1ZWZA

Structural comparison of yeast snornp and splicesomal protein snu13p with its homologs
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
SAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Snu13p
publication title Structural comparison of yeast snoRNP and spliceosomal protein Snu13p with its homologs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 42
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1zwzA00
2OZBA 2QI2A 3RA5A 5IT9M 3LWOC 3NMUC 3N4ZA 1K73H 5G4UC 2JNBA 4NUTA 1NMUB 1X7PA 2OTJF 1YJNF 3MCAB 5GAPK 5GIPC 3GYQA 1VQNF 1KC8H 2HVYD 1YJWF 3CCJF 3LWVC 3CC2F 3CCRF 3JCMM 1Q81H 1DT9A 1ZWZA 1T0KB 3CCVF 2BO1A 3CCSF 1X52A 3SIUA 3CCEF 1CN7A 1E7KA 3IR9A 3V7QA 1W2BF 4X3MA 1JJ2F 2LBWA 5DCVA 2CZWA 3VI6A 3CMAF 1VQ4F 1VQ9F 5EO3A 3CPQA 3NK7A 1YITF 1GO1A 1M1KH 4TZZA 5FLXM 1Q7YH 3AGKA 2FC3A 2I6DA 3CCUF 1W3EX 2QEXF 3ON1A 1VQOF 1GO0A 4X3LA 1YJ9F 1QVFF 1W42A 3E20B 1QVGF 1M90H 3WXMB 3HAXD 5GANK 1XBIA 1YIJF 1RA4A 3LFOA 1W40A 1S72F 2OHWA 3CCMF 1Q82H 3J80M 3CPWF 1VQPF 3G4SF 2KTUA 1PXWA 2WALA 3O85A 5GIOC 1Q86H 3J81M 1VQKF 5EWRA 3V7EA 3CG6A 2QA4F 1GZ0A 5GINC 3JAMM 2LBXA 3LWQC 3CCQF 1VQ8F 4C4WC 3PLAC 3G6EF 3CC4F 3I55F 3NVKE 4LCKA 5A2QM 3CMEF 3SIVA 3J7AR 3LWRC 1VQMF 2VGMA 2VGNA 1YI2F 1VQ7F 1H7MA 1SDSA 3LWPC 3CD6F 3PAFA 1IPAA 2KTVA 2ALEA 1K8AH 1KQSF 2OTLF 3OBWA 1N8RH 1X7OA 3OBYA 3CC7F 3HJWC 1YHQF 1NJIH 1W41A 2KG4A 3FFMA 3N4YA 3VMFB 3NVIB 3G71F 1KD1H 2AIFA 3RA6A 1K9MH 4BY9D 3NK6A 5G4VC 5FJ4C 3CXCF 1VQLF 3I56F 1VQ5F 1RLGA 3E1YA 4BW0B 1CK2A 3OW2F 1VQ6F 3CCLF
chains in the Genus database with same CATH superfamily
1ODEA 4C8IA 3N4ZA 2ZF8A 3MBMA 5G4UC 1TVKB 3HTNA 4KWEA 4X1KB 1H47A 3V3TA 1YJNF 4TV9B 5LP6A 5GAPK 3GYQA 4X20B 2HVYD 4C8EA 5JQGB 5LYJB 3LWVC 3CC2F 5BMVB 4YJ2A 1IV3A 5HWEA 4EI8A 5JQGA 3JCMM 4G4YA 1DT9A 2H6LA 5GONB 1T0KB 3KE1A 1X52A 4O2BB 4ERHA 1H48A 5C8YA 4IHJB 4EB6A 3IR9A 3V7QA 1KNJA 4PWTA 1QD9A 4IHJA 2LBWA 2CWJA 2CZWA 3VI6A 3RYCA 3CMAF 1VQ4F 3EORA 1VQ9F 3JALB 5HY1A 1YITF 1M1KH 4O2AA 1RQ2A 3JALA 4I4TB 3U0OA 2I6DA 4BT4A 2W8BC 1VHAA 2QEXF 1VQOF 3FPIA 4TUYB 1M90H 3WXMB 5AVMA 