4X1IB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 151
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1iB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1iB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1iB01
4O4JA 2XKAA 5ITZB 5CA1B 4KWEA 4E6EA 5LOVA 2RHOA 4IIJA 4TV8B 4YJ3A 3M89A 5MN6A 4TV9B 3JAWA 3RYFB 5J2UB 5KMGB 3UT5B 5LP6B 5GONA 4HNAB 3JALB 4TUYA 3N2GB 4O2AA 5BMVB 5CA0B 4U3JB 4U39A 1TUBA 5MN4A 3ZBQA 3WGNA 5JH7B 4ZHQA 2Q1YA 4WBNB 3RYIA 5M7EA 5IYZB 3WGKA 5EZYA 4YJ2B 3HKBA 2BTQB 4I55B 5IJ0B 3N2GA 3RYHB 5LXTB 3JATA 2VAPA 1OFUA 3C8LA 4IHJB 4F6RB 4ZI7B 3JAWB 3RYFA 3VOBA 4X1IA 4IIJB 4TV8A 4YJ3B 4ZHQB 1Z5WA 3RYCB 5LXTA 4YJ2A 3N2KA 3HKBB 4DRXA 1W5AA 4EI9A 3HKEA 4ZOLB 4B45A 1RQ7A 5EIBC 3RYIB 2RHJA 4O4HB 5IJ9A 4X20A 3JASA 3WGLA 3RB8A 2BTQA 4I55A 2RHHA 3RYHA 3JAKA 5LOVB 3JATB 3RYCA 4LNUA 3VO8A 4EI8A 1W581 5JCOA 5EYPB 4X1IB 5CB4A 3WGMA 4O2BA 3E22A 4HNAA 4TUYB 5CA0A 4O2AB 1FSZA 4U3JA 5GONB 5LA6B 3JALA 4LNUB 5KMGA 4WBNA 5J2UA 3HKDB 4O2BB 3E22B 4X20B 5CB4B 2R6R1 2GVIA 3ZBPA 5JVDA 5BMVA 1SA0B 5EYPA 1W59A 2VXYA 2XKBA 1JFFB 5LA6A 5FNVB 5C8YB 4I50B 4I4TB 4X1YA 3HKDA 3V3TA 4FFBA 3HKCA 2Q1XA 1TVKA 4XCQA 4DRXB 5KX5B 4ZOLA 4O4LB 1SA0A 3JARB 5JQGA 3JASB 5EIBD 5MN5A 3VO9A 4B46A 1TUBB 3WGJA 5LYJB 2VAWA 5IJ9B 2RHLA 1FFXB 5IYZA 2VAMA 5KX5A 4EI7A 5EZYB 4X1KA 5LP6C 3R4VA 5JH7A 3VOAA 4IHJA 4F6RA 1RQ2A 3JARA 5JQGB 5LYJA 3ZIDA 5IJ0A 4O4IA 5J2TA 4EB6A 1W5EA 4X1KB 4ZI7A 3M8KA 1FFXA 2BTOA 1W5FA 5JVDB 3VPAA 5CA1A 3HKEB 4O4JB 3N2KB 5FNVA 5ITZA 4I50A 4TV9A 1TVKB 4FFBB 1Z5VA 4O4HA 4X1YB 4I4TA 1JFFA 3CB2A 5C8YA 5JCOC 1RLUA 3UT5A 5LP6A 4O4LA 4EB6B 2R751 4O4IB 5J2TB 4M8IA 1W5BA 3HKCB 4DXDA 3JAKB
chains in the Genus database with same CATH superfamily
4MXDA 4UE2A 4L5CA 3UM9A 4R9NA 4U00A 1T1JA 3ELYA 5CITA 2EBWA 1KP9A 1H9BA 1BDMA 2EJWA 4L28A 2VRWA 1ZN8A 4FK8A 4YH1A 4GZMA 1FF9A 1N3BA 1PR9A 5EXSA 2WB2A 1YK1A 1IHDA 4DREA 3L7AA 4LNHA 1RYNA 4JQOA 2JGLA 3CT4A 3BRSA 3E9YA 3GJ6A 4EG6A 1AI5A 1LTKA 1N8NA 3MMSA 1MRSA 3IAXA 3QX7A 5FL7A 1G21A 1KZYC 3DONA 2WHEA 2QWQB 2PBZA 3GV0A 4X45A 4IVNA 5EJMA 1J1ZA 2P30A 4LOAA 1A5ZA 1QVVA 3FE2A 1SBNE 5C93A 3N8GA 3C8LA 2H07A 3OLQA 3IS3A 4OI2A 4MGHA 3ZP4A 1N4CA 1N32O 2HFEC 2PSEA 1OX5A 4OIFA 1BE8A 1JIXA 1ZK3A 3BYQA 4QJIA 3WL8A 4QL3A 3N2ZB 1BXRA 1JT2A 3PUWA 1JA9A 2R8ZA 1ZCZA 3WISA 3LV8A 3BVPA 3IAEA 4JUCA 4OHUA 3WRXC 2I7VA 4KL8S 1JQAA 1QIHA 1H2RS 1QFSA 1GPNA 2YHSA 4I5IA 2Q7OE 5FPSA 3B82A 1CWUA 2CBZA 3F7MA 3NIBA 1JBQA 3RWBA 3WP0A 1PGPA 1STOA 3FETA 2FLVA 3PEFA 4R1NA 3PIRA 1FMFA 3OPYI 4CJXA 1AMNA 3GJRA 3R4CA 4X71A 1DEOA 1YUMA 4ISBA 1BMQA 1ISPA 4BFVA 2MYNA 2J09A 1Z8NA 2C7VA 4UPDA 4TSFA 1UXKA 3DZHA 4Y1GA 4BX9A 1O97C 3G1UA 3GBPA 2IIBA 2UV8A 2LQTA 1AF7A 1C2TA 4XJSA 5AQEA 3SXPA 1Z4QA 1H5NA 4DANA 4NI5A 1D5NA 1YR8A 3OD1A 3R3UA 3F8WA 1YRYE 3AY3A 3VR5D 4C05A 2ZSEA 2A5DA 5CFOA 5C5EA 5ICCA 4NESA 3P97A 7GPBA 2HRBA 3QTCA 1L2TA 2A9KA 3RF6A 4I4TB 4GHWA 3SK0A 4Y6RA 1PFYA 4BDTA 4Z4HA 4CLOA 1LQUA 4JDPA 2ACKA 1QH9A 3MUOA 5IEJA 4TSFG 3ABIA 5KS2A 2X5NA 3LDGA 3OY2A 3TOXA 3P20A 1IOLA 1JAZA 2CKMA 4RQOA 2QTMA 2ZFUA 4IWNA 4FZJA 2OHVA 1ZKMA 2AFIB 1VM6A 4FQ5A 2XOKA 4XYBA 5FO1A 4BBPA 4YRRA 1ODIA 3AC0A 1E2GA 3F5TA 2HRDA 5JNLA 4I0WB 4V1CA 1XDWA 2BFNA 1TKCA 2H1VA 1YZHA 4QATA 2HHJA 3AVQA 2P2SA 4RZXA 5K2MA 2JI6A 2QLBA 1T4CA 1VP3A 1VJCA 2FLWA 1EHYA 3QVSA 1QK3A 3W7VA 3IP3A 4Z51A 4NBRA 3ESYA 5BYKA 3TD5A 5K8JB 1E1NA 2KLHA 5KCMA 3E3LA 1ZINA 4DGSA 1G8PA 4Q4DA 1X3SA 1KQSF 3B5JA 3CEIA 2FRDC 1ZMRA 2HF9A 4GLOA 3L74H 1XXHB 3OU7A 2D59A 1UKEA 3UAWA 2WUEA 3U1BA 4YUXA 2YIBD 2C31A 1A9PA 1P4AA 4CEIB 1VIYA 