ6F 3LWRC 3SIUA 3CPWF 2ALEA 3SIVA 1PXWA 1JJ2F 1KQSF 4EI9A 2F9ZC 2FGYA 1RLGA 2KG4A 3VMFB 3CCVF 3CMEF 3V7QA 4X3MA 3OBYA 5HY4A 4X3LA 1VQOF 1W41A 3I56F 3NVKE 2BO1A 1W2BF 1KD1H 1VQ5F 5DCVA 2AIFA 1X52A 3CCSF 3J80M 1IPAA 4BVSA 1W40A 2LBXA 1VQMF 3G71F 1YITF 3V3TA 3LWOC 2I6DA 3J81M 1SDSA 3O85A 2CZWA 3CCEF 1GO1A 5G4VC 2VGMA 3D00A 3NK7A 2HVYD 1N8RH 3RA5A 3CCJF 3CD6F 2JNBA 1QVFF 3OBWA 3NVIB 3LWPC 1YHQF 4BY9D 5IT9M 1Q81H 2OZBA 3CC4F 1S72F 3RA6A 5A2QM 3NMUC 2KTVA 1NMUB 4XCQA 2OTLF 1M1KH 1K9MH 1T0KB 3OW2F 5HXUA 3VI6A 3MCAB 1VQNF 5EO3A 5HY2A 4BVRA 1YI2F 3E20B 1VQ4F 3ON1A 3CMAF 1K73H 4EI8A 3I55F 3LWQC 1VQLF 3JCMM 3N4ZA 2OHWA 5HWEA 3PAFA 1NJIH 1Q7YH 1YJWF 1DT9A 3E1YA 1VQ9F 3CC7F 1W42A 3CXCF 1VQPF 4NQ3A 2FC3A 5FLXM 3CCMF 2OTJF 3CC2F 3HAXD 1VQ7F 3NK6A 5HY0A 1YIJF 4EI7A 4NUTA 3GYQA 1VQKF 1GZ0A 2QI2A 1H7MA 5GIPC 3CCLF 1YJNF 1W3EX 3LFOA 5GANK 3V7EA 3FFMA 2VGNA 2GLZA 2QEXF 4BVQA 1X7OA 3CPQA 3J7AR 1VQ8F 1RA4A 5HXZA 3CG6A 4BVTA 3AGKA 5FJ4C 5GINC 3N4YA 3CCUF 2WALA 5HY1A 5GAPK 3HJWC 5GIOC 3JAMM 3CCQF 3IR9A 1CK2A 1X7PA 3G6EF 1Q86H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 F;  1QVG F;  3PLA C;  3G4S F;  4TZZ A;  5EWR A;  3WXM B;  1K8A H;  4C4W C;  5G4U C;  4BW0 B;  2LBW A;  2QA4 F;  1Q82 H;  1XBI A;  1CN7 A;  1GO0 A;  3LWV C;  1E7K A;  1KC8 H;  3CCR F;  4LCK A;  1M90 H;  2KTU A;  1ZWZ A;  1VQ6 F;  3LWR C;  3SIU A;  3CPW F;  2ALE A;  3SIV A;  1PXW A;  1JJ2 F;  1KQS F;  1RLG A;  2KG4 A;  3VMF B;  3CCV F;  3CME F;  3V7Q A;  4X3M A;  3OBY A;  4X3L A;  1VQO F;  1W41 A;  3I56 F;  3NVK E;  2BO1 A;  1W2B F;  1KD1 H;  1VQ5 F;  5DCV A;  2AIF A;  1X52 A;  3CCS F;  3J80 M;  1IPA A;  1W40 A;  2LBX A;  1VQM F;  3G71 F;  1YIT F;  3LWO C;  2I6D A;  3J81 M;  1SDS A;  3O85 A;  2CZW A;  3CCE F;  1GO1 A;  5G4V C;  2VGM A;  3NK7 A;  2HVY D;  1N8R H;  3RA5 A;  3CCJ F;  3CD6 F;  2JNB A;  1QVF F;  3OBW A;  3NVI B;  3LWP C;  1YHQ F;  4BY9 D;  5IT9 M;  1Q81 H;  2OZB A;  3CC4 F;  1S72 F;  3RA6 A;  5A2Q M;  3NMU C;  2KTV A;  1NMU B;  2OTL F;  1M1K H;  1K9M H;  1T0K B;  3OW2 F;  3VI6 A;  3MCA B;  1VQN F;  5EO3 A;  1YI2 F;  3E20 B;  1VQ4 F;  3ON1 A;  3CMA F;  1K73 H;  3I55 F;  3LWQ C;  1VQL F;  