3HAXD 5J2UA 3LDTA 3VIUA 3M1XA 1RA4A 2FGYA 1S72F 2OHWA 3CCMF 4G4WA 3I3FA 4ZHWA 2V9YA 3I7TA 1PXWA 1KNKA 1VQKF 2QA4F 2OTMA 1GZ0A 2BTQB 5IYZA 3JAMM 2Z1EA 1W57A 4I50B 2GZLA 5JCOA 1VQVA 4LCKA 4B46A 5A2QM 4I50A 1J7HA 2L26A 4O4HB 5EYPA 3OONA 2CVLA 2VGMA 3M4SA 1YI2F 5CB4B 1SDSA 1RQ7A 4O4LB 3CYPB 1KQSF 2CHSA 2I6RA 2YXZA 1NJIH 1W41A 3N4YA 2F9ZC 4O4IA 4R40B 4DXDA 1R1MA 5ITZA 5J2TA 4YJ3A 1KD1H 3RA6A 5HY0A 3B6NA 1QAHA 2Z1UA 2GVIA 4U3JA 5EZYA 1VQLF 1ONIA 2PHNA 3E1YA 2K1SA 5KX5A 2OZBA 2QI2A 3KJKA 3C9TA 3RA5A 5IJ9A 2HX0A 3LWOC 3NMUC 3Q8HA 2UYKA 4M8IA 3VTIC 1K73H 5LXTB 2H8EA 2JNBA 4NUTA 4I55A 3RYFA 1NMUB 1FSZA 3MCAB 1KC8H 3F0GA 5LOVA 3V4DA 1UFYA 4WBNB 4B62A 3GHZA 4F6RA 5FNVB 3HKEA 4O4JA 1PF5A 3VYUC 2NMUA 5CA1A 3RYHB 5KMGA 3CCEF 1CN7A 5LP6C 1OFUA 1U3LA 3RYHA 3ZO8A 2EWCA 1COMA 3VOBA 5EO3A 3VCZA 3CPQA 2VAWA 2RHLA 1X25A 4TZZA 4HNAB 1TVKA 3CYQA 3FD5A 3HKCB 4X1KA 1W5EA 4TV9A 1JFFB 4DRXB 4X20A 3CCUF 3IKFA 5EB1B 5LYJA 4C82A 3JARB 1OAPA 4BT7A 2UYJA 5BMVA 1W42A 1XHOA 2HP3A 5GONA 4FFBB 5JVDB 2HS0A 1SZQA 5GANK 3KJJA 3WJPA 1W40A 3JASB 3QHDA 4O2BA 3P0ZA 2HQSC 3CPWF 3WPXA 3G4SF 2AIZP 2KTUA 2B33A 2WALA 5GIOC 3IEQA 3J81M 3K14A 5CA0B 1FFXB 5JH7B 3ZP7A 4G4ZA 3VOAA 3LWQC 4RQOA 3WGMA 3RE3A 5JH7A 2VXYA 2G9IA 4I4TA 3MDOA 2UYNB 3LWRC 2CW4A 2HP0B 2QTPA 2VGNA 1VQ7F 2HRYA 3CD6F 2KTVA 3GTZA 5HP7A 2ALEA 4TUYA 1QU9A 3OBWA 3OBYA 3HJWC 4G4XA 4C81A 5HY4A 3JAWB 1JN1A 3VMFB 2Z1FA 3BYQA 3G71F 3D01A 3ERNA 2AIFA 3IEWA 3S0WA 4X1IB 2DYYA 1TUBB 2PMPA 3HKBB 4X1IA 3WJQA 3VYSC 1VQ5F 2Z01A 3FBAA 2DT4A 3HKBA 5B8FA 1VQ6F 3WJRA 5IT9M 4U39A 4O4HA 4NWOB 3LMEA 2IG8A 1VH8A 5CB4A 4O4LA 2OTJF 3JAKB 3D00A 3F0DA 2ZAUA 4G88A 1W5FA 2ZVYA 3VYTC 3CCRF 5LA6B 1ZWZA 5HY2A 3CCVF 2BO1A 1U3PA 3WPWA 3SIUA 1GX1A 1U40A 3L7QA 4BVTA 3T80A 4ZI7B 3S0YA 2VAMA 1Z5VA 3HWUA 2RHHA 4LNUB 3WGLA 5LXTA 3S03A 4IIJB 1SA0B 1XRGA 1JD1A 5EAZA 3AGKA 2FC3A 3S06A 4IIJA 1SA0A 3QUWA 1IV2A 1QVFF 3E20B 5MN4A 3K0TA 4WBNA 3K12A 4BVSA 2P6YA 5FNVA 1IV4A 1Q82H 1VQPF 4ZHQB 1YQNA 3O85A 3LYBA 5HXZA 5EWRA 3V7EA 3JATB 5IJ0B 2LBXA 1U43A 3FD6A 5HP8A 3CCQF 3C9SA 1VQ8F 1NQ3A 4NQ3A 3RYIB 3PLAC 