2UXBO 1DMRA 4WNIA 3T5DA 4ALIA 1XHOA 3ACCA 1OVMA 3H9VA 2ATIA 4BBAA 3F6MA 4W82A 5ALXA 2XKJE 3ESAA 3WO1A 4QPDA 4MCIA 4OJKA 3K5PA 4EJSA 1YDMA 2GAOA 3EGIA 1GV1A 2VWHA 1Q3KA 3A2LA 2C5HA 5ECYA 2GPSA 1U96A 1CK4A 2XUQA 5IW8A 3ZHRA 3ZV5A 4CVNA 3HDHA 4IT5A 1FYWA 4PR0A 3ROPA 1L4UA 3UIEA 1E1KA 3GFFA 2C4MA 1VQ4F 3CC4F 5FAKA 2KG7B 2N46A 1E3LA 2A78A 1DPGA 1AP5A 3HJAA 1ENVA 1OFIA 4RCVA 1CZOA 5FEMA 2A7QA 4OQQA 3UOAB 4I9FA 2X5XA 4DADA 1T2DA 1BN7A 1TA4A 4P7FA 2G1AA 3LBIA 1C1XB 3IULA 3DKIA 1FXWA 3MTQA 3S70A 5AVWA 2XA1A 4JJ6A 1TMOA 3HXKA 4EHLA 3AR9A 1R3IC 1N6OA 1W2BU 3K1JA 4NZPA 4O25A 5IF3A 4YR9A 3NOQA 1KPHA 1UJ2A 1QMPA 4G23A 3DOIA 5DO9A 3IMEA 2PL9A 5ER9A 3T41A 1P33A 3TR0A 2QYOA 4R1PA 5FNVF 1ML3A 3WNDA 2WK1A 5GP1A 1EVJA 1YMQA 2I4RA 3ENVA 1XB2A 3FPEA 3H9QA 3IEPA 3KSDO 4JVLA 4Z4FA 4L4YA 4O4HB 4JGBA 4DR4O 3CW2A 5BWLA 3I9FA 3CA8A 5JYDA 2Q6KA 4J7UA 4KNVA 1OXKB 5HS6A 3QX9A 4D0NA 3TO5A 3ZMVA 4UUJC 1XTRA 2WU4A 3HV0A 3SJUA 5BSHA 3Q6IA 2WUVA 4EKWA 3R40A 1CP9A 1Q1QA 4US2R 3BRWA 1OMOA 4BVHA 2OCCC 2I3BA 2QVYX 5U1PA 2ALJA 2GUZB 1XO1A 1IL0A 4KAJA 3AFMA 4MTCA 3X1ZA 3R09A 2G7MC 3CS5A 4G4VA 1OSNA 2QRLA 2YZMA 4UM9B 1RNLA 1PS0A 2O2SA 1YCDA 4KPGA 2FP4A 5JVDA 3EIUA 1XP8A 3TETA 1AUOA 3DBLA 2C9BA 2MINB 4HQLA 3OIWA 2JJ2A 2JVIA 4HVAA 4KXVA 3RRNA 3CC8A 4OYRA 3NHBA 4BJ5A 2OFFA 5AVMA 1Q81H 1CN7A 4M87A 5D86A 4DR7B 2ACWA 2V98A 4KYUA 1PRYA 2ZRQA 4GRAA 5DSZA 5TC4A 1I7SB 1OCCC 1TVKA 1N0NA 2XAFA 3M6FA 5F5XA 3OBYA 3IUSA 3WYBA 3H1IH 4F5EA 3LTNC 3IURA 3D54D 1UDCA 2AWOA 2WKQA 4BNGA 5FLXN 4EY5A 4DUYB 1E9DA 2E6UX 5KWJA 3ADPA 3IEIA 1NP7A 2FEOA 2FWIA 2WVGA 1WJZA 1P6QA 1ZM3A 1VA4A 2D8MA 2Q9AA 3WG7C 2NTEA 5BWCA 1P61B 5TMDA 2RHMA 1YH3A 1JH8A 4IDDA 4EKEA 4C7OA 3K73O 2OLKA 2OSBA 4IRUB 1RRKA 3IDAA 5IYZA 2F9MA 2I4IA 2E4XA 1X92A 2VT7A 3EUFA 3PNYA 5T3UA 4DYDA 2X13A 1Q6IA 3N3AC 4FWIB 1UUFA 3FFWA 1BDHA 1MMMA 3OY7A 4W4LA 3ELDA 3AIMA 2I4OA 2IH4A 2IE0A 3QLJA 1CJCA 1YL5A 2WF5A 4KH1A 3KKYA 4HF7A 4L5JA 5FULA 3TS1A 2BTOA 5JCJA 4HWKA 4EECA 4MDEA 4GMFA 3P9SA 3RV4A 2I4LA 1U7WA 3AY0A 3W7XA 3H1PA 3KSBC 2MU1A 4B7CA 2UZ0A 4P2BA 4OBWA 1JAHA 3ABKB 3WIVA 4EAQA 2NTNA 4ZI7F 2Y92A 1IPFA 5G0TA 1U0JA 3VGJA 5CHYA 1H8HG 5CGQB 3V2IA 5IVKA 2HAEA 4WCFC 2BUAA 4B83A 5C34B 3O21A 1DRJA 4B80A 2EKPA 2AEFA 3GFRA 2QRUA 4LGYA 2R5FA 4LHXA 1V1MB 1R5NA 4ENVA 2AOXA 1DV2A 2L17A 4TS1A 1DDOA 7ABPA 3L1HA 3O4VA 2DFLA 2RAFA 2WI8A 1G2PA 1SC1A 4L3VA 4XW2A 1N7IA 4B84A 3JALB 3CS3A 1BCRA 1ORQC 5BR8O 2W2QA 2Z9CA 2WHYA 3JVEA 4MYSA 4TTSA 5ALWA 1IWBB 1VOTA 2PJUA 2JNWA 2H4YA 2VIIA 3QKUA 4HSGA 3ZWKA 5DNYB 2XITA 4O4JF 1KR5A 1UAGA 4JZGA 3QO8A 5EO3A 2H94A 1RLGA 1X7ZA 2R1TB 1BKYA 4I3GA 4YY3O 1JECA 1KDTA 4MB0A 1JEQA 1GPUA 1M6VB 2P9CA 1OBOA 3JZDA 4HYEA 4N39A 2BGJA 1Q0QA 2BSAA 3DT9A 1L5HA 3WQBA 4BYGA 1EWTA 5JRJA 3ZQUA 1J5EB 2XUZA 1IBRA 4ZOCA 2DB3A 1V39A 5B1AC 2PGAA 3FPJA 3NTUA 5D84A 5LDDC 1QLJA 2WU3A 3E3AA 3NBMA 4NJMB 4D3DA 2Z1FA 3B3JA 2BCJQ 4YJDA 1J09A 1C9EA 5K3CA 1ZHOA 4M55A 1N1EA 1E1RA 1YTFD 3V7EA 1UQTA 1QCZA 2GN9A 2P4UA 4GKBA 1M57C 1XIVA 2QB5A 3AZOA 1I7QB 3EMDA 1H23A 3S7ZA 3N6RA 3INRA 5EE0A 1ACJA 4TRMA 1YQNA 1QVGU 1TAHA 4IEIA 2RGYA 5BSRA 5ALUA 3NR2A 1AKUA 1T2NA 1U3FA 2WM2A 5REQA 2ZAYA 2JCGA 5FLXA 4LXUA 1TPYA 4DILA 3FRHA 4BZWA 4LECA 5KINB 3K0CA 1XRMA 1JALA 4BVRA 2QLTA 1KD1H 2WHQA 3N70A 1ITZA 1MORA 2IYEA 4G24A 1YTLA 4QU9A 5JROA 1PJCA 2O1WA 2BFOA 4M1ZA 4CMEA 3FZGA 1NRXA 3HFGA 1I5YA 3IE2A 3L7BA 2W6NA 1GRNA 3WBJA 4W5RA 5FNVB 1EUCB 2YZNA 3OM3B 3T5GA 2YIVX 3M4NA 2FEWB 3RS8A 3NNNA 5GJBA 1UP6A 1OWMA 1LTQA 2VT6A 2B9ZA 3WLKX 4EUSA 1SA0A 1F1BA 1T5EA 1TQDA 2I2XB 1VPDA 3F6PA 1V95A 3PQFA 1T1IA 4IIXA 4HAXA 