3JCM M;  3N4Z A;  2OHW A;  3PAF A;  1NJI H;  1Q7Y H;  1YJW F;  1DT9 A;  3E1Y A;  1VQ9 F;  3CC7 F;  1W42 A;  3CXC F;  1VQP F;  2FC3 A;  5FLX M;  3CCM F;  2OTJ F;  3CC2 F;  3HAX D;  1VQ7 F;  3NK6 A;  1YIJ F;  4NUT A;  3GYQ A;  1VQK F;  1GZ0 A;  2QI2 A;  1H7M A;  5GIP C;  3CCL F;  1YJN F;  1W3E X;  3LFO A;  5GAN K;  3V7E A;  3FFM A;  2VGN A;  2QEX F;  1X7O A;  3CPQ A;  3J7A R;  1VQ8 F;  1RA4 A;  3CG6 A;  3AGK A;  5FJ4 C;  5GIN C;  3N4Y A;  3CCU F;  2WAL A;  5GAP K;  3HJW C;  5GIO C;  3JAM M;  3CCQ F;  3IR9 A;  1CK2 A;  1X7P A;  3G6E F;  1Q86 H; 
#chains in the Genus database with same CATH topology
 5LP6 B;  4R40 B;  3G4S F;  1JFF A;  1TUB B;  5EYP A;  4BW0 B;  3WJR A;  2LBW A;  4X20 A;  2CSL A;  3GHZ A;  1KC8 H;  4LCK A;  3WGM A;  1SA0 B;  3KIZ A;  3SIU A;  5J2U A;  4ZI7 B;  2ALE A;  3SIV A;  1FNK A;  1JJ2 F;  1FFX B;  5LOV A;  1SA0 A;  3I3F A;  5LP6 C;  1FNJ A;  5IYZ B;  5IJ0 B;  1CLI A;  3I56 F;  1FFX A;  1KD1 H;  4U3J B;  1VQ5 F;  1KNK A;  4WBN B;  1VHA A;  5IYZ A;  3HKE A;  3I7T A;  1W40 A;  5CA1 A;  2LBX A;  3V3T A;  3K12 A;  3LWO C;  2H8E A;  4U3J A;  3RYI B;  5KX5 A;  3JAR A;  1TVK A;  2HP0 B;  2CZW A;  4LNU B;  1RQ7 A;  5G4V C;  3D00 A;  3RYH B;  3GTZ A;  1W5A A;  3HTN A;  1N8R H;  3RA5 A;  4BT5 A;  3CCJ F;  2JNB A;  1H48 A;  1SZQ A;  5EB1 B;  5C8Y B;  3LWP C;  5J2T A;  1YHQ F;  1Q81 H;  4LNU A;  3CC4 F;  1S72 F;  4O4L B;  2EWC A;  3S02 A;  4XCQ A;  4G4Z A;  3MDO A;  1M1K H;  4PWT A;  4O4H B;  1VQN F;  2BTO A;  5HY2 A;  1YI2 F;  3CMA F;  3B6N A;  5MN4 A;  3M4S A;  3QHD A;  3RYF B;  4EI8 A;  1K73 H;  3LWQ C;  3VO8 A;  3ZO8 A;  3N4Z A;  4G4X A;  2VAM A;  3F6M A;  5MN5 A;  3JAT B;  4TUY A;  3C8L A;  5CA0 A;  3E1Y A;  3RYF A;  3ESJ A;  4C82 A;  1QD9 A;  2CW4 A;  1W5E A;  3NK6 A;  5HY0 A;  2HRU A;  3E22 B;  2UYP A;  3GYQ A;  4ZHQ B;  1VQK F;  1GZ0 A;  2Z1F A;  2ZAU A;  3JAW B;  1H7M A;  5ITZ B;  4BT2 A;  3CCL F;  3CYP B;  5EAZ A;  4BT6 A;  2GLZ A;  3P4E A;  3WJP A;  3JAW A;  3RYC B;  5ITZ A;  2HS3 A;  2PHN A;  1X7O A;  4BVQ A;  1DBF A;  1VQ8 F;  1Z5W A;  3TD3 A;  5HXZ A;  3M1X A;  1IV2 A;  3LDT A;  3JAK B;  3TD4 A;  2Z1E A;  2WAL A;  2MQE A;  