3HKDB 3G6EF 4HNAA 4ZK7A 3P4EA 3I55F 3NVKE 3HKCA 3CMEF 3RYIA 1JFFA 4DRXA 3N2KB 3J7AR 2ZOVA 3D54A 3JARA 1H7MA 3N2KA 1IPAA 5LP6B 2OTLF 4RHAA 4FFBA 4BT6A 5JVDA 2UZHA 1YHQF 3ELCA 2ZVZA 2KG4A 4BT2A 4YJ2B 3JASA 3WGNA 3DDNA 3KIZA 3R0PA 2LBTA 2IQQA 3C9UA 3ESJA 3S0HA 4BY9D 5CA0A 5G4VC 5FJ4C 1FFXA 5C8YB 3I56F 1W59A 3C9RA 4BW0B 3K2XA 3TD3A 1CK2A 2R751 4EB6B 3OW2F 3CCLF 4EI9A 3MQWA 3CB2A 1XV2A 2BTOA 5MN5A 3RYCB 2UYNA 3KHNA 2HP0A 3IKEA 4X1YB 1VK3A 2IAFA 4O2AB 1X7PA 3IMPA 3JVHA 4X1YA 1VQNF 5GIPC 5JCOC 1YJWF 3CCJF 4BVRA 3WGKA 3F0EA 1FNKA 2ZODA 2GLZA 3JAWA 1Q81H 1W5BA 5J2UB 2Q1YA 1TUBA 3CCSF 1FNJA 1E7KA 2RHJA 3N2GB 2HS4A 4X3MA 1W2BF 1JJ2F 4ZHYB 5DCVA 3N2GA 2Q1XA 2CHTA 5IYZB 3NK7A 1GO1A 2BTUA 2H8CA 3MCQA 1T0AA 5FLXM 1RLUA 1Q7YH 3TD4A 3JAKA 3P10A 2Z1TA 5EYPB 1W55A 1W3EX 3ON1A 5EB0A 4X3LA 4B45A 1YJ9F 1GO0A 4BT5A 1CLIA 3C8LA 1QVGF 5MN6A 5LA6A 1W5AA 3F6MA 1XBIA 1YIJF 3LFOA 2RB9A 3M84A 1W581 1Z5WA 2AMTA 4O4IB 5ITZB 5J2TB 3J80M 4YJ3B 1Q8RA 2HS3A 5HXUA 2VAPA 2RHOA 1Q86H 4ZI7A 2MQEA 3CG6A 1JY8A 4U3JB 5EZYB 5GINC 3QTYA 5EIBD 4C4WC 4LNUA 2R6R1 5KX5B 3CC4F 3ZOPA 4C8GA 3ZP4A 2CSLA 3SIVA 5IJ9B 2N48A 4E6EA 1VQMF 2UYPA 1UI9A 4TV8B 3WGJA 3UT5B 3LWPC 4I55B 3RYFB 3PAFA 4XCQA 1IV1A 1K8AH 4TV8A 2LCAA 4BVQA 1N8RH 1X7OA 3UT5A 4BT3A 3E22B 3CC7F 4ZOLB 5LOVB 3FFMA 3DC2A 4EI7A 4ZHVA 3E22A 4ZOLA 3NVIB 3S02A 4ZHQA 4B5CA 5EIBC 2YYEA 4F6RB 1K9MH 3NK6A 4G4VA 3HKEB 4O4JB 1DBFA 1YGYA 3VO8A 2KGWA 3F0FA 3JATA 5CA1B 5IJ0A 5KMGB 3CXCF 3TD5A 2HRUA 1RLGA 3HKDA
chains in the Genus database with same CATH topology
4EI9A 2OZBA 2QI2A 3RA5A 5IT9M 3LWOC 3NMUC 3N4ZA 1K73H 5G4UC 2JNBA 4NUTA 1NMUB 1X7PA 3V3TA 2OTJF 1YJNF 3D00A 3MCAB 5GAPK 5GIPC 3GYQA 1VQNF 1KC8H 2HVYD 1YJWF 3CCJF 4BVRA 3LWVC 3CC2F 2GLZA 5HWEA 4EI8A 3CCRF 3JCMM 1Q81H 1DT9A 1ZWZA 5HY2A 1T0KB 3CCVF 2BO1A 3CCSF 1X52A 3SIUA 3CCEF 1CN7A 1E7KA 4BVTA 3IR9A 3V7QA 1W2BF 4X3MA 1JJ2F 2LBWA 5DCVA 2CZWA 3VI6A 3CMAF 1VQ4F 1VQ9F 5EO3A 3CPQA 3NK7A 5HY1A 1YITF 1GO1A 1M1KH 4TZZA 5FLXM 1Q7YH 3AGKA 2FC3A 2I6DA 3CCUF 1W3EX 2QEXF 3ON1A 1VQOF 1GO0A 4X3LA 1YJ9F 1QVFF 1W42A 3E20B 1QVGF 1M90H 3WXMB 