4X1IB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
428
structure length
428
Chain Sequence
b'EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 151
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1iB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1iB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1iB01
4X1KA 5LP6C 3RYFB 4ZHQA 5IYZB 5LA6B 5IJ9B 3JAWB 5EZYA 4DRXA 4X20A 4TV9B 5CB4B 2GVIA 3RYCA 3JALA 3JASA 2BTQB 5GONA 3V3TA 4F6RB 5CA0B 1TUBA 1FFXB 2RHJA 3C8LA 5LOVA 3N2KA 4IHJA 1TVKA 4FFBA 3ZBQA 4TV8B 3HKCB 4ZI7B 5MN5A 1RQ7A 4HNAA 5JH7B 4LNUB 4ZOLA 3WGMA 4I55B 5LXTA 1W5BA 3JARA 4O2AA 1SA0A 5MN4A 1W5FA 4X1IA 4X1YB 4YJ2B 5JVDB 4O4HB 4O4LA 4O4JB 3JATA 5ITZB 4O2BB 3RYIA 1FSZA 3M8KA 2RHHA 5JCOA 5BMVA 3JAKB 4YJ3A 3M89A 5C8YB 5JQGB 4IHJB 5LP6A 3WGLA 4WBNA 3CB2A 3HKDA 4I4TA 5EYPA 4EB6B 3HKEA 3E22A 5FNVA 4B46A 5EIBC 5EIBD 1JFFA 3HKBA 2VAPA 4XCQA 4TUYB 4O4IB 4I50A 5J2TB 3R4VA 5IJ0A 3VO8A 3JARB 5LYJB 2XKAA 3RB8A 3VOAA 3UT5B 3VOBA 5J2UA 1Z5VA 3N2GB 5KX5B 5LP6B 1W581 4B45A 4X1KB 1RQ2A 5KMGA 4IIJA 4U3JA 4ZHQB 4EI9A 5CA1A 3RYHA 4U39A 4E6EA 2RHLA 5EZYB 2R6R1 4DRXB 4X20B 4DXDA 3RYCB 2Q1YA 3JALB 3JASB 5GONB 3VO9A 3RYFA 5IYZA 1TUBB 5LA6A 5JCOC 5IJ9A 3JAWA 5LOVB 3N2KB 1TVKB 4FFBB 4EI7A 4TV9A 5CB4A 1RLUA 1Z5WA 3WGKA 1OFUA 4HNAB 4ZOLB 2BTQA 4M8IA 5CA0A 4F6RA 5LXTB 1FFXA 1W5EA 4O2AB 1SA0B 2RHOA 2VAMA 4TV8A 3HKCA 3RYHB 4X1IB 4ZI7A 5MN6A 3ZIDA 5JH7A 4LNUA 4O4LB 4I55A 2XKBA 3ZBPA 4EI8A 3JATB 3RYIB 5BMVB 4YJ3B 3VPAA 2VAWA 4X1YA 4YJ2A 4WBNB 3HKDB 5EYPB 4I4TB 5JVDA 3HKEB 3E22B 5FNVB 4O4HA 1W5AA 2Q1XA 4O4JA 1JFFB 3HKBB 3WGNA 5ITZA 4O2BA 4I50B 5IJ0B 3JAKA 5C8YA 5JQGA 3WGJA 4EB6A 1W59A 5J2UB 4TUYA 4O4IA 5J2TA 5KMGB 5LYJA 4IIJB 4U3JB 5CA1B 4KWEA 3UT5A 2VXYA 5M7EA 2R751 2BTOA 3N2GA 5KX5A
chains in the Genus database with same CATH superfamily
4BPRA 2O8CA 1VHQA 1SPXA 5L45A 1RRPA 5HF6A 1GDTA 5IWAB 4Y2YA 1N57A 4TVKA 3U11A 3L1KA 3W3AD 2OB2A 4RDXA 1M57C 3ANYB 3OZDA 1PJZA 4KSCA 1IG0A 2IHYA 2EQBA 1R6AA 1KYYA 3A14A 3NBAA 5HA5A 3RC8A 2I80A 1E3LA 1N3LA 4D4MA 5FTLA 3QO5A 2ZI7A 4WXPA 4D79A 1JLKA 1E59A 5ALXA 5CM8B 4R0VA 4CF5A 3DNFA 1U9ZA 5HKBA 4ND7A 3OM3B 3KFVA 5HFLA 4B3SO 3CCVF 5CBPA 4BW5A 2ZYDA 4U2CA 3STVA 1LBEA 5K8UA 3LV8A 1E4EA 4UUMA 1AURA 2XXAB 2PU7A 2QY9A 2OOKA 4YJHB 3OKCA 5JSYA 2YWJA 2CV1A 2WWXA 3JU3A 2O2DA 1R1MA 1NBIA 2AC4A 1XTZA 3LNMB 2P4QA 1UMDB 1S72V 4Q9DA 3WWCA 1W4LA 3EUWA 5IXYA 1P6UA 4A2WA 2ZW9A 4R51A 4UM9D 1P2FA 1DV1A 4Y9RA 3CKLA 1FDOA 2JGUA 3EZ7A 3GYQA 2JH8A 5JLJA 1LK0A 1MJFA 4D9JA 3B48A 4W9MC 3IB3A 1CX9B 4EHDA 1I0LA 1MO5A 2A7XA 5HVNA 2OORA 4MR9A 3LF1A 1XHFA 2WTXA 3L6DA 4DBLE 4PIMA 5DHAA 5ALFA 3ZQ6A 1KMCA 3IKEA 3RUHA 2ZQZA 3O90A 3JR3A 1BOOA 2C2AA 4HN2A 4LXXA 5KUMA 4G84A 2MOKA 3DAYA 4JJKA 3UYLA 2DKOA 1RXWA 1ZVMA 4FYIA 2ZUCA 4S05A 2O50A 3TEMA 2XAHA 3BTSA 1ZDMA 4B3CA 4LQCA 3GLHB 2X0JA 4JUFA 4GWGA 5FA6A 3RJ5A 3T1CA 3RUAA 4B3HA 1WB8A 2HWKA 4BGIA 3DF7A 4GPEA 2EARA 4WF9V 2AW9A 6REQA 3PENA 1PVDA 3D0KA 4KW7A 4P54A 5THQA 1SUIA 1IONA 3V1UA 3HH8A 4MGIR 2WB4A 1LSUA 4HQOA 2XMBA 5JBQA 4QFCA 1B2LA 2UXXA 1RAGA 4X66O 2VUIB 4H3VA 5AHWA 1X7WB 2ZSDA 3PV0A 3W5DA 2RG7A 1CE8A 3RUPA 5DOZA 1QJCA 3MAJA 2I76A 2WFMA 2JFUA 4HNAB 1T5DX 2JVKA 5GV7A 3NJ8A 3SF8B 1JSLA 4JR0A 1GTG1 4BC0A 1P4SA 5D3ZA 1VE9A 4EZIA 4CF3A 3O8BA 2WK1A 3SBDA 3F9IA 3TJRA 3GCZA 2Y77A 3GU3A 1D6JA 4AKEA 3RKSA 4C6RA 2QK4A 4OQLA 3DV0B 1V5IA 4ZAFA 1MZVA 3UAZA 1VPLA 4F5EA 5CLLA 3K9BA 5AG2A 1TUEA 2JIZD 3RAGA 2GK3A 2OO5A 4B7ZA 1E77A 2XNHA 2V7BA 4G23A 4QE7A 1VKZA 4N5DA 1T4CA 3WNCA 3TGLA 4UCRA 3PU6A 3GJ5A 2FG5A 1FBTA 1N2HA 3BMCA 3NIWA 2JW5A 2PGGA 4Q1DA 4LOLA 4KNWA 3H16A 4ZRMA 4HDOB 5D7BA 4PDRA 2CCKA 3O9OA 3B7WA 3VVLA 2FDXA 2RDCA 4LF4O 2KYRA 3AG1B 4KXUA 1GRVA 3D54A 3STXA 4DG9A 3DZBA 4LV6A 5KNCD 1V39A 1J8YF 4TYYA 2EAUA 4PIPA 2NUPA 1BVUA 1XD2B 4UMVA 3B52X 4XARA 3GLKA 4HDKA 1CDDA 2P67A 2HBQA 1VF5B 3BRSA 2GS9A 2W22A 1ZLYA 2Z98A 1NG1A 1WD7A 3OZUA 1OZAA 1TZ2A 2Q4OA 5AOCA 1YJNF 5L4NA 3HDJA 1DKOA 4CG1A 3KYDB 4Q01A 3H4MA 3PLRA 4M37A 2VK1A 4FCCA 5JMTA 1BX3A 2HBZA 2BVNA 2DYYA 3D8NA 1YDMA 1CZUA 1WJZA 3TQQA 5A05A 4TTSA 1V47A 3ED5A 4S1NA 4HH1A 5EQDA 2CNWA 3HG7A 4BYMA 4MUNA 2QLJA 1THTA 5ELLA 4E7OA 3Q8WA 1Z0UA 3CW2A 1SUPA 3D3EA 1GRCA 1ONNA 1Y4AE 4RY0A 4F4CA 4DRXB 5LBTA 3U26A 4ZOQI 4OH7A 1IWBB 1NHWA 2QKAA 2F4VB 1OHHG 4MQFA 2VNAA 4LHVA 4G5RA 1H05A 5K0FA 2EOAA 5CT4A 3RIEA 3L0YA 5JTTA 1R64A 1UK8A 3LUFA 4URWR 1XMQB 1CZLA 4DLVA 1OYWA 5DCWA 4UTNA 3TRKA 1TZJA 3QEAZ 3WL6A 4F84A 3DKIA 1CKEA 3OWHA 3R3WA 3PE6A 4FP9A 3DUWA 2AHYA 3B89A 3QLUC 1L3IA 5IW8A 4EB0A 1QP7A 1MV5A 2SCUA 4P93A 3VPGA 2HI0A 1M5TA 5JJCA 3AIMA 3GCWA 3U60B 2NU7A 4W1SA 3L43A 3OHPA 4YJ3A 3C90A 1CY7A 2CBGA 4B46A 1TADA 3CZPA 4WNYA 4WNAA 1QR6A 1WNFA 3ZCXA 1XI2A 5FYQA 4K9OA 1AQJA 4QOJA 3PEEA 1Z07A 3S3TA 1E4OA 2OE2A 3HNPA 3PTLA 4EY4A 3MUNA 2DETA 2O06A 1KYVA 3HR7A 4OY3A 1IQUA 1AMNA 5H6RA 4UEQA 3CNQS 2VO1A 4US1R 4WLOA 1S3FA 1PD0A 4X0EA 1P8AA 4EKGA 1CF4A 1JN0A 2GZSA 5A9RA 2C9MA 4FXPA 3TLKA 1IC6A 1P60A 2KI5A 3EVCA 5D3QA 2ZR9A 1VLMA 2BF7A 1TJNA 2WFLA 