4H7JA 2DKOA 4OHXA 5JTUA 3DLBA 1EN4A 4LISA 1G7SA 3M8AA 1E5QA 3SDLA 1L5YA 1O95A 2FMKA 2Z5GA 3FIJA 3I3OA 3PC3A 3EUWA 1DQYA 4D4MA 2X0DA 1F60A 2REOA 5BN3B 3PDCA 3CPWF 1M8KA 5AVVA 2R6JA 1PJLA 3P2YA 5A6SA 3NCTA 3CUEF 3ON5A 4LX0A 2YYSA 1LLFA 1NBME 1P2SA 3KCXA 5K51A 4D6YA 3TUJC 4ZAYA 3DWFA 1W73A 3R3VA 4RF2A 1JQKA 5A2QN 1TFUA 4FGKA 1NXVA 5E1DA 2AZMA 3E53A 1XK7A 3KQTA 1MXHA 4H7IA 3ERCA 1IQ0A 4FW8A 2Y4NA 4YT5A 4WXPA 1M54A 4TWJA 1ECFA 3KQPA 1N5KA 4ZOAA 1KHHA 5JISA 3U4QA 1L3IA 5L9AA 2M6KA 1ESDA 1JWAB 2FMTA 4RCZA 5EHNA 1KZGB 2CLKB 3QOFA 1AV7A 3WJ1A 3SCZA 3T5BA 3Q7QA 3QOYA 1PTKA 4RE5A 3REOA 3VR5A 3HNOA 1B6GA 1EVYA 2JD1A 1POXA 2JGJA 1G60A 3KHSA 4I9NA 4NBNA 3WGVA 4BNXA 2GO1A 5DCYA 3LP6A 5TF4A 5IXYA 4MWBA 2GN8A 4RU1A 2WIFA 1H8HA 4HAWA 4DMMA 3RRJA 5J2UB 4MUAA 3ZIAD 5JDIC 4PIMA 1UODA 3M6XA 4V39A 5G1OA 4P4SB 5D1HA 2C00A 3I30X 1K4YA 4PYIA 1WU7A 2P1RA 3A26A 3R9IA 4OI0A 2GNPA 3B2QA 4H3VA 1W36B 2XH8A 2WE8A 3GRRA 1P1HA 3LOUA 3A31A 3W79A 2BM0A 2AK2A 5H68A 3RK4A 3TLYA 3VZRA 2KX7A 3EVCA 4XR4A 2OPHA 1C8VB 1QC5A 4ZO9A 4MAFA 2ZUSA 4ZALA 5AWFC 3ML0A 1CJKC 1R3UA 3HDGA 3JW8A 4BQIA 3LQRA 3WBKA 2GRJA 2H59A 4MS2A 4GGPA 5DMHA 3BK7A 3ETEA 2R7KA 3AG1B 2IDMA 1B8UA 4NZ9A 5FL3A 3WLJA 1KAQA 3H6GA 3WFVA 5IYCO 2XGOA 1OPRA 1F4NA 3N0VA 5CH5A 4DC9A 5KSZA 4BWFB 2ATXA 3GNLA 3ZMSA 4JA0A 3PDWA 5LHGA 3FCOA 4GBJA 5CDUA 4UTXA 2RAPA 1WXFA 3LQQA 4Z3KA 2W48A 3EGCA 4LNUA 3DW1X 4KE9A 3V4RA 3CU5A 4HZIA 4A1OA 5B7QA 3R7LA 3ANYB 2O8CA 4FMCF 3SOPA 2BJVA 1M8JA 1GARA 3FUVA 3WZ2A 3HJTA 4LRQA 2FETA 4XQEA 1ACMA 3OLCX 1G8KA 2CK3A 3ZE9A 5LHIA 4POAA 1JVMA 1BRMA 3RSQA 1Y74A 5IY5B 3PLAC 2W2MA 4Y2TA 5CFZA 4S04A 2DTDA 2UYKA 2EC5A 1DT5A 3FUCA 2Z8YM 3OPQA 2CAZC 1ST2A 1OXBB 4LJ5A 2XOKG 1X52A 1FRZA 3KPYA 5EPEA 3KQQA 4KIFA 1JE0A 3TX2A 4G84A 3JQ8A 4KLAA 1U3CA 4LSGA 1DIHA 1M2WA 2GZ2A 5K0BA 4OXYA 2LCIA 2MHCA 4RA9A 1HGXA 3QX3A 4JV5B 1QKJA 2Y0BA 2HA0A 5DGCA 3KOYA 1NF8A 1PDOA 3RIXA 2VAXA 4PZPA 3I5YA 1NPTO 2R7NA 2Y69B 2QA5A 2YV2A 2XAJA 3OQVA 5BXZA 4WKOA 2WLSA 1CIPA 3N8HA 3IPAA 1PLLA 4X8HA 5L6MB 4MPPA 3V7NA 4C4SA 2RGRA 1II8A 1NBIA 3E8GA 1GPLA 5C5IA 1IG3A 4JP3A 1JWBB 3NOVA 3RHSA 4LYDA 4ER5A 2UXNA 2R2GA 1IVYA 3MHHC 4DR4B 4Q9KA 2OD7A 3TCNA 4G8JA 3CCRF 1V48A 1MZVA 1UKAA 4DFDA 5L3CA 2MYUA 1A8UA 3CHYA 2AOWA 2EKDA 2Y9PB 3DMYA 4QM6A 2R60A 3GAZA 1N3YA 1FFXA 3I64A 2D2CB 3QVJA 2W90A 4PAGA 2YW2A 4RDHA 1KZ6A 2EX0A 3FYIB 3AUFA 3HQ4O 1BMFA 3DVRX 3OEEA 4MWTA 2EG5A 3SR0A 1HNXO 3UH1A 4X3OA 3R5KA 3ZDQA 3L7LA 3THSA 3ZU5A 4XWKA 4Z0PA 1O54A 3CIOA 2JF0A 2Q5LA 4QELA 4PYJA 4K8RB 2Y4UA 4YDRA 4D4JA 3J81k 3NTXA 3M89A 3N76A 4LJ7A 1G7TA 4ZOLF 1L7RA 1G4UR 1BKDR 4P5EA 1E2IA 4RKQA 1H93A 4F60A 4IMRA 4U8HA 2NVBA 3B2EE 2AJLI 2REXB 3N5CA 4RHXA 3C1AA 3VTAA 1T0PA 2HU5A 1RPJA 1PKEA 2LGQA 2EL9A 4C7UA 1B3RA 3HB1A 3L7OA 2WLJA 2JFXA 3FSGA 3Q3GE 1NP3A 1QV6A 5DLDA 3T4EA 4PW0A 5IJWA 2WD7B 2XDAA 1K5SA 1BA2A 2ZI4A 2NU6A 3SIWA 4MVMA 1MA1A 4BFCA 3URMA 1K8ZB 2W6CX 7YASA 1FSFA 2C83A 1O97D 4HGYA 3ZRXA 2CD9A 2Y1FA 2DPYA 3RSHA 8ADHA 2XNSA 4TWRA 4Q02A 3GCGA 4YMSA 3SJAA 2VP4A 5ER6A 3WGZA 3WRVA 4TXLA 2BN4A 4GUNA 2O8EA 1OV9A 1DX6A 1ZAUA 1I6MA 1NY5A 2PMBA 4JCCA 2ZEJA 3GROA 4MWSA 3IMPA 4TN5A 4WXRA 3SIPA 4EYQA 1H9CA 2FG6C 4ZU3A 3LWNA 4XD2A 1L8QA 2X6TA 3IL2A 4HJXA 3P30A 2NADA 3PX7A 4KACA 3ND7A 4PLWA 4B6FA 3CRMA 1OT3A 4BKOA 1JQEA 1KQGA 2Q73A 2AFHB 1AG9A 4DV1O 2DECA 2IG8A 2HK9A 5TPWA 4D26A 4DPMA 1BU5A 3B4SA 1VHAA 2CZQA 3BB3A 2O59A 4MSUA 5E1MA 2NN3C 4OYLA 2B61A 3TI9A 2OV1A 3E22A 1LV8A 2WIDA 2EGHA 4NDNE 2Y27A 5FFMA 2C3PA 3IUMA 1W2HA 2R00C 4KBGA 1D9ZA 1KDPA 2Z5FA 4P33A 3ZV7A 2LJ2A 1X39A 4TT8A 1MZEA 1UT5A 2ODNA 5ALFA 