3HAXD 5GANK 4BVSA 1XBIA 1YIJF 1RA4A 2FGYA 3LFOA 1W40A 1S72F 2OHWA 3CCMF 1Q82H 3J80M 3CPWF 1VQPF 3G4SF 2KTUA 1PXWA 2WALA 3O85A 5HXUA 5GIOC 1Q86H 3J81M 5HXZA 1VQKF 5EWRA 3V7EA 3CG6A 2QA4F 1GZ0A 5GINC 3JAMM 2LBXA 3LWQC 3CCQF 1VQ8F 4C4WC 4NQ3A 3PLAC 3G6EF 3CC4F 3I55F 3NVKE 4LCKA 5A2QM 3CMEF 3SIVA 3J7AR 3LWRC 1VQMF 2VGMA 2VGNA 1YI2F 1VQ7F 1H7MA 1SDSA 3LWPC 3CD6F 3PAFA 4XCQA 1IPAA 2KTVA 2ALEA 1K8AH 1KQSF 4BVQA 3OBWA 1N8RH 1X7OA 3OBYA 2OTLF 3CC7F 3HJWC 1YHQF 1NJIH 1W41A 2KG4A 3FFMA 5HY4A 2F9ZC 3N4YA 4EI7A 3VMFB 3NVIB 3G71F 1KD1H 2AIFA 3RA6A 5HY0A 1K9MH 4BY9D 3NK6A 5G4VC 5FJ4C 3CXCF 1VQLF 3I56F 1VQ5F 1RLGA 3E1YA 4BW0B 1CK2A 3OW2F 1VQ6F 3CCLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZB A;  2QI2 A;  3RA5 A;  5IT9 M;  3LWO C;  3NMU C;  3N4Z A;  1K73 H;  5G4U C;  2JNB A;  4NUT A;  1NMU B;  1X7P A;  2OTJ F;  1YJN F;  3MCA B;  5GAP K;  5GIP C;  3GYQ A;  1VQN F;  1KC8 H;  2HVY D;  1YJW F;  3CCJ F;  3LWV C;  3CC2 F;  3CCR F;  3JCM M;  1Q81 H;  1DT9 A;  1ZWZ A;  1T0K B;  3CCV F;  2BO1 A;  3CCS F;  1X52 A;  3SIU A;  3CCE F;  1CN7 A;  1E7K A;  3IR9 A;  3V7Q A;  1W2B F;  4X3M A;  1JJ2 F;  2LBW A;  5DCV A;  2CZW A;  3VI6 A;  3CMA F;  1VQ4 F;  1VQ9 F;  5EO3 A;  3CPQ A;  3NK7 A;  1YIT F;  1GO1 A;  1M1K H;  4TZZ A;  5FLX M;  1Q7Y H;  3AGK A;  2FC3 A;  2I6D A;  3CCU F;  1W3E X;  2QEX F;  3ON1 A;  1VQO F;  1GO0 A;  4X3L A;  1YJ9 F;  1QVF F;  1W42 A;  3E20 B;  1QVG F;  1M90 H;  3WXM B;  3HAX D;  5GAN K;  1XBI A;  1YIJ F;  1RA4 A;  3LFO A;  1W40 A;  1S72 F;  2OHW A;  3CCM F;  1Q82 H;  3J80 M;  3CPW F;  1VQP F;  3G4S F;  2KTU A;  1PXW A;  2WAL A;  3O85 A;  5GIO C;  1Q86 H;  3J81 M;  1VQK F;  5EWR A;  3V7E A;  3CG6 A;  2QA4 F;  1GZ0 A;  5GIN C;  3JAM M;  2LBX A;  3LWQ C;  3CCQ F;  1VQ8 F;  4C4W C;  3PLA C;  3G6E F;  3CC4 F;  3I55 F;  3NVK E;  4LCK A;  5A2Q M;  3CME F;  3SIV A;  3J7A R;  3LWR C;  1VQM F;  2VGM A;  2VGN A;  1YI2 F;  1VQ7 F;  1H7M A;  1SDS A;  3LWP C;  3CD6 F;  3PAF A;  1IPA A;  2KTV A;  2ALE A;  1K8A H;  1KQS F;  2OTL F;  3OBW A;  1N8R H;  1X7O A;  3OBY A;  3CC7 F;  3HJW C;  1YHQ F;  1NJI H;  1W41 A;  2KG4 A;  3FFM A;  3N4Y A;  3VMF B;  3NVI B;  3G71 F;  1KD1 H;  2AIF A;  3RA6 A;  1K9M H;  4BY9 D;  3NK6 A;  5G4V C;  5FJ4 C;  3CXC F;  1VQL F;  3I56 F;  1VQ5 F;  1RLG A;  3E1Y A;  4BW0 B;  1CK2 A;  3OW2 F;  1VQ6 F;  3CCL F; 