1DQZA 1H93A 2D62A 2ONCA 1GA4A 4V39A 4RZXA 4AKTA 2PMFA 1WCIA 3R3XA 5KQGA 2FWPA 2ZRQA 2DFKB 1KZ9A 1G8YA 2NNLD 1SXHA 4JTAB 2I6SA 3N6RA 3SYKA 5DHTA 5KZMB 1Y3BE 3O0DA 3KQHA 1ZH8A 3L3BA 3CH6A 2E2WA 3F7VC 4MVJG 2ZRCA 4LXGA 3E4DA 5T57A 3B7PA 3A2MA 2O8DB 2NVUA 3L73H 3WIDA 4CVNA 4ERHA 3VR0A 3VNAA 3NXSA 3FMPB 1JFVA 2HDHA 2NP7A 3JYQA 2I8LA 2VRBA 4JC8A 2JJ2G 1X9HA 5BORA 1C4KA 4ONEA 2FJ0A 1E2PA 1T1EA 2PT6A 1JHYA 4W7IA 3GELA 5HF8A 4C82A 3GJZA 2DX7A 3L8GA 3ONFA 2XMSA 3QHAA 3TLZA 5F7ZA 2EP5A 3BL6A 5L3SB 4TYWA 2ZBGA 1QCYA 2AG8A 2WQZA 1F38A 3P10A 5JISA 3DO6A 1J2UA 4BECA 1YONA 5IHPA 1U8AA 3DEAA 1ST3A 2PUWA 4G1CA 5AI6A 3V34A 4KOAA 4DY6A 3GRZA 1YQNA 2QD3A 5CBHA 2PZKA 5HG0A 5IJ0A 2RH4A 1IBLO 4CV2A 4IQGA 1PJBA 5KYYA 4B45A 4KQJA 3KETA 2Y1GA 1LF5A 2QT1A 4A7PA 3QU4A 1TKRA 1I4DD 2P9HA 4PFKA 2C0PA 4QT4A 4NDAA 2JEZA 3P0FA 2EILB 1NYQA 2B83A 5IH7A 3FVVA 4E4RA 4XVRA 1E2GA 3H6KA 4B09A 3CISA 1GO3F 2AZ4A 4Q4LA 1ZUD1 4KKXB 3WBFA 1Z82A 2JIBA 2NZYA 5G4KA 5GGXA 1Y8CA 4J49A 3KLMX 3EXG2 1H2NA 4GI7A 1GGJA 2CB0A 4Y1EA 2Y69C 2OSBA 1U3PA 2V7WA 5AXBA 1G98A 1SY7A 1JEAA 5BVHA 3EXEB 2EZOA 1A8IA 4IDCA 1W96A 3J7TA 4EYOA 1T1IA 4PN7A 1SOAA 4CQMD 2YWBA 2BZSA 2PRZA 3L4JA 1BXKA 2UZHA 1OCZB 2P4VA 1DUSA 4QD3A 1VRVA 2WOJA 2V9YA 5MDHA 1JALA 1UXHA 2B1RA 1A98A 3OTOO 1BIFA 2CVLA 4NE9A 3SM3A 3GFFA 3FKJA 3F98A 3C3WA 3W78A 3PHLA 3LK7A 4DA0A 2ZB3A 2BEVA 3KKQA 3QE4A 4ZANA 1VIDA 3W9UA 2WUFA 3FB6C 4PRYA 4B4UA 1KI6B 1PZEA 3ZD7A 2V7QD 1KJ8A 4HS9A 2R47A 4MKRA 3PJSK 5GPBA 4RK0A 3BE6A 3EBOA 3MJSA 2AT1A 1MJNA 1YOBA 2G8LA 1GGVA 1Q5OA 5TQJA 1ZX1A 1QVRA 4JLKA 4GE0A 5LXTF 3L02A 1EN5A 3L7KA 3LQ2A 2YVKA 4L0CA 3TZHA 2OGZA 5TRTA 5CDYA 4ETNA 1JWLA 2EW1A 4EVIA 5K45A 3NEPX 3P2IA 1H22A 4CV3A 1NT2A 2UZIR 3OJFA 3H75A 1AJPA 3RUIA 1QRRA 4ARSA 2C7OA 1EJ2A 3SK0A 2VHTA 2DR3A 5I7WA 3INTA 1P18A 5IXSA 1DDIA 1YZYA 2QWPB 3OEEA 4I2VA 5LQCA 3CNBA 4E2LA 2GXSA 1WL8A 1KPGA 5DZSA 2EBWA 4TZTA 3RVDA 4GKJO 1M6VA 3N75A 3JSAA 3NT5A 2Z09A 3UMJA 1E1KA 3OLWA 1JIVA 5F77A 4A3SA 3ZO8A 2IQQA 3R24A 1Q0SA 3O95A 4AICA 1JDPA 1EFVA 1ZO8A 2AYZA 2CDBA 3CLTD 1W88B 3S68A 1JKXA 1YR9A 3HNOA 4PAGA 1TMGE 1KKMA 2A5DA 3LSSA 3QF4B 4FS8A 3ZCVA 3IFSA 1SQFA 2V7PA 1WW8A 4LZOA 1EUCB 1TU3A 4JT4A 2FWNA 1P2SA 2AFHA 2PUHA 3QNUA 3WGYA 4UM8B 4RTNA 3DNPA 1Z2EA 1EBFA 4IYRA 4OA5A 1MVLA 3MHSC 4LZJA 1T5HX 1GK9A 3TOXA 5D6OA 1ZXXA 3HVHA 1ZU5A 4W6QA 4UVCA 1N32O 2X5XA 4BP3A 4M1YA 2DT8A 4RVFA 5AW0A 1D2GA 2MSWA 3GLFB 1VI2A 2I34A 3AUAA 4ASUG 1EWYA 3ERCA 4GOXA 4BQRA 4UDNA 5JMPA 2XWJI 1GN9A 4TLMB 1VQ6V 3DPSA 3PNLA 4KVGA 4RVDA 3TOZA 4LNAA 1KFBB 2IW1A 3A0RA 3B2EE 3EHEA 3OUTA 2P4EA 1VYVA 3MWKA 4JLNA 3TSWA 3L01A 4QOIA 3L93A 4JLWA 1JIIA 1PFVA 3DZJA 1Y6GA 2IAFA 1RRCA 4RZQA 3MAGA 1Z29A 2QQ5A 1J5PA 2XKAA 3K9GA 4R83A 2FX3A 1XZEA 3BFJA 5E9AA 1GQYA 1N6PA 3OG9A 4MGEA 2NV2B 5T8KA 1E3JA 1JKMA 2R5FA 2AG1A 3P0JA 1K5HA 1G1AA 3SJBC 4WX2B 3AGQA 4MI6A 1MZEA 3KJIA 4H0FA 4CS2A 4B81A 2G76A 4DMRA 3IUJA 5IYZB 4BJ6A 5L3BA 3V8BA 4MI3A 2OVBA 1DP4A 2AEEA 1H23A 2VWGA 4ZCSA 5B1IA 3SVLA 1VMIA 3TXSA 1E0KA 3N8HA 2HCJB 4OX9O 2HU5A 1E66A 3AY7A 3N28A 4FSDA 2WLLA 1JGTA 4BO7A 3OE4A 1B0AA 1QQBA 2QJWA 3SWWA 1H6BA 4JLMA 3V55A 1GPMA 5H3HA 4A6EA 2TSYB 4UVIA 1QO0A 5ADWA 3KSAC 2B4AA 3TQTA 2GASA 2Q2VA 1W73A 3EB9A 4MX8A 4DEYA 4KHPB 3IUQA 4W7HA 1Z8FA 3WE7A 1K8ZB 3MS2A 2GTAA 3FTDA 3B5JA 4MNTA 1AOXA 5JCZA 2MYPA 2CHQA 1M2WA 1MDFA 1J20A 3SSNA 3P19A 3E9QA 3G6EV 4NSNA 2IKQA 4P4SB 2WJJA 3FGZA 2NSLA 1IB6A 2I29A 4PYQA 3MMZA 2A5FA 3OUFA 3GDGA 5TF0A 4W5QA 1B4DA 4LRQA 4BLPA 4J0IA 1LPOA 4X6YA 4AY6A 5JS1A 3AH8A 1SQ6A 4RSGA 1Z6YA 4RLQA 5K3BA 4RF2A 3WZLA 3C4JA 4V24A 2HHHO 2DPMA 1UFYA 4CJXA 1P7CA 4DLNA 3JARB 1CUDA 3C1AA 1E8NA 3IUYA 2CEAA 2OG2A 1GNQA 1XCGB 1W0JG 2QAIA 1XMPA 3L40A 2X0RA 2PKEA 2O6LA 1S3SA 4BNGA 4P3YA 3GH1A 5EIAA 4IDPA 1L7VC 2CUGA 2QE6A 1F6BA 1GZVA 3H11A 2YOGA 5EXSA 3EASA 4MYTA 4WCFA 2YWHA 2NPOA 2OT5A 3RS9A 2ZIGA 4RKYA 3UT5A 1XB2A 4KXXA 1FLNA 2A9JA 2QIPA 1XZDA 1W9HA 2HRDA 3JPWA 3CZCA 3QA9A 3WYDA 3EX7C 1OX6A 2ZYTX 4LDRA 1R6BX 4YAOA 3FYCA 5DVZA 4Z54A 1MIOA 3HKCB 2DH5A 1YXMA 5HYVA 3TTUA 2RJNA 1F4MA 4UNIA 2O2IA 1FS5A 1FFBA 13PKA 2YHBA 1Y74A 3M6FA 1SBIA 1GUFA 2R2AA 1DOHA 2XRYA 1WXQA 2QUHA 3O31A 5F5NA 1U1DA 4ZYLA 2WG1A 1SWWA 3G9QA 4RD4A 1T0KB 2ZDIC 2RHLA 1TK2A 3NC1C 3LQKA 5KYWB 2JAUA 1R6NA 5CB4F 1XTJA 2B1IA 2QU7A 4TTTS 1TVKB 2EJCA 1G6UA 3QP9A 1N0NA 1FP6A 3CBGA 2PT5A 1O9HA 3W7BA 4XDGA 4JI0O 1QMGA 3K0HA 3V8NA 4HH4A 3WGJA 5ED4A 1M90H 1A96A 4NJMA 3BJZA 2ASEA 2VJOA 1GPLA 1Z06A 4TWIA 3FNEA 2OCXA 1QTIA 1XJQA 1QRAA 4F8EA 5CDHA 3PNBA 1CUBA 3ZDDA 5AHRA 2QGNA 2OWEA 3ZS8A 3E0QA 5YASA 3ECAA 4PSDA 4W5OA 2F1HA 4ABTA 3HM9A 3J80M 4BDTA 2WKQA 3E58A 1TAUA 1K4DC 3PEYA 3PGA1 1SUDA 3JQDA 2QMYA 4RFSA 3I62A 2BSXA 3BVPA 4LRUA 3WQSB 4OXRA 2QD5A 2YNMC 5A4JA 1QS0A 2D00A 2BISA 3QUCA 4WZBE 2YZGA 1BEZA 3UMGA 3NTLA 4B6OA 2E1RA 3QELA 3KZKA 3SYCA 3ELCA 3DGEA 3OZAA 3PDJA 1D2MA 2PHZA 4R1QA 2VSFA 1EFTA 2RDMA 3ZGXA 1NKDA 1H8HG 2JH3A 4MTCA 3A1SA 3JCZA 4H3SA 1P2GA 3GT3A 5AVJA 4ZRDA 2VNIA 1O5OA 3EMKA 3EEOA 3FOAA 2O4CA 1W30A 1AZSC 4PYRA 2DN9A 4AWXA 