2B6HA 4TLDA 1VGQA 4DY4A 1MU0A 1YR9A 3CNNA 5AQ1A 3G17A 4JI2B 3PFNA 4QQKA 2VQFO 1J21A 4AILC 2OHWA 1ZOSA 2ZUDA 3NAMA 3P9CA 3PHIA 2OIEA 5IM5A 3HLKA 3KUKA 3OLYA 3QVGA 4UNIA 2K2QB 2X1HA 4OATA 3JQ6A 3WLMA 2H2GA 1T4BA 2ZYTX 3WI7A 1AE1A 2AXNA 3NUQA 4Y0VA 1IV2A 2H4ZA 2IQ5A 3TQHA 2C2GA 4DV5B 1PT9A 1YACA 2ZAMA 3PUIA 4L4UA 5BRNA 2PQ6A 5BOSA 4FM9A 1N8TA 3S2GA 2BBSA 4X64B 3OE7G 2IJKA 3WO0A 3OEHD 4D81A 4FYHA 3RT9A 3D8UA 1YE3A 5H6RA 3BBLA 4INZA 3RSOA 5KTTA 2W6OA 2WIAA 2ZWAA 3OLXA 3Q2IA 4UHCA 3U26A 2JKZA 1KQSU 2JBWA 4ND5A 3IA7A 2HGSA 4LBVA 3SJBA 1QIEA 2FFBA 4UM7A 3UMBA 4EYKA 3QF7A 4XDKA 5J40A 2PX0A 3L3BA 4CBVA 1QYIA 5DX0A 3R4VA 1HYGA 4R8CA 5HRUA 1OYOA 2XUMA 1CY7A 3KPWA 3AG6A 4AN4A 4XH9B 4EO4A 5K3FA 3ZJVA 3AUKA 1WXQA 2C0PA 1WNSA 3ZC3A 1TDJA 3ZH9B 5K8VA 2OWOA 3AX6A 5DIFA 2O54A 1T8PA 2UYNB 2HA7A 5A3QA 1W44A 2X5OA 4NBTA 3IESA 4FCTA 1FFTB 1LBIA 3IQDB 2WJAA 3ZXIA 5FR1A 5KYWB 1ZWLA 3SKVA 4OQZA 1OHHD 5EY5B 4BN0A 4B6GA 3MEQA 3E89A 2DYRC 4JTDB 2DQKA 1ZC4A 2VF8A 4HNRA 1OZGA 1S2GA 3LVBA 4ILKA 4BW5A 4JEHA 4Z8YA 4DV7B 5BV7A 3HR8A 4EAAA 5DGDA 4PV7A 2ZNJA 2FEKA 2RGAA 5IZCC 1JWLA 5AI8A 5HQ3A 3EH2A 4GZRB 1R8QA 3LUAA 3ZUGA 3DM5A 4L9AA 4OOFA 3B8EA 5AHOA 1LVGA 2BC9A 3UGJA 2GARA 3EPKA 1ADCA 1GY8A 1ZJYA 5ALDA 2OESA 2BGMA 3URKA 4JYZA 1TCCA 4BT2A 4N3GA 2W2XA 4RPHA 3FD9A 2KSDA 4HDKB 3KJNA 3C45A 3UPUA 4JI5B 3HCRA 1MNAA 2IC5A 1H0SA 3GLQA 3PC8A 4K1XA 4RV9A 1RJFA 4S1VA 1MC8A 3G2KA 3PD7A 3T9EA 1J5EO 1PZFA 3DBOB 3E86A 3KKPA 1GL7A 2AW5A 5IS2A 5KYXA 2YS8A 1R1MA 4BN5A 2KHZA 1I6WA 4R1MA 2GDJA 3OZXA 2VPYA 5DECA 1QUFA 1VHDA 3A11A 3AZQA 3E8HA 3EXEA 3F6RA 1DBWA 1X1CA 3FSRA 3Q3JB 4KIGA 3W0LB 4TZTA 5LZ8A 4MVRA 4L0MA 3AR8A 2ZSJA 3X1KA 4LI3X 5IAKA 2XE6A 2PT5A 3I83A 2GCIA 3HCEA 1OGYA 1W0JD 2RFLA 5BYBA 4C2AA 4JTCB 4RLHA 2DC1A 4B40A 2RNBA 3O85A 2AKAB 3FYTA 3LY9A 4E4YA 3T3NA 1L4BA 4RGYA 3W05A 1BMFG 5HXUA 3C4VA 1XELA 4CMGA 3DXFA 3P2EA 5IVDA 1LSJA 3QVTA 2JLCA 2Z5UA 2BO1A 4FCCA 4L07A 4RQFA 1E2JA 3O8DA 3U48A 1A5TA 4EMUA 3AW8A 3CEAA 3NC1C 3PFFA 1Z4OA 4ME6A 4NZOA 5A5VA 1IM5A 1UM9A 3EULA 3IOCA 4X97A 1YJQA 1ZU5A 2B8NA 3BEOA 3SG0A 2BONA 1Y5NA 3SC3A 4AC9A 1ECJA 2AYXA 3AFNA 4X8AA 1TYEB 2IZ1A 2FJUA 2BKVA 3D6UA 2Q2WA 2IYTA 1LB1B 1EFRA 3QYPA 4IF4A 2XUOA 4NX2A 4QXRA 5IKPA 2YVKA 3ZWWA 1YF2A 1CRWG 4WFGA 3ZVNA 2GM3A 4E2FA 3CLHA 3JQ7B 5CG1A 3ENNA 2XB8A 3NXSA 3MQ4A 3DV0A 1M0TA 2I99A 1RCTE 3F7OA 2DWEC 4QPJA 2ZQYA 3GN2A 3H9CA 3HYRA 2P9EA 3BAFA 2EZPA 2ACVA 4FR2A 1OFHA 5GTHZ 3CEHA 4UHDA 1ZIDA 2H7VA 4AJPA 1U3DA 4J7CA 3X44A 2Z6QA 5EE5B 4F71A 5MN5A 3E2MA 1Z63A 5HMLA 3AG5A 3OD4A 2GK6A 2WU0A 3E2PA 4EYEA 4YCCA 4WMLA 4UAVA 3EGWA 2J9ZB 3TIVA 1G0OA 1N8SA 4KTTE 3TKLA 1FFXB 5C9ZA 4XUDA 5EBMC 1O94A 3CLUD 1DC8A 5FCDA 3C3CA 1Z0SA 2NV2B 3ED5A 2ZOVA 4JKYA 4IIFA 2OP1A 4QFDA 2YYYA 3SHTA 1H2GA 1W5SA 5G02A 5AW7A 1XREA 2GKGA 1XBIA 3LD9A 1U7UA 1PFUA 5EA2A 3PC6A 4KV7A 5DF1A 2BGGA 2FL4A 3QEKA 4UE3S 1Q1NA 2DUMA 1QQ7A 4H4CA 1ZNZA 2GEFA 1ZD4A 3BF7A 4KIUA 4EJSB 5E3JA 1H3FA 3EGEA 3THRA 2JIQA 1XTUA 2VNAA 1K4DC 1VQ6F 1MOPA 2Y0EA 1ZL2A 4DIFA 2ZBFA 4B3TB 3P0ZA 1WB7A 5I7WA 1C3XA 1AJNA 3FYHA 1LNSA 4W63A 4QOFA 4C5AA 3MRSA 5A4MS 3U16A 1ZHFA 2AFVA 1SXJE 1Z74A 1VQPF 2B7CA 3IR5A 1FXWF 1SC4A 1U4NA 1KBHA 1BXGA 2COKA 4Z54A 5A4KA 2KKWA 4FT4A 2FFQA 2BFFB 1ECCA 1OWLA 2Y66A 1SB9A 2OHOA 4I4IA 4QOEA 1A1SA 5LN1A 2O8EB 5DHPA 3K09A 2W4MA 1D5CA 2XOEA 4KO8A 4BFUA 4HX9A 2MW2B 3E1SA 3RKSA 1MSDA 2DUJA 4ZEMA 4EHFA 5I51A 2ZIOA 1P8JA 3OZGA 1NUSA 2ODAA 1ZU4A 5CX4A 3NHKA 2VP2A 5LB4A 1KWGA 2ZTHA 2O48X 3COZA 1CZNA 2CEKA 3S1AA 3LIIA 4N7JA 2C54A 2ZT5A 3AFOA 4H35A 4LXXA 1YIOA 2B2XA 2M9MA 1T5HX 1XRNA 2H4FA 