#chains in the Genus database with same CATH topology
 1ODE A;  4C8I A;  3N4Z A;  2ZF8 A;  3MBM A;  5G4U C;  1TVK B;  3HTN A;  4KWE A;  4X1K B;  1H47 A;  3V3T A;  1YJN F;  4TV9 B;  5LP6 A;  5GAP K;  3GYQ A;  4X20 B;  2HVY D;  4C8E A;  5JQG B;  5LYJ B;  3LWV C;  3CC2 F;  5BMV B;  4YJ2 A;  1IV3 A;  5HWE A;  4EI8 A;  5JQG A;  3JCM M;  4G4Y A;  1DT9 A;  2H6L A;  5GON B;  1T0K B;  3KE1 A;  1X52 A;  4O2B B;  4ERH A;  1H48 A;  5C8Y A;  4IHJ B;  4EB6 A;  3IR9 A;  3V7Q A;  1KNJ A;  4PWT A;  1QD9 A;  4IHJ A;  2LBW A;  2CWJ A;  2CZW A;  3VI6 A;  3RYC A;  3CMA F;  1VQ4 F;  3EOR A;  1VQ9 F;  3JAL B;  5HY1 A;  1YIT F;  1M1K H;  4O2A A;  1RQ2 A;  3JAL A;  4I4T B;  3U0O A;  2I6D A;  4BT4 A;  2W8B C;  1VHA A;  2QEX F;  1VQO F;  3FPI A;  4TUY B;  1M90 H;  3WXM B;  5AVM A;  3HAX D;  5J2U A;  3LDT A;  3VIU A;  3M1X A;  1RA4 A;  2FGY A;  1S72 F;  2OHW A;  3CCM F;  4G4W A;  3I3F A;  4ZHW A;  2V9Y A;  3I7T A;  1PXW A;  1KNK A;  1VQK F;  2QA4 F;  2OTM A;  1GZ0 A;  2BTQ B;  5IYZ A;  3JAM M;  2Z1E A;  1W57 A;  4I50 B;  2GZL A;  5JCO A;  1VQV A;  4LCK A;  4B46 A;  5A2Q M;  4I50 A;  1J7H A;  2L26 A;  4O4H B;  5EYP A;  3OON A;  2CVL A;  2VGM A;  3M4S A;  1YI2 F;  5CB4 B;  1SDS A;  1RQ7 A;  4O4L B;  3CYP B;  1KQS F;  2CHS A;  2I6R A;  2YXZ A;  1NJI H;  1W41 A;  3N4Y A;  2F9Z C;  4O4I A;  4R40 B;  4DXD A;  1R1M A;  5ITZ A;  5J2T A;  4YJ3 A;  1KD1 H;  3RA6 A;  5HY0 A;  3B6N A;  1QAH A;  2Z1U A;  2GVI A;  4U3J A;  5EZY A;  1VQL F;  1ONI A;  2PHN A;  3E1Y A;  2K1S A;  5KX5 A;  2OZB A;  2QI2 A;  3KJK A;  3C9T A;  3RA5 A;  5IJ9 A;  2HX0 A;  3LWO C;  3NMU C;  3Q8H A;  2UYK A;  4M8I A;  3VTI C;  1K73 H;  5LXT B;  2H8E A;  2JNB A;  4NUT A;  4I55 A;  3RYF A;  1NMU B;  1FSZ A;  3MCA B;  1KC8 H;  3F0G A;  5LOV A;  3V4D A;  1UFY A;  4WBN B;  4B62 A;  3GHZ A;  4F6R A;  