2A1TR 3S44A 4Q0MA 1GVNB 3CF0A 1NUUA 2W58A 3F7TA 3K0CC 4DUGD 2X13A 3HP7A 2QMEA 1XOUA 4C6HA 3PB3A 3UGJA 4N5HX 4YLEA 1YZBA 4NZOA 2X41A 4BEBA 2X5NA 2ZU0C 1XA4A 2UVPA 4C2AA 2VQ6A 3L4SO 3O2NA 3RS0A 1YO6A 2DTXA 4AP5A 3AG7A 3LY9A 2JEUA 4ZI5A 5HWEA 4MP3A 2I6XA 3OE7D 2I3GA 3QJ5A 4RSMA 3HYLA 1RQLA 4OHOA 3S5UA 5BW5A 4ZZ1A 3BTVA 4HGRA 4DR7O 1JBKA 3P2KA 3G9ZA 2ANBA 3D36C 1JE0A 1GQSA 3WGGA 4NZMA 3BRWD 4P8RA 2OKCA 2PEZA 1PNKA 3ZBUA 2QVGA 3DB2A 3EZFA 2PI4A 3E0XA 1YB5A 4WH0A 3ZZUA 3DLTA 4BIIA 4UNRA 4NS4A 1HLPA 3DM5A 4H1UA 1P4AA 1Q7RA 4L76A 4XIGS 3EIFA 3MGCA 4HP8A 3C7CB 4JCCA 4O5AA 2PUDA 2GJ9A 2D1RA 4RA6A 4MS1A 3GVPA 2Q3LA 4ND1A 4B6EA 4KI7A 3MJ4A 2F48A 2CNDA 3OKPA 4B5KA 3KQNA 3ETJA 4OPAA 3DHWC 3SJAC 1WQ4A 1K5DA 3H9EO 3ZRVA 3EPPA 4M22A 4MW0A 1M34B 4BRWA 2JS7A 3N0VA 1SUSA 4I0WB 3BK1A 2H4HA 1Q2UA 4P08A 1XV5A 5A3QA 3K08A 3SZOA 4QEKA 4YC7A 2QMHA 1WA8B 1FUUA 1FLAA 1PO7A 5G0SA 4KMMA 3UJ7A 3NOQA 3IDOA 3M1AA 1CRWG 4PAQA 1U6JA 3GF4A 3ONNA 4RESA 2ZRHA 2IY9A 4GNKA 1OASA 4GWKA 2TS1A 1XDBA 2H7XA 2IZZA 3SVTA 4JLPA 1KI3A 4JJAA 3TEFA 4U7DA 3T3GA 4HAUA 4ER6A 4GLOA 4UE2A 3NHKA 4GMFA 1PDOA 1RSOB 4G2NA 1VHDA 3MINA 5JCPA 3SAJA 4KYTA 5KJEA 4R8LA 2JGFA 3B85A 1JG4A 4CMJA 4X8OA 1UC5B 3E22A 1COMA 4IQ4A 5AMXA 2HXSA 3SHVA 3F7MA 4JJGA 1XKLA 5K0EA 3QKSB 1PVVA 3C85A 3KD3A 1JIXA 2V3WA 2W90A 2CVHA 3DT8A 2BE9A 1D03A 1ST2A 3UV3A 4D8XA 1C9KA 1ZJJA 4C0LA 3REFA 3JASB 4PO8A 3IMPA 3CN9A 2I8AA 3JCUZ 2FEWB 2GEBA 1KWGA 4P31A 1DXYA 1LLCA 3B3QA 3W79A 4K88A 3JATB 1G9SA 5BMVB 4J6FA 3I09A 5E4FA 3WO0A 4TPKA 3GDOA 1R15A 5IN4A 3KWFA 4RKFA 2UUOA 3VOUA 1WF3A 4JT8A 2FSGA 1GKLA 1KI4A 3MGBA 3FVQA 4K5QA 4B3MO 3MDOA 1P75A 2SKEA 1FX0B 1I9GA 5H68A 1XKTA 4MS4B 2A86A 5FJJA 1ULZA 4K9KA 1PG0A 3D8RA 1T36A 2AGAA 2DYRC 2BFBA 3SS8A 2P30A 3NO4A 4A0QA 3FB7C 3ZKWB 2ZRPA 5AKGA 3GZNB 4H44B 5GZ1A 4RO2A 2WF8A 1OW3B 4M7PA 5CDFA 2VATA 4MV7A 5SZIA 5EE0A 1CS0B 4JUBA 3FBWA 1N6HA 2I2FA 4ZA2A 3PFGA 4MVZA 2QUKA 5FTWA 3NNSA 3VO2A 3SFVA 3E84A 1F51E 4DDUA 5HY1A 2LWIA 2GA9A 1G21E 3ASOB 3BFKA 4FFNA 1KK3A 1PK7A 1Z39A 4BNTA 3PBKA 2UYJA 2PJDA 4C0HA 1X2EA 3ITKA 4ZT3A 4RGBA 3LHKA 3R9IA 4RKWA 2AWNA 4RJLA 1RSZA 2O0LA 3ILYA 1ZWLA 4C8EA 3JYNA 1M5RA 1B06A 5CA1B 3IT0A 5DPMA 2O2ZA 1ZI9A 3WG7B 3EZLA 1G8KA 2FDCA 1ZK0A 3KFLA 1YDGA 2RB4A 4E70A 1VE1A 1AZLA 2WIAA 3GARA 4TSFD 4Q93A 1OE0A 5K51A 2VJCA 1MB0A 5FPHA 5E2BA 2PX3A 4QULA 2DHCA 3TLMA 3I8SA 3I6MA 1NUPA 1OFIA 3U62A 3Q3EA 2XNKA 3PEVA 5ESDA 4DYDA 2JD0A 4R8VA 3KZMA 2PFGA 2HU2A 1KKCA 2J4CA 1FFCA 1NP7A 1VI5A 3IDAA 3JCMM 4HZ3A 1FFGA 2XOEA 1U90A 1NR1A 1RLUA 4MVJE 1ECCA 3QUWA 1SA0B 4PHTA 4GBGA 4ZAZA 3KIPA 4BV9A 2YFQA 1NI5A 1C9EA 2XTJA 2ADQB 5FBHA 5FWXB 4BFWA 1X13A 1E3WB 1GGHA 5KSPA 3DE7X 3LIPA 3W5SA 1RXEA 4WN3A 2IDJA 4QGPA 2AZMA 3W2GA 2VHYA 4H3HB 1GDDA 3O4FA 5GONA 2ZE7A 1N33B 3G2OA 4HWOA 3D6TB 4FJ1A 4YCJA 3U4QB 3I55F 1FP1D 1RM4A 5B3JA 2ZOSA 4F2HA 3TW6A 1X7GA 3ZNQA 4MVJH 4NLLA 3DT9A 4FMDF 2AIZP 4FEEA 1XLTA 3RLFA 4CR8A 4D4IA 2CNWD 4GCZA 3TJTA 4J2OA 4TVBA 2QWOB 2ODQA 3HP1A 4Q1AA 1XTBA 2P2GA 1Y4SA 4TKUA 1XWFA 2DBZA 4EI9A 4YCMA 4GL4A 3A6ZA 4CNQA 5K0SA 5JD3A 2XDWA 3FFWA 4R69A 1C5KA 2GRUA 1AKEA 3TK1A 4UM9B 2ATKC 4DV2O 5FBRB 4K6GA 5B8FA 3OQMA 2ORVA 2NADA 2QD1A 3PP8A 1YQEA 3SR0A 1HI9A 1Q1GA 3HE3A 3NBYC 3NG1A 5KTMA 5DBEX 4EJFA 2C88A 2N1MA 2N9UA 2GJ4A 3PKZA 3QPWA 2EZUA 3LLSA 1FS6A 3IOCA 4PC2A 4MVJM 3PHIA 2NN4A 5FPYA 2MU1A 3P2MA 4G2KA 3KU1A 1DXOA 4MWBA 4OQ4A 4ZVUA 4FIDA 4P7BA 5D1NA 5K3FA 3Q88A 5LQMA 4Y9UA 3K0SA 2G0TA 4NU0A 1M1XB 3IJ4A 1GAEO 5KHJA 1S9HA 1AXEA 2DQ4A 3O3CA 1BHQ1 2G5PA 3L84A 1NBAA 4DLUA 2AFIA 2DVMA 4RTRA 3LUHA 1MO3A 1J21A 3VR6D 4LF5B 5C3UA 3AEKA 2JFGA 4P35A 4Z0PA 3DZDA 1ZUWA 1KECA 1ONIA 2JHAA 4DV7O 4YAWA 4K9MA 4ME6A 3LHIA 4NQZA 2GNOA 2CHGA 4ESVA 3M3DA 2NU9A 1ABFA 3ZYCA 3HDQA 4QODA 2WAOA 4UBIA 2I6DA 2IYOA 1Z4KA 2XUKA 2FUG1 4CIXA 3I56V 3GGPA 1SZPA 1R18A 4HOYA 3GFSA 8OHMA 1WP9A 4KL8S 5H16A 4ZVNA 2C96A 4QU9A 3FJ1A 1TVCA 5EIHA 1ZWKA 1B41A 4YJ2B 2BONA 3ZDFA 4GYJA 4D0LB 3BMNA 2ZPAA 4HFJA 1JVSA 1PHPA 1IN5A 4M54A 3TXAA 1UBHS 4ISBA 4CCWA 3L7LA 3DC7A 1E7WA 4P3PA 1A9SA 5IWAO 2V1DA 4DQUA 4LWPA 1T0BA 2P9CA 2QL9A 3S03A 3SIUA 1KQPA 2R8PA 4IDAA 3VR4H 2K5UA 4BNKA 3BB3A 2GZRA 2JLBA 4G5FA 4GSLA 1Q11A 2PJUA 2P9GA 2A9RA 4RULA 5SYMA 4GW3A 1ZK4A 1CQXA 3M6WA 3OLYA 3Q12A 4FFPA 3U7JA 3GLTA 3TQRA 2PO5A 4MGHA 4HMQA 1E3TA 2WPNA 3D0RA 1Q82H 1Y7TA 4J9ZB 3W7AA 3R65A 1FQJA 1KYTA 1YE3A 2OCCC 2ZBFA 3DE4X 1RFGE 2FRDA 3OBIA 3FAVB 5C9ZA 1MA3A 3LFHA 5MFPA 3WIOA 1NVPD 1XTTA 2X42A 3DYIA 3K7EA 2YEVB 1DWOA 2XAGA 3K0FB 4AN1A 3BIJA 4TXLA 1DTOA 3BWEA 3NHAA 4B47A 2H1LA 1GYQA 1XDWA 4RK7A 1D1QA 1UZAA 4BO3A 3MS7A 4HX9A 1M1KH 5E38A 5ICEA 5I9TA 2GZAA 1QCZA 5E0OA 3A4VA 2BIFA 2IHBA 3LL4A 1IK4A 2RGAA 1L5KA 4CW7A 4PCAA 1QHHB 2UZ1B 3JQCA 1N5RA 4LBWA 2Z2KA 4CM7A 1PW7A 3BAFA 3FD5A 3H8VA 3RKUA 4D9IA 2WTMA 1ZMXA 5H8WA 3AVUA 2Q0XA 1T2DA 1OXTA 2ZNIA 1RWPA 2P9TA 2QR2A 1X1QA 4DG5A 1F8GA 3HRKA 3U4HA 1JIKA 1INLA 3TW8B 4YH1A 3I23A 2X4GA 4P81A 2FYTA 2HSZA 2PZ8A 4HFNA 3U9TA 2HWUA 5A3JA 3T4ZA 4RF4A 3SIXA 4V0ME 3R4VA 1N2CA 4XPZA 5LYJB 4K46A 