3LX5A 2Q4PA 4L8GA 3UVEA 4D0GA 3KFXA 4HEA6 4YMUA 5B1YA 4MX8A 1UOPA 3SP1A 3HA7A 5AK4A 2C7BA 2NN4A 3VR1A 3WYDA 2FX2A 4W5QA 3UJCA 2O14A 3NM4A 3S2FA 3G2QA 2KG4A 2ZCUA 3H0CA 3HR4A 3K0SA 5H5NA 2RI0A 1XHFA 1QH1B 1QOZA 4Q4HA 1DKLA 3TQQA 2AK3A 2BOCC 5AJHA 3OJLA 1EWKA 3L4SO 4YAEA 3LCUA 1LV7A 2PPVA 3JX9A 3WKCA 2R86A 5HGXA 3RVOA 3UC9A 4YT4A 3R9WA 2I6RA 2PRZA 4B3CA 1FMJA 1DADA 3RIGA 3VU3A 3MOIA 3T15A 1YJCA 5EJIA 1U9YA 2HBYA 2IEBA 3DAFA 3FYDA 4G4GA 3CJHB 2JAWA 2AL7A 4JUAA 3VAZA 1Q17A 3F6BX 3C85A 3MCWA 3S28A 1D5WA 2W22A 3CSUA 4IXNA 3ZBPA 4WFHA 4IEEA 1F4LA 3NEJA 2DF8A 4ASUG 2ZCVA 4WF9V 2Z95A 3T1HB 1USGA 3HXLA 4ZREA 5BSGA 3VVBA 4LWSB 1JG4A 1ILWA 2CFIA 3WL7A 4MA4A 5E38A 1A9XA 1X7OA 1AK2A 1ZMXA 2DQ0A 1HLPA 4R0NA 5D7BA 1J25A 5HTKA 4GRIA 1N0JA 4ZJPA 4D1YA 4BPBA 2AMTA 2ZB8A 4CIAA 1W0KG 2VPQA 4KDFA 3PQ7A 2ARHA 4GMHA 4ND7A 4WN9A 3FDZB 1CRLA 4CH3A 4DW1A 3I39X 3UHJA 1JS1X 5E7IA 4CL0A 4UQLA 5CT4A 1GZHB 3KXPA 5HJ5A 4A8JB 1LI7A 2VF5X 3K8YA 1TD9A 5AJTA 1H6AA 3U3RA 3OGCC 5G4KA 5JI2E 3CCJF 2OFXA 3QVOA 4A16A 1TUGA 5FNZA 1V54B 2CLFB 2B5OA 3IR7A 1F9AA 1KBQA 4QUAA 1XPUA 5KI6A 2UU9B 3OP4A 3ZV4A 1Y7LA 3MGGA 2AW3A 3UAZA 3E2EA 2I4TA 4RANA 2Y9MB 1E18A 2WLIB 3K57A 2PI5A 3PD0A 4N3CA 4YEDA 4Z1OA 1JHXA 1QKIA 4RJ2A 3NTVA 3SYQA 5B36A 5HXZA 2JW5A 1XF1A 1NULA 3EW9A 2BFAA 3A0RB 3H1LH 5IAGA 4BIOA 1LW6E 4JSTA 2MINA 2X9LA 2XWSA 4D9FA 3M4JA 1OFVA 3KEFA 2OV3A 5F1KA 1YJ9V 1XYGA 1KE2A 5C7YA 4GZ3A 5TSDA 2ODMA 1EWYA 1GEGA 4PD4F 1J95A 1GFIA 2HBRA 2QP3A 4R8SA 2CLSA 4RZQA 4N8SA 2JI7A 4MUKA 1XZPA 3F67A 1TU4A 5EJ8A 5DK6A 2IXEA 1WP9A 2A4MA 4DQXA 1HDEA 2O2YA 4KO3S 1DCTA 2QN6A 3ZIAA 1XMIA 1QHHA 1FVXA 1EDOA 1E4OA 2RHOA 2XD4A 2C96A 1E99A 1YJNF 3DAHA 5B3SB 2OCAA 3DM9B 3E7PA 2BSXA 3ETQA 2FUG6 2NZ2A 4W4TA 1EK5A 2XIQA 4P4TA 4PYLA 5B66Z 2VXBA 4PA3A 2B37A 3X1JA 1HSZA 2JS7A 4Z9BA 4F7WA 5AVUA 3KKMA 5JZVA 3NVAA 3Q6MA 2ZQZA 1YZUA 2C84A 1VQ8V 1I7DA 3ZIUA 3PQCA 1GSIA 1SR8A 1JDNA 2YUIA 4JBGA 4LC1A 4QLAA 4N5DA 4B7XA 3PAFA 5CLQA 1PG5A 2IPMA 4RQAA 3OPVA 3B52X 1FVFA 3BKXA 1SG9A 4A0GA 3F7TA 2QL7A 3L75H 3GNQA 3GL9A 3NHAA 2FSHA 4M6WA 1KOFA 2PLFA 3G2HA 4Q6BA 4ZYXA 4G1VA 3IPCA 1FXUA 2VHXA 4QU5A 3RV3A 3SJZA 2POQX 3BORA 1DG9A 4GM4A 5B30A 1FTYA 4LZLA 3WMGA 4LJRA 1JKMA 4OY3A 4BBZA 3AEUA 5JYBA 1FW8A 1II9A 2GR9A 3KVVA 1P5RA 1WPXA 2A0KA 1EB9A 2RGBA 2QU7A 3KCYA 3NBYC 4FVTA 2NM0A 4I1RA 1J1UA 4R71A 4AWAA 2J3DA 3OEWA 4RKWA 5CNKA 1X94A 2PXCA 3P52A 3T0GA 3GZ4A 4FEEA 1T26A 1UBUS 4HQ0A 1WD5A 1FPOA 2YEVA 1SFRA 2WPNA 4TXJA 2B7LA 1CUWA 4BV3A 2DCMA 4WECA 1KP3A 2BHSA 2JCSA 4HLUC 3S1SA 5H59A 3MTIA 4XB1A 1AQUA 1DBRA 2HNBA 4DR1B 3AG4B 2FRVA 4ERHA 2YOFA 3HLTA 4G1FA 4RPKA 4BC1A 4EKDA 2C04A 4B8ZA 2OZEA 1VQ6V 2Z2IA 4PC1A 1DHTA 1AK9A 1HLDA 3K6JA 3LT4A 2NXJA 4JJEA 5JSYA 3SSAA 5KQGA 2CNBA 3JQ9C 4D9HA 3PJGA 1OQAA 3DO5A 5E1AC 1IBSA 2ON6A 2DYKA 1Y8QA 1UPUA 1W46A 5KNLA 3CPEA 5AI9A 4LPKA 3KU4A 4AS2A 1R0YA 5IG2A 2X5JO 4UB6Z 3DLTA 4V0SA 3LA6A 3TGWA 3TVYA 3O95A 1DAMA 2CDBA 2P69A 3LGSA 3OF3A 4TGLA 4ENSA 3GZNA 3J80N 1PVDA 1WXGA 4MIEA 4XSGA 1XDCA 3BK1A 4MVJF 2Z4RA 2F4VB 2ZYVX 2EX1A 1E0AA 1TADA 1FFWA 1L4MA 5DXAA 4M22A 3E0XA 1G8YA 2MT9A 3R3JA 2CMFA 3C8DA 5HPYB 2RHLA 3ME5A 1SBCA 4TZ6A 2ID4A 2C88A 1N2JA 3GJ5A 1W52X 3AG4C 4BT5A 2WM9B 4JIMA 4NPHA 1GN4A 3UAGA 4PCLA 4RDXA 4BU1A 3G6WA 4FSDA 1DJPA 4ZCQA 4CCWA 2B69A 4IO0A 4MW8A 1VMIA 3TQRA 4B31A 3GLKA 1NBWB 4E13A 5CFMA 1JR2A 1FXKB 2XUHA 1V71A 2NU7A 3D00A 4WASA 2GUGA 1P4JA 1HURA 1DAFA 1M2JA 4CEHB 1QZXA 3L77A 5JQWA 4OXSA 1REQA 4TS3A 5JDCA 4QEKA 2PRKA 2J59A 4PO1A 4BQPA 1IV4A 4POOA 1W49A 3CCQV 1NRWA 3PA8A 4B3XA 1KU9A 1SURA 2WG1A 3RVMA 2C2XA 4CQLB 5I8PA 