5FNV B;  3HKE A;  4O4J A;  1PF5 A;  3VYU C;  2NMU A;  5CA1 A;  3RYH B;  5KMG A;  3CCE F;  1CN7 A;  5LP6 C;  1OFU A;  1U3L A;  3RYH A;  3ZO8 A;  2EWC A;  1COM A;  3VOB A;  5EO3 A;  3VCZ A;  3CPQ A;  2VAW A;  2RHL A;  1X25 A;  4TZZ A;  4HNA B;  1TVK A;  3CYQ A;  3FD5 A;  3HKC B;  4X1K A;  1W5E A;  4TV9 A;  1JFF B;  4DRX B;  4X20 A;  3CCU F;  3IKF A;  5EB1 B;  5LYJ A;  4C82 A;  3JAR B;  1OAP A;  4BT7 A;  2UYJ A;  5BMV A;  1W42 A;  1XHO A;  2HP3 A;  5GON A;  4FFB B;  5JVD B;  2HS0 A;  1SZQ A;  5GAN K;  3KJJ A;  3WJP A;  1W40 A;  3JAS B;  3QHD A;  4O2B A;  3P0Z A;  2HQS C;  3CPW F;  3WPX A;  3G4S F;  2AIZ P;  2KTU A;  2B33 A;  2WAL A;  5GIO C;  3IEQ A;  3J81 M;  3K14 A;  5CA0 B;  1FFX B;  5JH7 B;  3ZP7 A;  4G4Z A;  3VOA A;  3LWQ C;  4RQO A;  3WGM A;  3RE3 A;  5JH7 A;  2VXY A;  2G9I A;  4I4T A;  3MDO A;  2UYN B;  3LWR C;  2CW4 A;  2HP0 B;  2QTP A;  2VGN A;  1VQ7 F;  2HRY A;  3CD6 F;  2KTV A;  3GTZ A;  5HP7 A;  2ALE A;  4TUY A;  1QU9 A;  3OBW A;  3OBY A;  3HJW C;  4G4X A;  4C81 A;  5HY4 A;  3JAW B;  1JN1 A;  3VMF B;  2Z1F A;  3BYQ A;  3G71 F;  3D01 A;  3ERN A;  2AIF A;  3IEW A;  3S0W A;  4X1I B;  2DYY A;  1TUB B;  2PMP A;  3HKB B;  4X1I A;  3WJQ A;  3VYS C;  1VQ5 F;  2Z01 A;  3FBA A;  2DT4 A;  3HKB A;  5B8F A;  1VQ6 F;  3WJR A;  5IT9 M;  4U39 A;  4O4H A;  4NWO B;  3LME A;  2IG8 A;  1VH8 A;  5CB4 A;  4O4L A;  2OTJ F;  3JAK B;  3D00 A;  3F0D A;  2ZAU A;  4G88 A;  1W5F A;  2ZVY A;  3VYT C;  3CCR F;  5LA6 B;  1ZWZ A;  5HY2 A;  3CCV F;  2BO1 A;  1U3P A;  3WPW A;  3SIU A;  1GX1 A;  1U40 A;  3L7Q A;  4BVT A;  3T80 A;  4ZI7 B;  3S0Y A;  2VAM A;  1Z5V A;  3HWU A;  2RHH A;  4LNU B;  3WGL A;  5LXT A;  3S03 A;  4IIJ B;  1SA0 B;  1XRG A;  1JD1 A;  5EAZ A;  3AGK A;  2FC3 A;  3S06 A;  4IIJ A;  1SA0 A;  3QUW A;  1IV2 A;  1QVF F;  3E20 B;  5MN4 A;  3K0T A;  4WBN A;  3K12 A;  4BVS A;  2P6Y A;  5FNV A;  1IV4 A;  1Q82 H;  1VQP F;  4ZHQ B;  1YQN A;  3O85 A;  3LYB A;  5HXZ A;  5EWR A;  3V7E A;  3JAT B;  5IJ0 B;  2LBX A;  1U43 A;  3FD6 A;  5HP8 A;  3CCQ F;  3C9S A;  1VQ8 F;  1NQ3 A;  4NQ3 A;  3RYI B;  