3G2LA 4JNKA 1NONA 5IDJA 4ZYTA 2IW5A 5AJTA 2IV3A 2HWYA 4HVLA 5BOVA 2DKFA 1L5ZA 4Y2JA 4L0DA 2DEUA 3KJXA 4O3FA 4AUKA 1CV2A 3FCAA 3IAXA 4QKQA 4B9EA 1M54A 4EF5A 1CDZA 3HXTA 2DUWA 1BN7A 4DUGA 2W42A 3KQMA 1FXSA 2FQQA 4RAOA 5IAJA 2J5KA 4AXBA 4LF9B 3KCXA 1KJZA 2V6BA 2QL7A 4ZIRA 1K73H 5JG7A 2RCYA 3FETA 2OCHA 1U8XX 3T7TA 3GAAA 5DHRA 4P4LA 3IHKA 1G2PA 3C6ZA 3UJ9A 5ALUA 4B6JA 2V1XA 3Q72A 3CLKA 5A2QA 2QWXA 2ASVA 2Y68A 5U1PA 4Q39A 2HDWA 2UAGA 2HSWA 5K8CA 3A1VA 3UWSA 3PHCA 2Q5OA 4S04A 4HYTA 5EE3A 1IHOA 3ASZA 3C6QA 4BGVA 1QV9A 1YJWV 1GR1A 4R1SA 3DVAA 5AW6A 1YUBA 1OFUA 1L1EA 2RJ3A 4AP6A 1B6QA 1RRFA 5BY1A 2DLDA 5CEFA 4D9NA 3OEED 4KIGA 5EQFA 1PJRA 1NVTA 4A36A 2GTPA 1II8A 1RZVA 3OM0A 3WRXC 3FSRA 1S7CA 2RMKA 4FDAA 2V7UA 5IWCA 2O52A 3A70A 4GIBA 2GPTA 1ZAKA 2R8ZA 2WMDA 2WG2A 3D4IA 5B1BC 3DZCA 1ZEMA 4I3HA 3NWEA 2OY0A 3F78A 1V5FA 4GRIA 5JLAA 4WGGA 2I9KA 1XXHE 9ATCA 2BKUA 2W0MA 2YKGA 3W5VA 1MCZA 4TMYA 1ZLZA 4LCUC 4WK0B 5ELMA 1KJYA 3OEYA 1S2NA 2COUA 2P35A 1GZ4A 3H1PA 2ZM5A 4H08A 1TKCA 1CBUA 1KD1H 4WFIA 1I9CA 4IDQA 1XVVA 2DPLA 5FH9A 1DGQA 1TW2A 2I4IA 3ET4A 4LMBA 2A1TS 4G01B 2IC5A 3GFPA 3Q8HA 4A10A 1IM8A 5DGCA 2VAMA 5EJ5A 3ONWA 1ZINA 5A4KA 4F56A 1KDVA 1VLLA 1ZD9A 5EE9A 2J4FA 1EVLA 1WQ3A 4POAA 3L46A 3MQFA 4HNSA 3DLBA 4BFLA 3T9FA 2VT6A 1FNMA 2O1XA 1D0IA 4YRPA 4G5QA 2F4VO 2IRWA 4AN4A 3PNOA 3ZWPA 3ZJ4A 1W36D 3OHMA 3CVXA 1ORQC 1X19A 4AF6A 4QPCA 4OL9A 4FHCA 3DMHA 4KR0A 1SCBA 3DF9A 1CY4A 4ZVTA 4DA8A 2WMOB 3ZJVA 2LE0A 4OK3A 2AOUB 3BE8A 2XB6A 5CHYA 1IQPA 5EE1A 4TLEA 3K1AA 1TEVA 4WASA 4DUZB 5CFOA 4Y67A 1DEXA 2SHKA 4ZYZA 1PFGA 4L8VA 2ARKA 5H9WA 5K3OA 4IL5A 3MDSA 4CQMB 4JYBA 4E94A 2E0IA 3OR6C 4HGOA 4MHOA 3RS8A 3OAAA 1QUFA 3ORQA 1PJQA 1XJ5A 1Z4QA 4RA9A 4HQNA 1C1DB 3KOUA 1RYDA 1NBOA 3HWX1 5CD9A 3PTZA 1TIKA 2J6HA 3Q10A 1TUBA 3UJNA 3CZMA 5C1DA 3G71V 4S1VA 4NJEB 4BVEA 1I5RA 3LWZA 3EGXB 4E3WA 3SQWA 5JJIA 3T5BA 2EEZA 1O0CA 1SOUA 4GNRA 4BKMA 4BZZA 2IEAA 4KP4A 3NP7A 4MI9A 1TXGA 4EEKA 2BSKB 1QO0D 1K27A 1K5PA 3LP8A 4BQPA 1STOA 3D3KA 1N0VC 5KNDA 3HWUA 3AUUA 3CEMA 3QG1A 5D7NA 1IHXA 5L8VA 1TA9A 4MWSA 3SC6A 2W2NA 1YU6A 2XQIA 4QRDA 1DQRA 5JVDA 1Q6YA 4JBHA 3VOTA 5CJ2A 4JI2B 3ESJA 4TSFA 1Z5OA 3OGCC 3DL0A 1HG0A 2ODAA 1UKEA 2X2OA 4MDYA 1W8IA 4EPWA 3FCSB 4LE1A 1H1LB 1X7ZB 4A0HA 3NYIA 1F8YA 3KQPA 3E4CA 3QVMA 3R5XA 3SM9A 3L6CA 3GJRA 3OECA 1DZIA 2VPXA 2UYNB 1AXRA 4URVR 1UFQA 1XKQA 4R9RA 1QZ3A 3FLBA 5J4VA 3CPWF 4HY3A 1A9QA 16PKA 2XITA 3UO3A 2QMQA 4L7VA 1J9GA 2BGTA 2DWUA 4FI3F 4K6MA 3LBYA 3F1LA 2C20A 4PWZA 4LMRA 3C3DA 1TKBA 1KQOA 3LWDA 2RB5A 1ORIA 1XDGA 3NNNA 2P91A 5LOVB 1PT9A 4GKAA 821PA 4WN9B 4H0CA 1UXGA 3A1CA 1OC2A 5I8WA 4I1IA 3CCEF 1U2EA 1C7FA 1G3RA 2VF2A 3NMUF 5IYZF 4E5DA 3QWHA 4CTJA 1H2YA 5P8WA 1NVKA 4KYVA 3WGQA 2NUBA 4HDNB 4ICGA 3R5KA 3AOEA 5KA6A 1WPQA 4FT4A 3KTDA 4J9VA 1M1ZA 3KT6A 2YR0A 1P77A 1C3XA 2VHXA 2I7XA 4AMZA 2YXYA 4HEA6 2QAJA 1XKXA 1XPRA 2C54A 1ZN7A 1TQDA 1VQ9F 4YYZA 1Y82A 4D4GA 2CSUA 1W1WA 2OV8A 3UB2A 3DL2A 4BXOA 3TL3A 3ETGA 4IJ6A 1FLDA 1HFJA 1M2VA 1ODCA 5FPOA 3W8DA 4BS9A 3QLTA 4ZCTA 4KPYA 5H81A 4JI5O 4B4OA 1ZIOA 1OH8A 4Z4QA 4BUCA 4C1BA 2G7MC 3CV3A 5I6DA 3QSGA 4KLZA 4IOJA 1E79G 4AJ4A 3DKRA 2VP3A 5F1KA 2I4TA 1QIKA 4LX0A 1IH8A 1SIWA 1F7UA 2H6LA 4P5PA 4G0WA 4G1EB 4MQ6A 2EJBA 1JTFA 4DCSA 3LDAA 2WKPA 5AKLA 4JQZA 4RHUA 1Z15A 2QAGC 4TZZA 2OD2A 5E9QA 1O3YA 3ICXA 3ABTA 2GH1A 2IS6A 1GY8A 5A1JA 1RQ7A 3P9IA 3V8MA 3GGJA 4GXQA 1W1IA 3VR6A 4XJTA 4L4RA 5BQPA 4PIVA 2WSSG 1J00A 4UDXX 5JYEA 3DD1A 4DQ0A 3SOPA 1HRDA 3JD3A 1E58A 4DANA 3D8HA 3HRHA 2YY7A 3B8NA 3LF2A 3TD2A 4PFQA 3ROPA 1XVTA 4HLQB 4DCGA 4URFA 4DV1B 3QPAA 3OWOA 1SVKA 4KP7A 1JF8A 3IVAA 4GI1A 3ACDA 3LHDA 5FTNA 1NJ5A 3P94A 3PDIB 5KHKA 4LHYA 4LX8A 2H1OA 4QSHA 2OXCA 3JVIA 3PXGA 4CMEC 3GGOA 5A0TA 3Q1LA 3OU7A 2C3YA 2QRMA 4ZEWA 2HLDG 4XQ9A 2GPYA 3SHTA 3V7WA 3QUAA 5HCUA 2XGGA 1D4AA 2MIIA 3IP7A 4PLHA 3G5TA 3HBFA 4HWPA 3OFVA 5BNZA 1XK6A 2PAFA 4FC6A 4H6PA 4EY8A 3EG5A 4I5EA 4CTKA 3KLNA 1QZXA 4L8WB 3NK6A 5J5VA 2YWRA 3WLFA 4KWHA 2RI1A 2MSCB 3GZTB 5HFJA 3OZCA 4FOSA 1XCBA 1TQ2A 4JOQA 5TIIA 4PGGA 5DNWA 2A5LA 3QUSA 3FIJA 1BEUB 2X8JA 2QL5A 5BR7A 1S0VA 2YV4A 1RIFA 5AI5A 3EA0A 3B9PA 5KVVA 3QBTA 1HP8A 5JANA 4P3NA 2B25A 4KPGA 2HUPA 3HR8A 4YCBA 4Q6WA 3P9NA 3BULA 2N1BA 3IIIA 1UBUS 2AV6A 4C22A 2H4JA 5JAOA 2GVIA 1ZNYA 3OE5A 4JGSA 5H2FZ 4JBGA 2FZVA 3FNBA 5KVSA 4LAFA 3HA3A 4YJFA 1U2QA 2DFPA 1NXSA 3DFFA 1I94B 1DBIA 2V6GA 1EU1A 3MAQA 1PQWA 5K8IA 5KNLA 3IO3A 3AKYA 5F7XA 5A3RA 5HZKA 1MTOA 1YR6A 1P0QA 1R0CA 4FCWA 4XBFA 3LY7A 3CUWA 1JS1X 2Z43A 1Q81W 1IBKB 5A2QN 3GN1A 2VPQA 1BFDA 1FDIA 1C41A 1PD3A 4E30A 3UCSC 5FXMA 1OAAA 2HHAA 4MAAA 4O2BA 3IV7A 2W2OA 2CLIB 3QNMA 3RGGA 2MINB 3TL2A 3DEJA 1OKKA 2R8XA 1IU9A 2W2VA 1WO8A 3HP4A 2QNRA 3S1AB 3P2OA 4DBVO 2VJYA 3WMEA 3R0QA 3CRMA 1H47A 1K7SN 3LLVA 1LU9A 2VDRB 5ICSA 3GQBA 4U00A 3OTGA 1ZZGA 4NULA 2YBDA 1YZVA 4GUDA 1UEXC 1V55C 3P2EA 1ELOA 4UV9A 3GRRA 3BMOB 4FLMA 2P2ZA 3B51X 1W55A 1I7FA 3OZBA 2G06A 5ADHA 1GT6A 1LRKA 5IDVA 2VAPA 5LZ5A 1X7HA 2I6RA 3WLEA 3MMNA 3C6BA 3HXMA 1T9GS 4UREA 5CFLA 3G6BA 4G0XA 3RJ9A 