2X1VA 3CX3A 3MYRA 3VR5H 3QTTA 4Q39A 3WWZA 2LWIA 2QM4A 4AIIA 2CV1A 4HUTA 3V7UA 1IVNA 2EU8A 3CUUA 1NSTA 3KJZA 4KZPA 4F9TA 4MVCA 5D00A 3NPAA 3QQPA 3E6AA 4EFBA 4I1VA 3TTWA 3SZLA 4QUDA 4QSMA 1Y3DE 5EQTA 2C57A 4P2GA 4YRQA 1NH2B 4DV0O 1YKSA 2FB9A 3WMEA 4QODA 4B4DA 4B8YA 1J22A 1JEOA 3E84A 3QVKA 4P32A 4EK9A 1DUSA 4M1WA 5K9ZA 1WPRA 3SY8A 3MVEA 5B3SC 1VLJA 3H2KA 3HTXA 2LR0A 3IYLW 4FCWA 4C6SA 2XGJA 3U5ZB 4RNDB 3PFHA 4UPEA 1SOVA 2CLHB 2XMSA 2P2GA 3INGA 3HB4X 3NTQA 3UF0A 3NT5A 4D3XA 2Q49A 5H02A 2QVCA 3IBGA 1U0FA 3MRXA 4D42A 1MNQA 4R68A 3EQ6A 1DOAA 4IY1A 3FOZA 1VRVA 3AR7A 3ZDBA 3K9FC 1FQKA 3B1KA 3OZRA 1F8YA 1K3UB 4MINA 4DJDC 4F46A 2VG8A 2IHUA 3F3KA 2GBCA 3KKEA 3RYIB 3LL4A 4CC5A 4Q66C 3FCCA 5CDSA 1Q7YW 5JMPA 1SZJG 4FBLA 4UVBA 2G6BA 3FKSA 5BY2A 5AVRA 2ZCJA 1Q7EA 4OGFA 1V4VA 4LF7B 3BWDD 3EEBA 3FZNA 2VOJA 5U9CA 1QAHA 5EB0A 1XL4A 4MP8A 1XEXB 4JC8A 3UWPA 3W7BA 1AP6A 2IOQA 1M3SA 3K8ZA 3LU1A 2C7RA 1TQ6A 2OQIA 3MWEB 5CA0A 3CMEF 1KMCA 2VJAA 3GUYA 4P4SA 3O9ZA 4Q00A 5HCIA 4B82A 4F12A 3T1NA 4BQQA 4NZMA 4O6VA 1ZJ4A 4IIJF 1V9SA 4F93B 3HK2A 2JZNA 2IV7A 1NUTA 3HP4A 1ODSA 9ABPA 1EEXB 3PF8A 3QJGA 1NMEA 4BQFA 4F96A 4UBLA 2CGOA 3R3SA 5B1OA 4RZ3A 3D7NA 3V4OA 2AXTZ 1JHYA 3GFBA 4I50B 4A8JC 3PLRA 4TLEA 5J4VA 4QAJA 5GQSA 1BFKA 1N6KA 4KQ6A 3GDGA 4OA5A 3V8EA 1JA8A 1EDEA 3TGPA 4EW1A 1EFKA 4WTOA 3UCSC 3JWJA 5KUKA 4LC9A 4BT4A 3E05A 1YB2A 1SVSA 1LWOA 3L92A 1EBUA 3EZ9A 4J7AA 4P58A 3BAAA 5TVKA 1YO6A 2R7LA 1DRKA 1WCV1 1ZUD1 1M93A 3KL4A 1DCMA 1XMSA 5AJWA 3RSGA 4CKWB 1VQLV 3N0WA 2VLBA 3BABA 2OPBA 3UMFA 4BVTA 2W6MA 4J7XA 4WW0A 4C8EA 2ZB2A 1OKKA 2Z9DA 1YEWA 4ZAWA 3MQFA 2DHCA 4EB8A 3F7YC 3KXIA 1H4TA 1ULZA 4FGJA 2QNBA 3WADA 2GHQA 3AHHA 3SAJA 1YR1A 2CJXA 1HDXA 2FW1A 2P5YA 1DBVO 3C74A 3E8FA 3K0BA 2FPPB 4UEOA 1NE2A 1V8DA 3HBFA 3CCUV 4P9PA 2W2PA 4ZHYB 4K86A 1KARA 2F7SA 2KI5A 2WG2A 3QF4A 4ZMSA 1UJCA 1IY1A 1QYDA 4XYGA 3V9PA 4H31A 1L4KA 3O2QB 5FPRA 2FPUA 3LL7A 4H3HB 4QUIA 4JI4B 3GLRA 5DP1A 3TRIA 2P79A 3ASUA 4IGKA 1JJIA 2G40A 4TQAA 5TMBA 5K0CA 2HS3A 3FDXA 4BP8A 4MGKR 1KERA 1LSUA 2FFJA 2LBXA 4WLNA 3RHTA 3LX6A 4MPTA 4WFQA 4OLJA 1G8FA 2D54A 1P49A 1FNCA 5KOHA 2CMKA 4XVQA 3BRCA 1AJEA 1DL5A 5J2UF 3AR5A 5T6BA 4FLWA 1TL7C 5TVGA 1N5LA 2CNOA 2ALEA 2I91A 2CHQA 3S55A 3QMVA 1IXBA 2Q8VA 1F0YA 1JJOA 5EI5A 4G26A 3OFNA 4S24A 2XA9A 2GPJA 1U0GA 3QKIA 4GR9A 3UTDA 1WUJS 3I04A 1TZCA 2A35A 2PU7A 2TSYB 1ZH6A 3PT5A 4L4SA 5BSWA 1NF3A 1S77D 3QUAA 3PZRA 1CS4C 1I5EA 3DYBA 3QYJA 2ZTUA 2WFLB 3AFGA 4JBNA 1DGQA 4DR5B 3ABKC 3WIEA 2EILB 1F2DA 4MP3A 4ZI7B 4JQCA 5IVIA 2IZ0A 3H2HA 3RVBA 3T99A 3SQOA 3VYUB 5BP7A 2JJMA 1M4UA 4EY3A 1HFWA 4Y2RA 1N3IA 3USZA 1ZK4A 4JT2A 3Q8MA 4AJJA 5CYGA 2HX0A 4Q0MA 3F9RA 1A8SA 3G5LA 5DGIA 3UOGA 5DHTA 4LH6A 2ZM5A 1YFLA 5J9PC 4CG3A 2W2KB 5CA0F 1WCIB 2GVZC 3V46A 4EM6A 2RBKA 4KKVA 1YF3A 3D64A 3H42B 2YDXA 3QU9A 3IODA 3FCYA 5G0UA 4FFDA 2XWPA 2A3QA 5EWLB 5EZ6B 5HY0A 3UWKA 4CUJA 3SXJA 4ASUA 2AE2A 3B13B 2AN9A 2DLNA 2QPOA 3O92A 1UOOA 1HBJA 4BRSA 4CQMA 2GZAA 5GGYA 2FTKE 1JSXA 4TMWA 5EE1A 1O3YA 2DT4A 1OGIA 4HB4A 3TLMA 1KH1A 4AWXA 4KSYA 5EMNA 5JLAA 5FWAA 1JHMA 3OESA 5CLHA 4KI7A 2LKDA 2R85A 1XJQA 1Z15A 1I7NA 1TC1A 4H7HA 2GVIA 2ZUWA 1NUPA 3SKXA 2QROA 2CJWB 4M0PA 1QPBA 4KR3A 2X0KA 4X5OA 4BWVA 3H1KH 1VZ3A 1X7YB 1O6FA 3TZEA 3VNQA 5BQFA 1SQBH 1NVPD 4PZDA 1JKFA 3N0TA 4YX9A 2B4AA 1NBMG 2CFRA 4OGWA 2XNKA 3VM6A 4GPIB 2O4UX 4JI6O 1T6XA 1LBEA 4X61A 3LTEA 4XCQA 1T5IA 5U4QA 3BUSA 2WLKA 2UVQA 3IKEA 1BQEA 3QX8A 4UUQA 4CM4B 4GMGA 5T8KC 4O4LB 5HFLA 1FU4A 3K2QA 1PG2A 1Z13A 3AK2A 3LDEA 3VQVA 1XBLA 1E66A 1Z7GA 2ERCA 2FWBA 3I04M 1U2SA 3K0EA 4J2OA 1BX1A 3O4IA 1YS6A 