3PLA C;  3HKD B;  3G6E F;  4HNA A;  4ZK7 A;  3P4E A;  3I55 F;  3NVK E;  3HKC A;  3CME F;  3RYI A;  1JFF A;  4DRX A;  3N2K B;  3J7A R;  2ZOV A;  3D54 A;  3JAR A;  1H7M A;  3N2K A;  1IPA A;  5LP6 B;  2OTL F;  4RHA A;  4FFB A;  4BT6 A;  5JVD A;  2UZH A;  1YHQ F;  3ELC A;  2ZVZ A;  2KG4 A;  4BT2 A;  4YJ2 B;  3JAS A;  3WGN A;  3DDN A;  3KIZ A;  3R0P A;  2LBT A;  2IQQ A;  3C9U A;  3ESJ A;  3S0H A;  4BY9 D;  5CA0 A;  5G4V C;  5FJ4 C;  1FFX A;  5C8Y B;  3I56 F;  1W59 A;  3C9R A;  4BW0 B;  3K2X A;  3TD3 A;  1CK2 A;  2R75 1;  4EB6 B;  3OW2 F;  3CCL F;  4EI9 A;  3MQW A;  3CB2 A;  1XV2 A;  2BTO A;  5MN5 A;  3RYC B;  2UYN A;  3KHN A;  2HP0 A;  3IKE A;  4X1Y B;  1VK3 A;  2IAF A;  4O2A B;  1X7P A;  3IMP A;  3JVH A;  4X1Y A;  1VQN F;  5GIP C;  5JCO C;  1YJW F;  3CCJ F;  4BVR A;  3WGK A;  3F0E A;  1FNK A;  2ZOD A;  2GLZ A;  3JAW A;  1Q81 H;  1W5B A;  5J2U B;  2Q1Y A;  1TUB A;  3CCS F;  1FNJ A;  1E7K A;  2RHJ A;  3N2G B;  2HS4 A;  4X3M A;  1W2B F;  1JJ2 F;  4ZHY B;  5DCV A;  3N2G A;  2Q1X A;  2CHT A;  5IYZ B;  3NK7 A;  1GO1 A;  2BTU A;  2H8C A;  3MCQ A;  1T0A A;  5FLX M;  1RLU A;  1Q7Y H;  3TD4 A;  3JAK A;  3P10 A;  2Z1T A;  5EYP B;  1W55 A;  1W3E X;  3ON1 A;  5EB0 A;  4X3L A;  4B45 A;  1YJ9 F;  1GO0 A;  4BT5 A;  1CLI A;  3C8L A;  1QVG F;  5MN6 A;  5LA6 A;  1W5A A;  3F6M A;  1XBI A;  1YIJ F;  3LFO A;  2RB9 A;  3M84 A;  1W58 1;  1Z5W A;  2AMT A;  4O4I B;  5ITZ B;  5J2T B;  3J80 M;  4YJ3 B;  1Q8R A;  2HS3 A;  5HXU A;  2VAP A;  2RHO A;  1Q86 H;  4ZI7 A;  2MQE A;  3CG6 A;  1JY8 A;  4U3J B;  5EZY B;  5GIN C;  3QTY A;  5EIB D;  4C4W C;  4LNU A;  2R6R 1;  5KX5 B;  3CC4 F;  3ZOP A;  4C8G A;  3ZP4 A;  2CSL A;  3SIV A;  5IJ9 B;  2N48 A;  4E6E A;  1VQM F;  2UYP A;  1UI9 A;  4TV8 B;  3WGJ A;  3UT5 B;  3LWP C;  4I55 B;  3RYF B;  3PAF A;  4XCQ A;  1IV1 A;  1K8A H;  4TV8 A;  2LCA A;  4BVQ A;  1N8R H;  1X7O A;  3UT5 A;  4BT3 A;  3E22 B;  3CC7 F;  4ZOL B;  5LOV B;  3FFM A;  3DC2 A;  4EI7 A;  4ZHV A;  3E22 A;  4ZOL A;  3NVI B;  3S02 A;  4ZHQ A;  4B5C A;  5EIB C;  2YYE A;  4F6R B;  1K9M H;  3NK6 A;  4G4V A;  3HKE B;  4O4J B;  1DBF A;  1YGY A;  3VO8 A;  2KGW A;  3F0F A;  3JAT A;  5CA1 B;  5IJ0 A;  5KMG B;  3CXC F;  3TD5 A;  2HRU A;  1RLG A;  3HKD A; 