2VNHA 1U0EA 4OU4A 3PD7A 1YZNA 4HGNA 2O4UX 3AX6A 4ZQFA 4MA5A 1IVNA 3J81M 1Z4PX 4C9BA 2OILA 4OSEA 4C6SA 1SVWA 1HL7A 3DMTC 4ZCLA 4Q3KA 1VSUA 2VT3A 4CLOB 3NBUA 5EWMB 5KYUA 3IGFA 1BGYH 2IDKA 2ZUDA 3RSZA 3FMOB 2QRVB 4AQ7A 5EC1C 3HBNA 1GU1A 1OIXA 4DGSA 3JWHA 1ZEJA 4AUNA 4F12A 3M4SA 4TMWA 3T1VA 2A0YA 4IPTA 3VNBA 3AI7A 2GZMA 5CFZA 3I9MA 4Y1RA 3QTCA 1KO8A 4JDUA 3EAGA 3ZWVA 5HY0A 3U16A 1US8B 1SHJA 4IIFA 2R8YA 1T29A 3SVZA 3Q3VA 1G5HA 4FUTA 1NP6A 3ORRA 1IZ8A 3AM4A 4QGAA 5DHPA 3ZHVA 1XQ1A 4L5AA 1EINA 4GP6A 5KU1A 3BHJA 1UT8A 3WDKA 2Y9MB 3WYCA 3J7AC 3G67A 3SJAA 1NBHA 1IEQA 2QN1A 1LBSA 2AI1A 4NYJQ 1NNI1 2A9VA 4J16C 1YU9A 4G1FA 3U3RA 1G9TA 1N3BA 3O4JA 3RKRA 1NNSA 3FYUC 2WC1A 3G79A 4MW8A 2CEKA 3L06A 1Q21A 1Q7CA 4O4HF 1BE3H 1ZQ1A 4WJLA 1VRWA 3PUIA 3WJPA 3PFWO 2I1QA 1BHSA 3DDZX 3WZMA 3PQ2A 3E20B 5HS4A 4LYDA 3ER6A 4P4UA 4FZJA 3OZVA 4JODA 3F6RA 5AVVA 4BX2A 4XRGA 3TCUA 1SD1A 1IBCA 3DM9B 3HS3A 4QBFA 3RC9A 3VTKA 4ZVQA 2BM0A 4LY0A 5FA8A 4TKLA 5ECYA 1VLZA 4RVGA 4O1MA 4JLJA 3HCWA 2AR7A 2XUPA 1SQBH 4IVRA 3DOIA 5AM0A 3ER8A 3MRTA 2M6SA 3ZGZA 2O8CB 2LKCA 2QUIA 3TQCA 5DLYA 2W6PA 5BMVF 2ZETA 2ZR8A 2FJPA 1C7RA 3I37X 4UATA 1AS2A 1Z7WA 5JS8A 4MUHA 1MP0A 1DJLA 3MCUA 2V97A 3RW0A 1ZCZA 3GEGA 2WP0A 2B2NA 3OCYA 2FRXA 4R9VA 3B38A 1HURA 2Q0SA 3NHUA 3R7AA 2I1WA 1ZMBA 3CSDA 2ZSHA 3WJ1A 3RVLA 4W99A 4I4IA 4IFIA 4WKOA 2PGDA 1KY5A 1QGAA 4LEIA 2J46A 5CBPB 3X43A 1CZRA 3UEOA 4Y6RA 3UVEA 3PPXA 3IPYA 2J41A 1E4EB 2V4MA 4YACA 2PMWB 4ZALA 5I5EA 3O5AA 1FUEA 1NFQA 5GJCA 3QGMA 3WPXA 1NWHA 3E8SA 4BQFA 1E2HA 3CYQA 1RPNA 4O5OA 1SF9A 5FJIA 2CJFA 1GRRA 4XDKA 2KTUA 1FRQA 3L8EA 5LU9A 4MUBA 5CA1F 5FF9A 3SX4A 3SYQA 4H31A 5TISZ 3BD6A 1FUKA 5J2TA 1HA3A 2HWWA 3NHFA 1JJ2U 5CMUA 4MR9B 4ZU3A 5EP3A 1DAHA 4KXRA 2VSYA 1CEEA 3FYHA 3QWFA 3TBFA 5JASA 4ILEA 1SPBS 1GVHA 1R1DA 2O3RA 1BSVA 1Y66A 3F8SA 2G63A 3K3WA 5DCYA 3FZGA 5C8XA 3VQVA 1A04A 1KAEA 4I3FA 1IXSB 3ZW8A 3OD5A 2RGUA 4LJ7A 2W37A 3RVSA 3BORA 4LMAA 4ZTZB 1NLYA 4Y2UA 4K9PA 3LWRC 5TPZA 1O87A 3TR5A 3W1WA 4UNSA 3G0HA 1JQKA 5CBGA 5CG1A 6REQB 1OYOA 1VL0A 4XLLA 1P5RA 3DCJA 1S72F 2WD8A 4NCIA 5CUQA 3RWBA 1NV8A 4G63A 4PLYA 1KDPA 1VBNA 5HZGA 4QL3A 4Y7DA 3FNIA 3TLYA 1FVFA 5K2OA 4D92A 1N5LA 4WZAB 5DB4A 1CE8B 4Z2AA 3DL7A 4DSUA 2DSTA 5I8ZA 1S96A 2IHTA 4WERA 1A88A 1MGOA 2NN3C 1CK4A 2HDNB 4QG7A 4AAYA 4MHTA 1FOEB 1I2CA 3F67A 2HA4A 2Q4BA 2QHXA 4A03A 1DTSA 2NGRA 2QROA 4CL3A 3U3XA 5KO2A 1XDZA 4JSYA 3ZLUA 1XAGA 3KSBC 1QRDA 5EJ8A 3TGPA 3IX7A 5KQRA 3ETEA 1OTYA 3WJQA 3TLEA 3VTAA 1L7XA 4HXYA 3I9OA 2DYKA 1GDHA 4RE5A 1TUEB 4EKYA 3CF4A 1J99A 1MH9A 4HHEA 5LQAA 2R9RB 5AM3A 3PZBA 1T4CB 1KSFX 3HZHA 3B8EA 3RBVA 5HKAA 1ZOSA 2X4DA 4ZCQA 2QX4A 2Y1WA 3BMCB 2PQMA 1MAWA 3FVRA 3UV7A 5FBLB 1EVQA 4B31A 3U6BA 4XB2A 4DWOA 5HK9A 5JT1A 1KVRA 3ZCRA 4MO2A 3WIEA 5JNRA 4DK1A 3O4HA 1B0PA 4CI9A 4C3ZA 3W7WA 1KOJA 3GRFA 1YJ9F 2I87A 1KU9A 1PUXA 4L5JA 1VCIA 4P4GA 1SEVA 4JLAA 4XDLA 3NVAA 3FRJA 5DSZA 1ZY2A 2H1CA 2ZXEA 4PR0A 3VZDA 2QM4A 2NUPB 5AUQA 4DZZA 1JH8A 5EVCA 4NYIR 3ZHZA 3BGSA 4B79A 4HDKB 4J0CA 4ND8A 1G17A 3CCBA 4M7OA 5JZVA 1PM9A 3PUHA 1Y80A 2ZTSA 2IYPA 2W4QA 3TQSA 1O94C 6YASA 2FX2A 1IURA 4JBNA 3L4EA 2EL9A 3KQUA 1MC5A 2FG6C 4BB5A 2OIGA 3HM2A 4HVTA 1EP2B 4WMLA 3G1TA 5B58C 4QPDA 2H2GA 2XKBA 4YRIA 1U0SY 4D4LA 5FL7G 3IA7A 4LDQA 2J6BA 3MG9A 2PPVA 1CQIA 2HLHA 4GPIB 4QGGA 3PC8C 5IYCO 2ODBA 1YXBA 3G49A 4AROA 1H66A 2I54A 4EKDA 1M10A 5EESA 4MQFB 2FSVC 4QO8A 3D01A 1GXSA 1FDSA 4UTRA 2VEDA 1I5OA 2X2EA 4HCJA 4P92A 1QV6A 3I12A 1QQAA 3KV1A 1U2DC 3T1NA 1HE8B 2I99A 2AZ0A 4IFEA 2V65A 2VPIA 4UHFA 4ZVOA 2VDJA 3TRJA 2RHBA 2Q1UA 1G5IA 2YV1A 4WT7A 3C3MA 1X74A 3WO1A 1DO8A 4BQNA 5LN1A 1MGPA 2XT0A 2SCUB 1FDTA 3P32A 4RE6A 1D07A 3MLAA 3IV6A 2FP3A 3PR1A 4PAOA 3P20A 2NU7B 3RTAA 2PM8A 3TPZA 4DLPA 2XMDA 4TRRA 4YJ3B 1IAVA 4AD8A 4WNAB 3L0ZA 3HA7A 3HB0A 1N7HA 5AW8A 1VJTA 1Z36A 2ZRJA 3G0CA 3IKMB 2WNHA 1Q1AA 1SJ9A 1DBVO 3BXGA 1FW6A 3ZU2A 4DV3B 1NNUA 1HE3A 4LWOA 2VDWA 2FPLA 3B3FA 1WU7A 3BREA 3E18A 4Q7EA 4IHJA 3PFBA 1N7JA 3ND6A 1QFSA 1FMTA 3RVKA 4MW5A 4NWIA 1VE7A 2QN8A 1JILA 4P9OA 2XUFA 3RUDA 1BD4A 3LSYA 3GNLA 1LFAA 3NVIB 3HDHA 3O1LA 1TAHA 4I1OA 2ALJA 3N7UA 3INGA 1KB9F 1S89A 2IELA 3F2VA 3WB9A 4YAEA 2CGEA 2WFLB 3FNQA 4I9GA 5KINB 3E3AA 1WCIB 4KXQA 4XIJA 2GK4A 5BRJA 4D3FA 4RJ2A 3E81A 3OQJA 5JH7F 4G67A 4PELA 3QRWA 3RPEA 3CX6A 2NPFA 5CVDA 3ZZMA 2O3JA 5JD6A 3J7AU 1ZBDA 1PV1A 1CW2B 5ED0A 1OD6A 5AOAA 4OTZA 2HA6A 1IMJA 1EX1A 2ACKA 4PM4A 2OK8A 5AW1A 3ZHOA 3OJEA 2AMLA 3E70C 4ITRC 2NVUB 3WJRA 3IEXA 3LQQA 4C4AA 4O29A 5JXGA 4TXNA 3QO7A 1SCAA 2C0CA 3UMVA 4J2HA 2WZCA 3I5AA 3M5WA 5FORA 3NVKI 4QFBA 2PSEA 4J7XA 2ZUFA 2LO1A 4W8GA 1BRTA 5DN9A 4I7EA 1ODKA 1B3QA 1COZA 4DREA 4CRWB 4XXHA 3MCAA 2V7EA 3LXUX 1P0PA 2YRWA 4NIMA 5LB2A 1QF9A 3V4SA 2QD4A 2JD2A 3HYNA 3AHDA 5K0BA 1EFUA 2GF0A 2QA4V 1HNZB 2AUMA 3FPSA 2M9MA 3GX1A 2B3DA 4U9IS 4ND6A 2DWPA 2P3QA 3VHLB 1JI3A 2IF0A 5EJAA 3DAOA 4NG4A 4K6CA 3NH6A 2Z9BA 2Q68A 5IJ0B 1AKMA 4BZQA 5KYYB 5IUJC 3ITDA 2CHVA 1P0MA 5FLXA 1MT0A 2IYXA 4CR7A 2EV9A 4UHHA 3EXHC 3BHIA 5G4KB 1FE8A 1E0JA 4DAOA 3FGNA 2VDVE 