2J9XB 5EZSA 5BYJA 1QLEB 2JFWA 4AZSA 5A9RA 5JJJB 1P17A 2OZPA 2ECQA 4H6VA 4J1TA 3CF2A 2G04A 1O95D 5B1NA 1A72A 3O5AA 5KX5A 3M9XA 3R9XA 5BN3A 4HH4A 1XU9A 1P1FA 2QKAA 3T1HO 1UXOA 3HRHA 2B4QA 1GR0A 4LVOA 5SZKB 5KPDA 2QIPA 2Z4SA 4KYIB 3ZHZA 4TOIA 1WAZA 2J9FB 4B7AA 3C3TA 3ROZA 4ZO4A 1WW2A 1IN7A 1IB6A 1ZM9A 2WYUA 2ZJ3A 1FPMA 2ZUUA 1R0WA 5C1DA 4YJFA 3M3DA 1GM5A 1NUHA 1EFPB 2UYCA 1GN6A 1K68A 1WS6A 2OCXA 1XJ0A 4K3VA 3T1TA 5HKBA 4GGMX 4H3KB 1NR7A 4JJ7A 3RJ5A 1ZVQA 1HQKA 1I2ZA 2V7PA 3QHQA 4OHMA 3SYKA 2OKGA 1TVKB 3I8XA 5YASA 4LOJA 3TKAA 1USVA 3R41A 2QSAA 3QVWA 5EFZA 4I8DA 4J4BA 4TWAA 1MAWA 4GWLA 1NW8A 2FWAA 2PCLA 3K0FA 1BGVA 1CY0A 2HKIA 3A1VA 3V34A 3O4FA 2D2FA 3A28A 1J0XO 3D8HA 5DGHA 1EDDA 5B3AA 3ZLUA 5HGJA 5BY1A 3K71B 3R3XA 3QW4B 3OM1A 2C2YA 1D4OA 4Q4LA 1OB5A 5F1PA 4Z4GA 4U5XA 4BLOA 3LF1A 3K6RA 2FUKA 2WSSG 4MVJA 4MTFA 4BMXA 4RMNA 2CUGA 5J4YA 3B6NA 2WLHA 1XNGA 1V11B 2NXWA 4RA6A 1G291 1K98A 2QVXX 1RJGA 5DNWA 4WCVA 4UU1A 3PCRB 5GONF 3IA2A 1IY9A 1ZN7A 4Z4EA 4JAAA 3E03A 5KNCD 1MOSA 2FSIA 1XMJA 1GTL1 1KYIA 1Z35A 3AETA 2D7JA 4IQ0A 4CMJA 3A2MA 2VUIB 3HYSA 3ABSB 3K72B 5A02A 1YA8A 5FO0A 3PBKA 1ENYA 2JCYA 3PHLA 1S5PA 4PLVA 1J5XA 2IYFA 2RMKA 1KAGA 3ML1A 4E46A 1WSWA 4XB6B 3H2GA 4EVQA 3ZI4A 4Y1FA 4JFRA 5DTJA 2B5UA 2Q2OA 2BBOA 1H2EA 3BH0A 3BMXA 1AIPA 3CE6A 2CKDA 3ORFA 2BM1A 2NOAA 4FS3A 4C0AC 1Z7EA 1Z37A 1I3CA 1ZI8A 2AOTB 2JA1A 4Z99A 3X1WA 4QRDA 4BLUA 5G4UC 3COSA 1V5FA 4G9BA 4KXLA 2AI1A 5IDVA 1Z82A 5LBTA 3SVLA 2FSFA 4TYPA 4LKOA 4BXOB 3GHYA 2BFBB 3WLAA 3ZMZA 3HWSA 4WK2B 3WV4A 3QPBA 2I0FA 2N04A 3W6ZA 4DCMA 3CRRA 4FYVA 1OLXB 1P5FA 3H83A 1OLSA 1YQQA 5KNDH 2QW1A 1XL1A 1W40A 4C4OA 1KC8W 4RQUA 3ZZMA 3FHJA 1HT3A 3UK1A 1Q92A 2F1RA 1ZIYA 3IIEA 3PE4A 3L0PA 2Q3LA 1K5GA 1ISRA 3P3PA 1M6WA 4CE6A 1Z26A 1RP1A 3R6GA 3MUNA 2EQAA 4GOLD 3COJA 5AKZA 4BV2A 2XT9A 3EK2A 3LECA 3LOQA 1O77A 1PFKA 1T1SA 3DPSA 5DM2A 2EULA 1DIGA 5SICE 3UQZA 1W2GA 4DNFA 3AF6A 3DKRA 4BJHB 5HP4A 4PCUA 3AUSA 2VHEA 1SCAA 5KYYA 1JR6A 1ROPA 1GTMA 3M0EA 3NT4A 4FYMA 1TO1E 4ALJA 4OG2A 3DOOA 4H7PA 2AHRA 1Z0IA 3EYWA 1A32A 2AWNA 1EUDB 3H8JA 4O29A 4MB6A 2I7XA 3VMMA 4CMEC 5LYJB 4UQPA 3WP1B 1K8XB 1DS6A 3SYPA 1E2KA 1E8DA 3RC8A 1SQXH 3RS5A 4Z3DA 1J8YF 3O9OA 4S0XA 4X3CA 5HF5A 3BJEA 4PC3A 3L6CA 3JARA 3VTFA 4Q12A 3IBYA 4OAOA 4TQ9A 4Y6SA 3ZQ6A 3EF0A 3HEMA 2PRSA 4IBOA 5F9MA 5G0VA 1EFHA 1QO7A 4O4IA 3AESA 1C80A 4UHFA 2AOUB 2PQMA 3PIDA 4UW9A 1QQAA 4DMCA 2C2HA 5M2QA 3RABA 3WZLA 1U28A 2ZSHA 2POCA 1YTUA 4ZRNA 4EX7A 3E2IA 3MJRA 4PDRA 3AUYA 2FF5A 3KEQA 3G0HA 3GLFE 1C0LA 4PAMA 1Q6YA 1ZX3A 2ZBUA 3T4UA 1DCFA 1YAHA 1VE7A 1H2SB 2EW1A 3DXZA 3EVEA 4JITA 1A7AA 1RQLA 4KO1S 4QLOA 1F06A 4O1IA 4GR4A 3Q12A 1A0OA 4Z0TA 3GFVA 3BN3A 2XGSA 3ETNA 3A2FA 5LGUA 2XT0A 3B12A 4ZCMA 4B34A 1E89A 1ESZA 5D2CA 1CE8A 4DXDA 3D1LA 4Z86A 4O4JA 1HPLA 3EOAI 4JX9A 5LUBA 3UUFA 1UBJS 3HA5A 5LJIA 4K9NA 3B3QA 3M6LA 4KRYA 2NSJA 2I9KA 1EGAA 4TTIA 2GD6A 3H11B 3OIFA 821PA 5K0JA 1N6HA 4R98A 4QFMA 1M2HA 3B3FA 1D4AA 4G1CA 3V2HA 2WA3A 1NT4A 3C6MA 1Q7BA 2ZANA 4GL4A 5DI3B 1O4VA 2W7TA 1OH5A 2I71A 3A1CA 4GSLA 5DNVA 1IDSA 1Y48E 2R8XA 1PN3A 2Z2KA 5AJZA 3JAWB 1RYBA 5AKGA 1P0CA 3TLKA 3LUGA 3MF4A 4QTTB 2O7QA 2J9RA 3II6X 3H1HH 3LXMA 1EE1A 4LDAA 3O94A 2C3OA 1C0EA 4EI9A 3ZXUB 3U56A 1RXSA 3A3OA 2QTRA 3DOHA 2OIGA 1MDBA 1E2MA 2JK5C 2V3WA 2Z83A 3PFBA 2G36A 3R7WA 4BVBA 2REBA 4D3FA 3GRPA 1XDZA 4F2HA 1EIZA 4EI8A 4X3MA 2B98A 3G68A 3H9GA 3P2JA 1WETA 1WKVA 4P7JA 1UWLA 1RWBA 1PBTA 3ASNC 1IU9A 1OXVA 2JLBA 2RGNC 2XAUA 1YDEA 4EI2A 3IEKA 3GB7C 1M8GA 1PW5A 1H2MA 3WJPA 3ABMB 4EKNB 2OCPA 3ADKA 2K4MA 4U3JA 3NUGA 1TT5A 3MPOA 3AINA 3ROEA 2Q9LA 