4O4I B;  3VOA A;  4ZK7 A;  5JCO C;  5JQG A;  2VAP A;  3CCQ F;  1NQ3 A;  1YJ9 F;  3JAL B;  4TZZ A;  3WXM B;  4YJ3 B;  5G4U C;  2QA4 F;  2GZL A;  5CB4 B;  1CN7 A;  3JVH A;  1E7K A;  3CCR F;  1M90 H;  1J7H A;  4YJ3 A;  2KTU A;  3UT5 B;  2RB9 A;  1U3L A;  4I55 A;  4BT3 A;  3ZP4 A;  4IHJ A;  4C81 A;  5CB4 A;  3ERN A;  1KQS F;  3N2K B;  2Z1U A;  4EI9 A;  4I50 B;  3VMF B;  3CME F;  4X1Y B;  4X3M A;  5LYJ A;  4X1I B;  5HY4 A;  3KJK A;  5MN6 A;  2BO1 A;  1W2B F;  5DCV A;  2AIF A;  4I50 A;  3J80 M;  4X1Y A;  3VYU C;  3WJQ A;  4X1I A;  1XV2 A;  5FNV A;  5GON B;  3G71 F;  4RQO A;  4YJ2 B;  5EB0 A;  1YIT F;  5LP6 A;  3C9U A;  1YQN A;  3J81 M;  1GO1 A;  1Z5V A;  3HKD B;  1TUB A;  2VGM A;  1JN1 A;  3NK7 A;  4G4W A;  4HNA B;  5IJ9 B;  1W55 A;  2LBT A;  3MCQ A;  4G4Y A;  3S06 A;  5IT9 M;  3QUW A;  1FSZ A;  3KJJ A;  2H8C A;  2ZF8 A;  2KTV A;  4ZI7 A;  1K9M H;  3K14 A;  3IEW A;  2R6R 1;  3VI6 A;  4O2A B;  3WGL A;  4F6R B;  2RHJ A;  5HP7 A;  3E20 B;  5EZY B;  2OTM A;  2YYE A;  4B46 A;  4M8I A;  5IJ0 A;  1UFY A;  3I55 F;  1VQL F;  2P6Y A;  3LYB A;  3PAF A;  4F6R A;  4WBN A;  3IEQ A;  1IV1 A;  2N48 A;  1VQ9 F;  3CC7 F;  1VQP F;  1VK3 A;  1ODE A;  2FC3 A;  1COM A;  2OTJ F;  3CC2 F;  4ZHW A;  3RYI A;  1YIJ F;  2HP0 A;  1W5F A;  2HQS C;  3F0E A;  4EI7 A;  3RYH A;  1QU9 A;  3MQW A;  3S0W A;  2CVL A;  5C8Y A;  3LFO A;  5GAN K;  3K2X A;  1VQV A;  4O4L A;  3DC2 A;  2QEX F;  2IG8 A;  4G4V A;  5LXT B;  2Q1X A;  3BYQ A;  3C9R A;  4O4H A;  3FBA A;  2CHT A;  3AGK A;  2CHS A;  5GIN C;  3FPI A;  5BMV B;  1Q8R A;  3HJW C;  2W8B C;  3JAM M;  2KGW A;  3JAT A;  3V4D A;  1Q86 H;  3PLA C;  3RE3 A;  2BTQ B;  5EWR A;  1YGY A;  4B5C A;  2DYY A;  1XBI A;  3E22 A;  4TV8 B;  5JCO A;  4O2B B;  4ZHQ A;  2I6R A;  3C9S A;  2ZOD A;  3LWR C;  2CWJ A;  3S0Y A;  3CPW F;  4TV8 A;  4EB6 B;  4O2B A;  1OAP A;  3TD5 A;  3RYC A;  2F9Z C;  2FGY A;  3VOB A;  1T0A A;  2KG4 A;  3WPW A;  1RLG A;  1VH8 A;  4X3L A;  1VQO F;  3JAK A;  3VYT C;  5AVM A;  3NVK E;  4X1K B;  1XRG A;  4O4I A;  4O4J B;  1X52 A;  3ZP7 A;  3CCS F;  1U40 A;  3F0D A;  1IPA A;  2ZOV A;  1VQM F;  3JAL A;  4O4J A;  1SDS A;  3O85 A;  3FD5 A;  2HVY