1B8VA 4E2WA 2Y2VA 4IIYA 1JDBC 2GTHA 4D6XA 2PL3A 4CTNA 2GPNA 4H7PA 2QTOA 3SIVA 2V58A 4BVLA 3NC4A 3EQ8A 3NPAA 5BVHB 3KEOA 1PKEA 4X71A 2X5OA 1WUYA 1TIBA 1SBQA 2NZ2A 4C0KA 1GNSA 3DP9A 2EGHA 3KUUA 2X9LA 2YQZA 4O63O 4JUDX 2PH5A 4HWGA 1B8UA 5CD1A 1RBZA 3OAAD 3EDRA 3PE4A 2O3TA 4LPKA 2C1XA 4XLZA 3WYGA 4ITUA 4Z4IA 1SC1A 1IJFA 1RRKA 5BN3A 3II6X 4LF5O 2EKPA 4Z0TA 1JECA 1XCOA 3DBRA 4GYWA 2FPKA 4P34A 1GL3A 4CV0A 3V80A 1SB8A 3MEQA 3QKUA 1M5UA 3MCTA 1DIRA 2BEVB 2KE5A 3I2JA 4L9SA 3RSCA 1E5VA 2RHRA 1S02A 2DWQA 3RU7A 4MR7A 2RAFA 4AXXA 5A0VA 1VA5A 3I9LA 1RLOA 4BNYA 3LDGA 1C7ZA 3T5GA 2RGNC 2UV8A 1LW7A 5FP0A 2PFSA 3NUQA 2ZWMA 4E03A 4URYR 1RI4A 3QV2A 4EX6A 2IPNA 2APJA 5CCEA 5FPPA 1RHQA 5KNDD 2W2MA 2TECE 3A6JA 4ZICA 2WIFA 5H02A 3TTTA 3GGDA 2ZT5A 2E37A 3QOYA 1KQGA 3NEAA 3LZ6A 3MUFA 1FLVA 5FPRA 1V1JA 4C6TA 4LTMA 1NT2B 3EQ2A 3GEDA 1XWIA 3M9XA 1CERA 1ECJA 3SG0A 1L1RA 3A7DA 4NARA 1RU3A 1M1YE 4DZRA 1N8SA 5AQEA 3PRJA 3VX4A 3I5UA 1XK7A 2HMYB 1EYZA 4G0MA 5JW6A 3OX1A 1FRNA 1M6VB 4ZVKA 1H8EA 3PKJA 1IXMA 3C1TA 4M9SA 3REOA 1HSOA 2C5LA 5KWSA 1CTQA 1IPAA 2HA3A 5GM1A 2C1EA 1EFVB 3W1EA 1ZM2A 2HOQA 2FETA 4DEVA 3SR4A 3ZE8A 1TUIA 4OHKA 1CHDA 1U65A 3IA2A 2D7DA 3ZU6A 3P4EA 4LOHA 5BSKA 2ILTA 4MWCA 5JXWA 1O4VA 3L2OB 5EZ6B 4PPNA 2H1HA 1BU8A 5THXA 2YQ4A 1RHKA 2AFHB 2RN9A 4R1UA 4X7BA 3RREA 4OF4A 5JQGA 3AIOA 3NBQA 4YRFA 5DW3A 4Z1MG 1FJGB 1IQ0A 1R5BA 3U1TA 1BHO1 2DFTA 2XE4A 3O85A 5AW9A 4AURA 3GDFA 1AB6A 4ZZ3A 4J1QA 2QZ4A 4ICIA 1QKJA 4HVAA 4QXMA 5CP8A 1TLTA 2WUVA 1WMFA 3GUYA 1KZYC 1XRLA 4TTRA 2IVZA 2QTVB 1EESA 3E7XA 3RYHA 4HYYA 3A0RB 3DBHA 3K70D 4IX9A 4DM4A 2PMEA 3M81A 3ROZA 4I1VA 3S8YA 3OEHD 3HCOA 4INPA 2XSZD 2DMXA 2P3SA 3H4IA 1X4TA 2FJUA 2QTTA 1HTTA 5ALOA 3MT8A 1RTTA 1YBFA 4EFKA 4NU8X 4BWVA 1HYHA 5I4IA 5H83A 4MLDA 1DIGA 3K1TA 5EG5A 3U5ZB 1WABA 4N0EA 1AZTA 1QK5A 2ZSFA 4X7RA 5AJXA 3JYCA 2PU5A 1W5BA 4YXFA 2B5VA 5KPDA 2GVNA 3I32A 4AYXA 1BDIA 2RBGA 2LGQA 2H5EA 2KGWA 5LOVF 2X0KA 4R2KA 1CUFA 4YK7A 4CODB 1QFXA 4EG7A 2VP2A 3AIKA 2YWEA 4PY2A 3GFBA 3COPA 1RWKA 3VTIC 2C98A 2OCBA 3ZN2A 1Z4JA 2ETVA 3CT4A 3EGDA 1Y3HA 2H1RA 3URKA 4A2QA 5GOZA 2WLLB 4LCKA 2HF7A 1Z4IA 3TO5A 3LO8A 2XQJA 4JR2A 2OMEA 1XTVA 1ZNXA 3Q7TA 5HKOA 1C3EA 1PQ4A 4D1YA 4S1PA 1I7SB 2Q50A 3ROMA 1RJGA 1QIDA 2ZWIA 3R3SA 4LVUA 3VJKA 1JKIA 2CH7A 4DV0B 4IX1A 1C14A 3L0BA 2WWHA 4QUJA 3LWQC 2NM0A 3HGQA 3AW8A 2LR0A 2QTMA 1YJBA 4HPJB 4DO2A 5HF9A 4WE3A 1KYQA 4QXAA 3KQQA 4JH0A 4P80A 1ISRA 1S8NA 1EGHA 2I55A 3ZEAA 4FW9A 2B4QA 2ZBRA 1N92A 2E76B 2ECKA 3LX5A 1XROA 4NBNA 1AUVA 3I04A 3BSYA 3QLUA 3DDNA 2WA2A 3I6IA 2QQ0A 3I39X 1M7BA 1SCNE 3TVYA 4NU6A 2FEXA 121PA 3C5WP 3U7EB 3B1YA 4EGJA 2ZDQA 1PGJA 4QVIA 4W9RA 4EUHA 5B12A 4IEEA 1XEXA 3QHDA 2XZOA 4X9XA 1RJWA 1QO7A 3TNLA 3VYTC 2FLWA 4BMDA 4Z9BA 2F6RA 5TQVA 3N2KA 3RI3A 1L2TA 3DQQA 2FU5C 3AHHA 1NHGA 4W6ZA 5K20A 1KY4A 3H11B 1ZVQA 4FHZA 4ZV7A 1LZLA 2ZQYA 1BROA 4YMWA 3MOIA 3K8QA 3DH0A 4WCFB 5HBGA 3RRNA 1SD5A 2XTZA 4S1OA 3G6EF 2EWCA 1NMEA 3UT5B 4D8VA 2JI9A 1FYEA 4QDJA 3SKYA 4H0LB 4IUBS 2Q5CA 3KSMA 1O0BA 3ORFA 1EQUA 3OPYA 1SKUA 2HA5A 2R66A 3CCSV 2R00C 4YJGA 2N05A 2A7QA 5A4FS 5KTOA 3LBHA 1VHTA 1SUBA 3P96A 3S0JA 3VNVA 2A92A 2WM9B 5AJWA 1Y74B 1PCXA 3OJOA 4DT1A 1TT5A 4OJTA 5I7EA 3GVMA 4DUPA 2F43A 5JEDA 3BILA 1OKKD 4OHMA 5K7SA 2OSVA 3KTOA 4B4DA 1U0RA 2IYVA 3L1IA 2YS6A 4KOEC 5M5BA 3MELA 1BDHA 3UMBA 2JLRA 4C07A 1UXOA 3GJQA 1U43A 3E82A 1P17A 4EG3A 5JSQA 3L8ZA 3WL5A 2H8PC 4R4JA 4I99A 4K28A 4NJMB 2WTEA 2HF8A 3RAFC 3HN7A 4QXOA 1PLLA 3KE8A 3DMRA 2PH3A 3WLQA 1KEUA 3P5BA 1KPHA 4M9RA 1HG1A 3L9WA 4RPHA 4XD7A 3W4JA 4YASA 4JL5A 5TGDA 3HJBA 4I0XA 2R8RA 4E11A 3E83A 4G3XA 3DZGA 3SXUA 3BUSA 1R74A 3IXQA 4ZMRA 5G3ZA 2CFIA 3GDWA 4JU9A 3C5CA 2CZWA 3JRNA 4XJXA 3RG2A 2X0NA 4G4YA 5DEIA 2YJZA 3ZIAG 4K9NA 4RFSB 2FXIA 5A6VA 5D51S 4DLBA 5EWLA 3STZC 3K6SA 1QS0B 5EIEA 3KJZA 3EUFA 1BX1A 2FR8C 1XZHA 3X1KA 3QELB 3M4NA 1NE7A 5E1AC 2P78A 4CH4A 2E4WA 2NYRA 1YCIA 4AG6A 5HIJA 2HRZA 4P2ZA 1YFZA 3LC0A 4Q9IA 4X6XA 4D7TA 1LH0A 2IP4A 5I4BA 3VYSC 3RYIA 1JHDA 2DSNA 2GZ2A 2PGLA 3RV4A 1M56C 3WR5A 2WTUA 2I6FA 2VBIA 3VI6A 2WRZA 4IJWA 2C2MA 3LC1O 4DCPA 1T5SA 1T5EA 3GP3A 2Z5GA 5EHZA 1W47A 1QGDA 4G65A 4DLLA 4GQBA 4YEDA 4G36A 5IZCC 1PQYA 5FLXN 4DIMA 3LDCA 1TIPA 1QLEC 3V7YA 3WLHA 5E2IA 1BJRE 4MTXA 3L92A 4JENA 5E6SA 3IODA 4JVLA 1RYFA 4N41A 2VTVA 3C4VA 3PFIA 1ISSA 4NOLA 2GFIA 2A9HA 4I9QA 3S1LA 1I7NA 2HP0A 2IYYA 5T4BA 2ZIXA 3LSTA 2UVPB 5KCMA 4GYCB 4I14A 4E14A 1EVJA 6ABPA 1QO9A 3RE1A 4EUKA 2ZR7A 5LMCA 5AD1A 5CM2Z 4X5OA 3B1VA 1R6DA 3RT1A 3IMKA 1G9XA 4JLOA 3ER9A 4NJOA 1VI6A 1A1SA 1JYSA 4I5GA 3LY5A 2W8BC 1BKSB 1KYOF 4MICA 2R7AA 3UHOA 5BNFA 3TLGA 5GP1A 4F9EA 1GSAA 4ANFA 3CSXA 1X42A 3ENWA 4UAVA 3OJXA 3C41J 2BFEA 4Q34A 3AYZB 3LK6A 3JD0A 3QENA 3F0FA 2DFVA 3PNSA 2Q4PA 2BZ1A 4UQLA 5E3JA 3LVRE 3EF1A 3DMTA 2G9VA 1GAQA 5AVXA 4LYHA 1IB0A 1K2WA 2RC5A 4ZD6A 4JT9A 4H77A 1E1QA 3QG5A 5DNVA 4IYHA 3E9CA 1J8FA 4DYLA 4HAXA 4MS1B 4FM9A 1VBKA 4ARIA 4M1QA 4ESHA 5KCZA 1USUA 3MB5A 1G38A 5LD2C 4L9WA 1LTHR 1XMQO 1NQWA 2HJSA 1SUWA 1V54C 2EATA 1PFKA 1KFCB 2A35A 5HOEA 