#chains in the Genus database with same CATH homology
 4EI9 A;  2OZB A;  2QI2 A;  3RA5 A;  5IT9 M;  3LWO C;  3NMU C;  3N4Z A;  1K73 H;  5G4U C;  2JNB A;  4NUT A;  1NMU B;  1X7P A;  3V3T A;  2OTJ F;  1YJN F;  3D00 A;  3MCA B;  5GAP K;  5GIP C;  3GYQ A;  1VQN F;  1KC8 H;  2HVY D;  1YJW F;  3CCJ F;  4BVR A;  3LWV C;  3CC2 F;  2GLZ A;  5HWE A;  4EI8 A;  3CCR F;  3JCM M;  1Q81 H;  1DT9 A;  1ZWZ A;  5HY2 A;  1T0K B;  3CCV F;  2BO1 A;  3CCS F;  1X52 A;  3SIU A;  3CCE F;  1CN7 A;  1E7K A;  4BVT A;  3IR9 A;  3V7Q A;  1W2B F;  4X3M A;  1JJ2 F;  2LBW A;  5DCV A;  2CZW A;  3VI6 A;  3CMA F;  1VQ4 F;  1VQ9 F;  5EO3 A;  3CPQ A;  3NK7 A;  5HY1 A;  1YIT F;  1GO1 A;  1M1K H;  4TZZ A;  5FLX M;  1Q7Y H;  3AGK A;  2FC3 A;  2I6D A;  3CCU F;  1W3E X;  2QEX F;  3ON1 A;  1VQO F;  1GO0 A;  4X3L A;  1YJ9 F;  1QVF F;  1W42 A;  3E20 B;  1QVG F;  1M90 H;  3WXM B;  3HAX D;  5GAN K;  4BVS A;  1XBI A;  1YIJ F;  1RA4 A;  2FGY A;  3LFO A;  1W40 A;  1S72 F;  2OHW A;  3CCM F;  1Q82 H;  3J80 M;  3CPW F;  1VQP F;  3G4S F;  2KTU A;  1PXW A;  2WAL A;  3O85 A;  5HXU A;  5GIO C;  1Q86 H;  3J81 M;  5HXZ A;  1VQK F;  5EWR A;  3V7E A;  3CG6 A;  2QA4 F;  1GZ0 A;  5GIN C;  3JAM M;  2LBX A;  3LWQ C;  3CCQ F;  1VQ8 F;  4C4W C;  4NQ3 A;  3PLA C;  3G6E F;  3CC4 F;  3I55 F;  3NVK E;  4LCK A;  5A2Q M;  3CME F;  3SIV A;  3J7A R;  3LWR C;  1VQM F;  2VGM A;  2VGN A;  1YI2 F;  1VQ7 F;  1H7M A;  1SDS A;  3LWP C;  3CD6 F;  3PAF A;  4XCQ A;  1IPA A;  2KTV A;  2ALE A;  1K8A H;  1KQS F;  4BVQ A;  3OBW A;  1N8R H;  1X7O A;  3OBY A;  2OTL F;  3CC7 F;  3HJW C;  1YHQ F;  1NJI H;  1W41 A;  2KG4 A;  3FFM A;  5HY4 A;  2F9Z C;  3N4Y A;  4EI7 A;  3VMF B;  3NVI B;  3G71 F;  1KD1 H;  2AIF A;  3RA6 A;  5HY0 A;  1K9M H;  4BY9 D;  3NK6 A;  5G4V C;  5FJ4 C;  3CXC F;  1VQL F;  3I56 F;  1VQ5 F;  1RLG A;  3E1Y A;  4BW0 B;  1CK2 A;  3OW2 F;  1VQ6 F;  3CCL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...