D;  3Q8H A;  3T80 A;  3M84 A;  3HKB B;  3L7Q A;  3OBW A;  5JH7 B;  3S0H A;  3WGK A;  3VIU A;  4ERH A;  4RHA A;  3UT5 A;  3HKB A;  2AMT A;  1W58 1;  2L26 A;  2Q1Y A;  4B45 A;  4C8I A;  3N2K A;  3MCA B;  3WPX A;  5EO3 A;  1VQ4 F;  3ELC A;  1W5B A;  3ON1 A;  1IV4 A;  4FFB B;  4C8E A;  2UZH A;  5B8F A;  5HWE A;  2YXZ A;  1NJI H;  1Q7Y H;  5LA6 B;  5KMG B;  2BTU A;  1DT9 A;  1QAH A;  3CXC F;  3P0Z A;  5FLX M;  3CCM F;  5GON A;  5EYP B;  4YJ2 A;  2H6L A;  2VAW A;  3KE1 A;  4X20 B;  3HKD A;  5LA6 A;  1R1M A;  4HNA A;  2HX0 A;  5IJ9 A;  4I4T B;  1YJN F;  3HKC B;  3V7E A;  4TV9 B;  5J2U B;  3JAS B;  4B62 A;  4I4T A;  5LOV B;  3CPQ A;  3HKC A;  1KNJ A;  4O2A A;  4TV9 A;  2LCA A;  3CG6 A;  3JAS A;  4BVT A;  5EZY A;  2HP3 A;  5EIB C;  3LME A;  3F0G A;  4IIJ B;  5FJ4 C;  3N4Y A;  4DRX B;  5HY1 A;  5GAP K;  2RHH A;  3IR9 A;  3HKE B;  5CA1 B;  4E6E A;  4IIJ A;  1QVG F;  1W59 A;  5KX5 B;  4DRX A;  1TVK B;  3JAR B;  1K8A H;  4C4W C;  1JY8 A;  3U0O A;  3R0P A;  1W57 A;  1Q82 H;  4C8G A;  1GO0 A;  4G88 A;  1OFU A;  2RHO A;  2QTP A;  5J2T B;  2ZVZ A;  3LWV C;  1ZWZ A;  1VQ6 F;  2GVI A;  2HS4 A;  2IQQ A;  2IAF A;  1U43 A;  1PXW A;  5LXT A;  5HP8 A;  3IMP A;  4NWO B;  2PMP A;  5KMG A;  4KWE A;  2UYK A;  3CCV F;  3V7Q A;  3OBY A;  2ZVY A;  1W41 A;  5BMV A;  4ZHY B;  4TUY B;  2UYJ A;  5CA0 B;  2G9I A;  4BVS A;  2I6D A;  3VCZ A;  3CCE F;  3IKF A;  1H47 A;  3HWU A;  3CD6 F;  1QVF F;  4DXD A;  3NVI B;  2R75 1;  3N2G B;  2VXY A;  4BY9 D;  2OZB A;  1GX1 A;  2RHL A;  3DDN A;  3MBM A;  3RA6 A;  5A2Q M;  3NMU C;  3D54 A;  4ZOL B;  1NMU B;  2OTL F;  4EB6 A;  1T0K B;  3N2G A;  3OW2 F;  3C9T A;  2Z01 A;  5HXU A;  1IV3 A;  2DT4 A;  1ONI A;  4BVR A;  2HRY A;  3IKE A;  3D01 A;  3OON A;  4ZOL A;  5JVD B;  1RLU A;  3CB2 A;  4BT4 A;  3JCM M;  3VYS C;  2OHW A;  5JQG B;  3QTY A;  2K1S A;  4X1K A;  3KHN A;  1JD1 A;  3WGN A;  3P10 A;  5JVD A;  1YJW F;  1W42 A;  4NQ3 A;  4U39 A;  2HS0 A;  3HAX D;  1VQ7 F;  2NMU A;  2Z1T A;  3ZOP A;  4NUT A;  3S03 A;  2V9Y A;  2UYN B;  2QI2 A;  3F0F A;  5GIP C;  1W3E X;  5JH7 A;  3FFM A;  2VGN A;  3K0T A;  4I55 B;  1PF5 A;  4IHJ B;  1XHO A;  3VTI C;  2UYN A;  4ZHV A;  1X25 A;  2AIZ P;  3J7A R;  1RA4 A;  3FD6 A;  4BT7 A;  3CYQ A;  5LYJ B;  2B33 A;  5EIB D;  4FFB A;  3CCU F;  1JFF B;  5GIO C;  3WGJ A;  1U3P A;  1CK2 A;  3EOR A;  1RQ2 A;  1X7P A;  3G6E F;  1UI9 A;  5FNV B; 