3ZVKA 3ROEA 3Q7RA 4CM5A 3BL5A 4L78A 2WICA 2PQ2A 1F6WA 4C4PA 4RZ2A 2X19A 4YT4A 2DOKA 4FIPC 2D4HA 2HJ9A 2Z3VA 4HADA 4B34A 1H9AA 2YN2A 4K0KB 3NKVA 2PKYX 1T0IA 4FKZA 2W0XA 4B7CA 4JJ6A 4C0QC 4DR3B 3UG6A 1AQNA 4UXHA 3W7TA 3MINB 3AI2A 4N7MA 5JZBA 4TTJA 4RLHA 2UXCB 1BDJA 4TT3A 1NTZH 5TT1A 3CRRA 3E22B 1PG2A 5C8YA 3CKKA 4MLPA 1DLBA 2LRHA 5JPDA 1A9TA 1R12A 4KSYA 4FDUA 4HSGA 2M6YA 1M6WA 4BT7A 2IYAA 1A4UA 1WMEA 2ZUTA 4HX2A 2NG1A 5A5FA 1JMVA 4PSAA 2Q3CA 5KI6A 3C5HA 4OKSA 3KEFA 2QTGA 3TQIA 3WWEA 4X8HA 1J90A 4PQYA 1XVUA 4MV9A 4BKQA 5CT6A 2GI4A 3E2MA 3NHRA 1X2BA 1W57A 1W0KG 1ZOIA 3K9QO 1BS9A 1Q22A 1GOTA 4BV8A 1VLQA 2P5YA 3PRHA 4A8TA 1HLDA 1K4KA 1Q92A 5TPZD 1QU7A 3BIOA 2QN3A 4R3NA 3VQYA 4QDXA 1M2NA 4ZPJA 3KR1A 1M57B 2QX8A 1VBMA 2JAWA 3GAZA 3A7EA 2KSQA 2LCFA 3CVYA 1HDEA 5THKA 3P9XA 2BFBB 2FK7A 4XR9A 2DXIA 1TA0A 2DW4A 1F4PA 1HE4A 5ULLA 1WXXA 1XEQA 4A82A 1RHRA 4CR6A 2CJPA 3GJ6A 3GEHA 3QMMA 5LP6C 3W2IA 1AX9A 4KQMA 3DO5A 4Q47A 3X1XA 3GCGA 3ONEA 3T1OA 2IHJA 4DBLC 3UGKA 1HZZC 1UC8A 2Z3ZA 1TM7E 3SJUA 3T2MA 1UKAA 1SELA 4OB6A 1GILA 2AZDA 3C6YA 1YRLA 3WBKA 4E5PA 2PGAA 3N2LA 4MVCA 4HNUA 1D2CA 3AG5A 3N39C 2EJVA 3SJBA 3DC6A 2JAPA 4JMPA 2ZYSA 1FQWA 1S5JA 1EDOA 1YZHA 2JCSA 5HK8A 4LI3X 3BTUA 4EENA 3TQHA 1R3JC 2OFPA 2PX2A 4Z99A 4XUEA 2AVDA 1ZD3A 2O8BA 1H2RS 2FKAA 4X63A 5IBPA 4K9RA 3NWBA 2OV6A 2QWQB 1C0PA 4YQFA 4RTSA 4F7WA 4N3NA 1PJ4A 3BPZA 5H59A 2RK3A 5I7AA 1IHPA 3IQXA 3VZPA 1PR6A 3MERA 5KX5A 4OB7A 5EJ6A 1Z4OA 2P6OA 3WFVA 2Q7XA 1FP7A 4IV5A 4B5CA 4FIZA 2OT3B 1CIVA 4CDRA 5CAEA 5HF5A 3PIRA 4YAUA 2KS6A 1M7HA 1RC8A 3OEHA 2C9DA 3T12A 1VH8A 2HRRA 1O58A 5M29A 5J2UA 2XSZA 4BC1A 4MHSA 1IXRC 3KKLA 1RC1A 4J9YB 5JALA 3IS3A 3PC2A 5GONB 1BCSA 3NT2A 4CMIA 4DDTA 1YIDA 2DCUA 5IJWA 2PGIA 3T7CA 3FMFA 4DWJA 2H57A 2AC7A 4YI5A 3ZS9A 4A8PA 2HRUA 3DGFC 2YTZA 3AV0B 1T2NA 1WXEA 1DBFA 2Y0PA 2PO7A 2GFHA 4PYNA 2RNBA 1G4YB 3TOCA 2Y4UA 5T41A 3TECE 4DA6A 4BO6A 5A3SA 1F14A 4TKUB 1GLGA 1LGYA 3F5QA 3QE0A 4YXWD 3FYTA 1NFFA 3NTVA 2GFQA 4FFDA 1CVRA 2PUFA 4ID3A 3SU8A 2FMLA 4GL2A 2O2JA 3H86A 2XWBF 4IV0A 2ITDC 3K9WA 3ESXA 1RMTA 4WXEA 3GRPA 5EVJA 2GYVA 1QF6A 4EY3A 1NN3A 4RAQA 1AMUA 1KJIA 4Y2PA 4JIMA 3FRHA 4OLFA 4OQQA 2ZB7A 2ZJ0A 3SMQA 2WA1A 4NNPA 4ZJPA 3SHOA 1SU6A 3V4FA 1N6IA 2H00A 4H60A 1Z37A 2PGOA 3GCXA 2PWZA 2JGEA 3DDUA 1V6SA 1W29A 4EKWA 4FM0A 3RTDA 5K3FB 2IUEA 2IDMA 1A2QA 4G1BA 2QXYA 2YIAA 1ZK3A 5FO0A 5H3LA 2QUJA 1NYTA 2ZKIA 3COZA 4H27A 3X1JA 3KR2A 4QASA 5AH0A 5AVQA 3WV4A 3B3AA 3AEIA 1SU8A 1V8OA 1HORA 4J94A 2AFIB 2VPWA 4IXWA 3E86A 2CYBA 3QV1A 2XI4A 4EY6A 4I6GA 3AEKB 1L7QA 1R10A 3NBMA 4H37A 5KSOA 3PNQA 4WD3A 2EBUA 4ND2A 4DRYA 1XRSB 1ZU4A 2IZ5A 4A92A 2ZTLA 1RXCA 2PI5A 1L3BA 4D9GA 3Q7PA 4Z7NB 3V4PB 2FRVA 1U3WA 3AI3A 1AV6A 2ZDIA 2NU9B 3OQHA 3CNHA 1JLHA 2IVFA 3C9UA 5F5XA 3TLBA 4D99A 3ZNOA 1H1DA 5GIPC 2PS9A 1IUNA 2BOVA 1EWTA 4OGLA 2NP6A 4EPTA 4HLDA 3P0HA 3BHPA 5CBKA 2O20A 1R4AA 4M1TA 3EOAI 4LCBA 1X92A 4Q24A 2QE7G 4B6GA 1BS3A 5DASA 2V6IA 3LXRA 4UU1A 4WXHA 3H9GA 1ZD5A 1W75A 3TNJA 2V54A 3BMNB 1MRSA 3L7BA 1X1RA 3DOFA 1UUFA 5FBZA 3KU4A 4YI3A 3PC8A 3OBBA 4GOKA 2D1FA 2EJ7A 4G8DA 4LJ5A 2OPBA 2BFAA 4GWLA 2R8BA 3FTEA 2Q62A 2FSVA 4KVAA 3O8RA 2H4FA 4JZ2A 4BX9A 4BCDA 2YNMA 1H2LA 2HA0A 2B1GA 3KUCA 4YB8A 3BIFA 8GPBA 3M8KA 4HXEB 5FUVA 5TXGA 4TQFA 5C4MA 3FWYA 2GLZA 3NR7A 2OHGA 4I50A 2HJFC 4WXMA 2DFLA 1MX1A 4Z9XA 4WLUA 3UK1A 1TYCA 4C2UA 1E8MA 3VKVA 2R72A 1FDUA 1V43A 2E4UA 1EFDN 1U2SA 1L8XA 3VHXA 4CBCA 4HQ0A 1BYUA 5C5CA 4RF3A 4Y7CA 3ILSA 3GFRA 2Y9PB 1G0NA 1XA3A 3PUXA 1RHMA 1ODSA 3TCNA 3Q7IA 4JOSA 2GM5A 3UCEA 2BYTA 3FPKA 3WWYA 2H0AA 3E1GA 2AKEA 3K0CA 1RAEA 2WJIA 4EHFA 2Q2WA 3KUDA 1Q81H 4LRYA 4RNCA 4Z9YA 2DBYA 2R751 4PBTA 2B7LA 3RJTA 4ROTA 4RPCA 2VGNA 5E4TA 1JR2A 2BV3A 4LA4A 4H13B 4DR2B 2NACA 3D3NA 1A8PA 1AC5A 1Y3FE 3PTAA 4NDNE 4EJSC 1XBIA 1TF5A 2ZAOA 1J0EA 3UAWA 5K3EA 1U7WA 1MF7A 4PX3A 1RABA 1OV6A 5BUQA 1V6AA 1ESCA 4YAKA 2NU8A 3SYPA 1I5XA 1L5SA 3H2KA 2FMXA 5ER9A 1BGVA 2CXRA 3TDKA 1N0IA 3D36A 4EGCB 5BSFA 4F4IA 3I8OA 1S76D 3LVQE 4J90A 4TYPA 4KHPO 4EATA 4KCGA 1N2CB 2RKBA 4PU0A 1CVLA 1EB8A 5AIAA 3W8RA 2ACWA 2L69A 4V0QA 2XLCA 2SBTA 3IKJA 2QKCA 3KR0A 4FZ5A 1BD3A 2Z1MA 1GLVA 2Y1FA 3L4KA 1BHBA 2JGAA 5KTPA 4O1HA 5HP7A 1SQXH 2E7ZA 2XMRA 4MQLA 3WNVA 1BSMA 3UF0A 4XDZA 2HCBA 3QXGA 1PIWA 3Q5DA 2Q67A 2GX6A 4D3YA 3QKRA 4Q3CA 1SXJE 1TT7A 4C2BA 4J4TA 3AVTA 3I2YX 2J3EA 5CVUA 2J9RA 4ZIRB 3BEOA 4AZ3A 2FPIA 2IYSA 1RC0A 1DJNA 4P98A 2UZ3A 1FFDA 1Y63A 2P41A 2ERXA 1RP3B 4M49A 4QHSA 4JGBA 3R75A 4EW1A 3KKNA 1WAZA 4UUPA 5GINE 1XF9A 4RABA 1P45A 2VHVA 2F17A 3CCFA 3PFFA 4U7PB 1ARZA 1KE1A 4O3MA 4UFOA 2ZCVA 2X86A 2XW6A 3P9RA 3P27A 5BZBA 1BQ3A 1YZ3A 3DVAB 3OCJA 4HYQA 4NK5A 5IFLA 4PQFA 4BVHA 1Z22A 3GL9A 2JJYA 4N3AA 1WB5A 4B73A 1KA9H 1SZJG 3NTUA 2JI6A 4ZOLA 3EXHA 4ZZ2A 1LSOA 1UMKA 5EAIA 3OY2A 1II8B 1A27A 1XD9A 4IGIA 3SZRA 1H8ED 2RMKB 4GLFA 4QFDA 4X3PA 2HEIA 1QHFA 5B57C 3M82A 4FFLA 3CZ4A 4ZC8A 2Y69B 4GFDA 4G27B 4RVNA 3HL0A 5DHQA 5JCOC 3AK2A 3TVDA 2LQTA 1QVVA 5C8DA 2FG7C 4D9BA 1P4GA 3NU1A 1FFXA 2RGGA 2L17A 1YA6A 4UVGA 3MFQA 1Q44A 2XRMA 