#chains in the Genus database with same CATH homology
 1YJ9 F;  1QVG F;  3PLA C;  3G4S F;  4TZZ A;  5EWR A;  3WXM B;  1K8A H;  4C4W C;  5G4U C;  4BW0 B;  2LBW A;  2QA4 F;  1Q82 H;  1XBI A;  1CN7 A;  1GO0 A;  3LWV C;  1E7K A;  1KC8 H;  3CCR F;  4LCK A;  1M90 H;  2KTU A;  1ZWZ A;  1VQ6 F;  3LWR C;  3SIU A;  3CPW F;  2ALE A;  3SIV A;  1PXW A;  1JJ2 F;  1KQS F;  4EI9 A;  2F9Z C;  2FGY A;  1RLG A;  2KG4 A;  3VMF B;  3CCV F;  3CME F;  3V7Q A;  4X3M A;  3OBY A;  5HY4 A;  4X3L A;  1VQO F;  1W41 A;  3I56 F;  3NVK E;  2BO1 A;  1W2B F;  1KD1 H;  1VQ5 F;  5DCV A;  2AIF A;  1X52 A;  3CCS F;  3J80 M;  1IPA A;  4BVS A;  1W40 A;  2LBX A;  1VQM F;  3G71 F;  1YIT F;  3V3T A;  3LWO C;  2I6D A;  3J81 M;  1SDS A;  3O85 A;  2CZW A;  3CCE F;  1GO1 A;  5G4V C;  2VGM A;  3D00 A;  3NK7 A;  2HVY D;  1N8R H;  3RA5 A;  3CCJ F;  3CD6 F;  2JNB A;  1QVF F;  3OBW A;  3NVI B;  3LWP C;  1YHQ F;  4BY9 D;  5IT9 M;  1Q81 H;  2OZB A;  3CC4 F;  1S72 F;  3RA6 A;  5A2Q M;  3NMU C;  2KTV A;  1NMU B;  4XCQ A;  2OTL F;  1M1K H;  1K9M H;  1T0K B;  3OW2 F;  5HXU A;  3VI6 A;  3MCA B;  1VQN F;  5EO3 A;  5HY2 A;  4BVR A;  1YI2 F;  3E20 B;  1VQ4 F;  3ON1 A;  3CMA F;  1K73 H;  4EI8 A;  3I55 F;  3LWQ C;  1VQL F;  3JCM M;  3N4Z A;  2OHW A;  5HWE A;  3PAF A;  1NJI H;  1Q7Y H;  1YJW F;  1DT9 A;  3E1Y A;  1VQ9 F;  3CC7 F;  1W42 A;  3CXC F;  1VQP F;  4NQ3 A;  2FC3 A;  5FLX M;  3CCM F;  2OTJ F;  3CC2 F;  3HAX D;  1VQ7 F;  3NK6 A;  5HY0 A;  1YIJ F;  4EI7 A;  4NUT A;  3GYQ A;  1VQK F;  1GZ0 A;  2QI2 A;  1H7M A;  5GIP C;  3CCL F;  1YJN F;  1W3E X;  3LFO A;  5GAN K;  3V7E A;  3FFM A;  2VGN A;  2GLZ A;  2QEX F;  4BVQ A;  1X7O A;  3CPQ A;  3J7A R;  1VQ8 F;  1RA4 A;  5HXZ A;  3CG6 A;  4BVT A;  3AGK A;  5FJ4 C;  5GIN C;  3N4Y A;  3CCU F;  2WAL A;  5HY1 A;  5GAP K;  3HJW C;  5GIO C;  3JAM M;  3CCQ F;  3IR9 A;  1CK2 A;  1X7P A;  3G6E F;  1Q86 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...