2Z1DA 5LZ7A 2ZT6A 4Q7LA 2LP7A 4L4UA 1PX2A 1Z17A 3GT7A 1E2EA 1PL6A 1DT3A 1XDDA 4TUYA 2ZJOA 3BJEA 5DWQA 2FMFA 3O83A 4BFVA 1FNNA 1YJWF 4REMA 2Q29A 3D4LA 2JDID 4UUAA 3UB3A 1YVEI 1HNWB 4Q05A 3LXMA 4C0XA 4ZFNA 4GKVA 4PTLA 1IX9A 2A9QA 1FVXA 4DIUA 1JQJC 3WTCA 4DW8A 4EMSA 1JJ7A 3QTYA 4CC6A 1H38A 2C42A 1Q74A 2G88A 1C81A 1MHPA 4B35A 3EWNA 3DT6A 1VC2A 4MV8A 1JSCA 3IRVA 2D3WA 4GYKA 4Q4JA 2NQ8A 3GLUA 1GADO 2OBXA 1FJHA 2GJ8A 3QEMA 3DB1A 3VV2A 3GNTA 3WIUA 5TGTA 4E21A 1F0PA 3FOEC 3LUTB 4I9WA 5GTHZ 3LUGA 3KJGA 4O4JA 2CXTA 2XAQA 3KNZA 3JZAA 2CNNA 1RCTE 3A11A 5A2GA 4OQZA 3T5MA 3IBTA 1NQUA 8MHTA 1E62A 1WXFA 3K1AB 4EEXA 2W8ZA 4C76A 4EHIA 1DKUA 3HY6A 4MQ5A 2P5TB 2YS8A 4C4YA 1NDUA 2ORWA 2ERYA 3RVQA 1PHRA 3UQ8A 1HTWA 1EZJA 2FUNB 3S2ZA 3DUFA 3VH2A 1LBHA 2HK9A 2G6TA 2B1JA 3EW9A 4RA9B 5F23A 1YFLA 1Q50A 4BN4A 4AECA 3PUVA 2I7TA 2OHHA 1LS1A 3IFXA 2Q7GA 1TUBB 4FNGA 1KWKA 5JJNB 1KYXA 3W6OA 2I2BA 3WL4A 5L9AA 4Q9NA 5F2VO 5L95A 4OHWA 4BW9A 1OX5A 5IBRA 1AK1A 4LY9A 4JF3A 3L5KA 3VPSA 1ZC4A 4ZARA 3GZJA 4YX9A 2XYHA 4NFHA 4KBYA 3S6JA 1XL1A 3L1VA 1Y34E 3EIOA 3L7DA 2HN9A 5J23A 4E1VA 2ZZKA 1ILWA 2PJRA 3R3VA 1G6KA 3VAAA 3HU3A 3QUTA 1EUYA 5JVDB 2EYQA 3NDPA 2VT7A 1H2KA 4B74A 2HSEA 4IF6A 2VYFA 3CHXA 5AVZA 3VOBA 4S2EA 4FDVA 3KJEA 1RQGA 2XMQA 4OQXA 4Q3BA 5BQFA 2QW8A 4MI1A 4HWTA 3K2BA 3S0WA 4ZI3A 5HZHA 4BB0A 4MARA 2X6QA 1SZXA 1KVTA 4DIEA 5LIRA 5KNBD 3PDHA 3T0FA 2QR5A 4TWZA 4LYFA 2JEXA 1Q0QA 1RQNA 3HXLA 4OK5A 4C87A 1LTQA 4KLCA 5TMPA 4EL5A 3KTAA 1TQ8A 4ENQA 4UARA 4ODIA 1HNZO 1EG7A 3OONA 2PWAA 1THZA 2IBTA 3TLJA 2OYCA 3ZPXA 1TTPB 2I67A 2LJ2A 4QTZA 2Q3DA 4N65A 1H4VB 4G4WA 2HJVA 1R73A 4KQ6A 1DOZA 4H1TA 4KBFA 4OA8A 4DSNA 3OFNA 2GN8A 1DDOA 1QE5A 3KL4A 4B08A 1PZFA 3H0KA 3TLAA 2AKYA 3VO8A 4K9SA 5CIYA 2Q49A 2BEJA 5AVYA 3ZJZA 1HT0A 1VL8A 1T8SA 3RRXA 1A5ZA 2KB1A 1Z6QA 1TECE 2C0QA 4MGZR 5KWVA 5IJZA 3S28A 5DISB 3P30A 2NZJA 3ANNA 5EJ4A 5DTJA 2HV9A 2ZBPA 4X88A 1AB3A 1F4LA 2Y71A 5TMDA 1HF3A 5JRDS 5DSXA 1PTJC 4AZTA 4WNCA 2PIDA 2QM3A 4YXWA 1RYMA 4YJ2F 3WOHA 4D8TA 1EGVB 3U13A 1Z4LA 4BXOB 1F3LA 3STHA 1M2VB 1EA7A 4M8KA 3GVXA 3K70B 5IBQA 1F06A 3FUCA 5SICE 2FA9A 1PWEA 3AVPA 2F90A 2WDZA 4DF3A 5B2ZA 1HDOA 3I83A 1LWOA 2C8JA 4KX5A 5E7QA 2OHVA 1UOQA 3P9KA 1Y9AA 2PHNA 1RIIA 2FPSA 4Z4FA 3Q3IA 3Q41A 2AB0A 1M0EA 1W581 2H16A 1AQ6A 3RC1A 2XT9A 1QGOA 4KWIA 1RWWA 1E69A 1U6IA 2O2YA 3IXMA 4MYRA 1RD4A 4XD7D 3EK2A 1B3RA 3UW3A 4QYIA 2QRKA 1CR0A 2NO4A 4Z49A 2AVNA 1FBNA 1YKSA 3BXOA 1N0UA 2YVLA 3STLC 4ZVSA 3ANTA 1UODA 1MMMA 3H6HA 4Q6GA 4OHCA 1GGNA 1RE0A 4NESA 1E3MA 3IBFA 2YH2A 4HUJA 3G85A 1EFRA 1LQTA 3KXKA 4LJSA 3ZJYA 1JZSA 1TEXA 1OPXA 4ZHQA 3CVJA 3FTQA 3E3OA 5ADVA 2CHTA 1OFHA 3F4LA 2QRJA 4U9HS 1IMOA 3BD7A 3FXAA 1HLFA 3L6UA 2HF2A 2QUBA 4TTPA 3LUJA 1GO0A 1DCTA 3ZDXB 1C50A 1RJDA 2D06A 1IIBA 1W2GA 2JBAA 2ZRMA 4OD0A 4L6AA 1UANA 2PD3A 1ZWIC 2MHCA 3TYXA 4BLUA 4DOMA 2OESA 2AMFA 2WD7A 3KZ1E 3NBFA 3SR3A 4XWYA 4AT1A 3P4XA 4DSAA 4LH6A 4CFZA 3DDOA 3ZOZA 1JU3A 2O5VA 2OCLA 1P0IA 3OOHA 2W00A 4LYGA 3OZWA 4TGLA 4HLUC 1UPBA 3N8DA 1X6VA 4G56A 5KAMA 3IAS6 2PUAA 3FDJA 1DAOA 4BMNA 3CTMA 2GXUA 5TEWA 4DLXA 5LYJF 2CSLA 4JXZA 3ABSB 3ZHCA 1Z88A 3DXYA 3C3BA 1DAKA 3ZXXA 2X8JB 1TGYA 4WCVA 5HQJA 1VLJA 3MJEA 2VP4A 3QFCA 4CCYA 4L5IA 3ZQKA 3GFTA 2WDPA 2PX0A 3E53A 5LZ4A 4HF7A 1N2OA 1V2HE 1N33O 3QU2A 1VQMV 1MG5A 1Q91A 4H1HA 3FMGA 3MA0A 4H59A 2H54A 1XZMA 1SETA 4Q00A 1NVPB 3V33A 4HEQA 1QH9A 1UBFA 5DXFA 4R0NA 2CHSA 1KFKB 2ZZNA 1G8SA 4YJFB 4JJ8A 4ZO9A 4KR9A 1GCAA 5CLQA 3NPMA 2A4KA 3FUVA 3ZBPA 2XAFA 2OXRA 2BOBC 2L26A 2CVPA 3AR3A 1FJ2A 2JBWA 5LZ9A 1E1QD 5CVTA 5KYKA 3KQWA 2DPHA 1MO2A 2CF5A 1XMIA 4IDBA 3NHJA 3AYXB 4R1TA 4XIYA 3ZNPA 2Q1SA 3ZQJA 2FR8A 2AN5A 4J07A 4UCUA 5IN5A 2XCRB 2JLYA 2ZJAA 4QOFA 1N6RA 4CKWA 3HVJA 3FPCA 3QVVA 2COKA 2Z4TA 4O2BB 4MKGA 2WVAA 3K0AA 4F1KA 2IUSA 2BHLA 3O8OA 3OLVA 2Q7OE 3K59A 5H80A 4TL6A 4NMWA 2PT9A 5CFMA 1JEQA 4OXIA 3ZHBA 2IWHA 3ZWNA 4M9ZA 4RMGA 3GQBB 5FHRA 1O9BA 3HSYA 3WRXA 3KWMA 2XAUA 2JRIA 1DFIA 2XV1A 1RW4A 4OBEA 4PYOA 3VMFA 1UC4B 4NC9A 5AKHA 5HHTA 3WA6A 3TUZC 3A0HZ 2ZVPX 2YXLA 5L4SA 2FLVA 4X60A 2P0YA 3NXKA 3E61A 3UWOA 2PYIA 4TT3D 2V0CA 1HDYA 5F5LA 2X58A 5IVKA 1KC8W 4MVWA 3GRYA 1YACA 4BLQA 1KE2A 3ROKA 2Z6UA 4WECA 2QF7A 3WSTA 4DQVA 4R6ZA 4CM9A 4ZZIA 5JEEA 5DJ5A 2QZZA 3EZGA 2XH8A 3I3OA 1CIPA 1FQOA 3O7MA 3VJMA 2W8BA 2OLEA 4DCVA 1YR8A 2ZYGA 5KYUB 4UHDA 1Q0PA 3T3EA 1VG0B 4M1WA 1BN6A 2J45A 3HMKA 4DPLA 2RFLA 3BICA 3RWRD 3DWEX 2B3TA 1CXZA 4DV0O 4FD3A 3CRAA 2GKOA 1VHAA 4Y1RB 4DCOA 4TV9A 2I3AA 1GEEA 1ZM3A 1CUCA 3RRJA 2F00A 4H33A 3Q4GA 2E48A 1C80A 4RQAA 1R0SA 3BK2A 4J29A 2K2QB 1N2JA 1YMVA 3OIVA 3UHPA 3D6NB 4URXR 5HM8A 5AI8A 5LR6A 1FSFA 2J0VA 2WP8J 4P7JA 4G1MB 3FCXA 3ML1A 1B14A 3GWOA 2QL6A 4UW9A 2ISQA 1GFWA 2QPLA 5LPNA 3MTQA 3E2PA 4V02A 1HETA 3T41A 1P6XA 3AFGA 1KMQA 1SAYA 3WQRA 2CTPA 3I9FA 2B7BA 3WTBA 5CGZA 4V1CA 1NL3A 2ZQ5A 1ISPA 4J3FA 1UBJS 4ZN6A 1XNHA 3LLUA 1XHOA 2XMPA 3QMVA 4X7PA 3AINA 1I6LA 4MYHA 1V9PA 4BNNA 4HBZA 2QGZA 4LISA 2PV7A 2J7PA 2PQ0A 4RANA 1SD2A 3R23A 1US6A 2F2TA 2YICA 1KRHA 3UAXA 4W4TA 2ZP1A 4M36A