1JTVA 5KNDA 3KJKA 1K97A 2PSFA 1OOEA 4R2MA 3WK9A 3WQSB 2WU8A 3NWJA 2R79A 3OE7D 3LHKA 4GSKA 1XQWA 5KYVA 4BO9A 5ENVA 3GNTA 1JE1A 3LZCA 2A84A 4UEQA 4BNDB 2IYUA 4FQ7A 4IWXA 3NHWA 4G8CA 1IURA 5B57C 1G8GA 2C0QA 5C8YB 4S0ZA 2XX3A 1W8IA 5DZSA 5A4AA 2IZOA 5FOUA 4FR0A 2D7DA 3RG8A 3CCSF 1IJEA 1WXEA 4DTCA 3STLC 5C8ZA 5IWAO 3ZR4B 5C8YF 3EEOA 1UFYA 1NA5A 3GCWA 3OE4A 1OZ0A 4MKZA 4MS3B 4KITB 3GUHA 5CB8A 5HZMA 4XPZA 1AI6A 1JJFA 2KLBA 1UMBA 3TNYA 3FVQA 4PLZA 3A4IA 2P7HA 3NJ8A 2B4YA 2X9GA 3LXXA 5JHGB 2DCUA 3EISA 3ZG6A 1FU7A 4MH0R 2H08A 1RJDA 1WAMA 1EJBA 1XMOB 2W2OA 3NBXX 4OQFA 1YB6A 3ZU4A 1Y76B 4HXEB 3S27A 3C1TA 2O06A 4MRVA 3VTZA 3EH1A 3HYTA 4BUJA 2ZB3A 3V4LA 4QOJA 5CVEA 2VP3A 4CMCA 3QXJA 2XDQA 4ZJUA 5I9LA 3PNLA 3VOAA 2ZRMA 2W6IG 1VKJA 2GAJA 1UZNA 4M9UA 1ODJA 3AJRA 2OGZA 3LCRA 3WJ2A 5EJ5A 4O3MA 2HP8A 3CPWU 4JI8B 3SS9X 3IKLA 3BGWA 1T8TA 1GAQA 4DR3B 3VC2A 5H2FZ 3OHSX 3VOUA 2AT1A 3AUXA 2BY4A 3I6ZA 1V9PA 2ODWA 2PSDA 5AI0A 3SYLA 5B3KA 1RYDA 5K1XA 2UUOA 3K0DA 5KJEA 2P06A 1CS0B 4UBJA 3AJ9A 5D8DA 3ZHYA 1HC7A 4M7WA 2E4WA 4LF6B 1JSLA 1PDVA 4XAQA 2BGWA 3ZHBA 2PJDA 1E7RA 1YQXA 5HP8A 2Q7XA 3M33A 5JY1A 3K5LA 2A1TR 1L3BA 1R4NA 5B64A 4UULA 3GGPA 2V5AA 1G5IA 1ZOLA 2BSKA 2BBTA 1IRXA 2A0UA 3E8XA 1YS9A 2FZCA 1B0AA 3BA9A 1ZK1A 4JTAB 3TEJA 3H9UA 2R96A 2OBNA 2VDLB 2XVAA 4OJYA 2PMFA 4ZV4A 3LSQA 2ECOA 3UPDA 5E4FA 1GGJA 2ZIXA 4E5VA 1GR1A 1BFDA 1KKLA 3QA3E 2YMPA 4OFWA 1RI4A 3EVAA 3TZLA 1G9TA 2DQZA 3D9QX 3TL3A 2BP7A 4DV2B 2G4LA 4DL9A 4ZI2A 2WZQA 4CETA 1QTIA 4PRKA 4BNFA 2DYSC 5ALZA 5LBQA 1NQOA 3H2JA 4YJ3B 2A1IA 3DFZA 4FOPA 4GW3A 4H15A 1PNMA 5EMMA 3FGOA 2OYRA 2HW8A 2H8EA 1BS9A 2D3TA 2H1HA 2Z2ZA 4FI3C 4LQCA 4IXTA 5K8CA 4HMOA 4PC6A 4LF8B 5ALQA 3UMGA 3KJEA 1ZX1A 5DI3A 2BISA 1P5ZB 2QTTA 2VF4X 5CIWA 2WYHA 3KD2A 1S72F 1A4IA 3FI9A 5KZMB 4H7EA 2O3TA 3HGTA 3LBNA 5EIEA 4UVCA 1G16A 2QLNA 2H3HA 2DT5A 4DR2O 4NXMO 1PGJA 3TZKA 3ZI0A 5GPBA 4EA8A 2ZDHA 2QPTA 3V2GA 1NVAA 1PSDA 1GPH1 2ECPA 4FZ0A 4NNJA 4IJUA 1KNKA 1E1CB 3GYQA 5L51A 1YDGA 3R7SA 3HUDA 3RRMA 4H0LB 1IN4A 3C3XA 1US6A 2KGWA 2OTJV 3AWDA 3SZ3A 1CE8B 3L7CA 2IDKA 3DVAB 1HDGO 2W6PA 4ZRDA 4EB0A 3REGA 5CCEA 4ZTUB 1GRVA 3CPSA 1UBLS 1AZTA 1X3LA 2D4AA 2WSLA 2GZMA 3A1NA 3CRW1 4QDKA 2BF7A 1KMQA 2R6R1 5CB4B 4BX0A 4IFIA 4X92A 3UO2A 1RYZA 3QI7A 1F2UA 2LIVA 1KDZA 2UYPA 1ELOA 4QDXA 3EDRA 1IFXA 6REQB 2XCTB 4D9KA 2ORYA 1QGOA 1XRSB 3NH9A 4ZQEA 2RGGA 1P2DA 1OYVA 5LHHA 3HKDA 1PD0A 4R81A 2UAGA 5JCXA 2Q1XA 4YR7A 3CZAA 4J0IA 3GEPA 1ZZEA 1ZM4A 4RORA 1E8NA 3P1JA 4TMXA 1IQUA 1KFJB 3JARB 3IAS1 2WLNA 3JASB 4KJZA 3ZWMA 1B1CA 4F91B 3B85A 1T5TA 1GPYA 4BKQA 1SUEA 2WBLC 4DR5O 2AUMA 3B8HA 4U6NA 2F64A 3JQFC 1ZKDA 4QFBA 5C3MA 3U9LA 4JPRA 1D4ZA 1FFBA 1XTIA 4JAVC 4J1SA 3T1YO 3ONWA 1AKEA 5EZYB 1E6WA 4Y2YA 5FTKA 4PELA 3NBZC 2F9ZC 3OW2F 2AQIA 4MUEA 4WXHA 1S6YA 2ZTVA 5C0OE 5JD3A 1U9IC 4FGZA 1R0XA 4P0PB 1D2AA 1K9SA 4B74A 3DHEA 3L46A 4CGYA 1XX6A 4A73A 2HJWA 2G1KA 3LWRC 2AV6A 3GUZA 4MIOA 1JA1A 2JJ1G 4PZLA 1EFVA 2HB6A 1UADA 3QXGA 3UK2A 1GZ7A 3AM3A 4PG4A 1I1QB 1UJNA 2BGLA 2O7SA 5HWEA 4N8EA 1LWNA 1XILA 1QGED 1M57B 4IH4A 3TDMA 3HJRA 2PX5A 4KAAA 4P3NA 4QICA 4C30A 2W2KA 4FFBB 3HDQA 2GZLA 4G4SP 4GPTA 1WUHS 5B6IA 3LDDA 3VYUC 2WAOA 5EMLA 2P4SA 5DN6D 3D1VA 1JKJB 2HD4A 2X6BA 4PZZA 3UBMA 1C8KA 3NVDA 4KK3A 4ZCLA 2YCLA 4MTGA 4IRMA 4MGYR 4MV5A 5A1JA 5KYWA 3LVFO 4YUYA 3INNA 4EG5A 3TPCA 1K9MW 2CNWA 1K89A 4HNAB 2VGNA 1WOYA 2ORIA 2C7OA 4DY6A 3K2BA 3DEAA 3V48A 2EGUA 1H9AA 2B78A 3G0DA 2QRVB 4D4LA 1JMVA 2JGKA 2NU9A 1HYEA 3AEIA 5DFAA 1A7KA 1GDDA 2PZBA 1L9KA 4P84A 3B8MA 3SJAC 2VUTA 4C0LA 4AJKA 3V00A 4G1MB 1E3MA 4P92A 3G5AA 3GFTA 2I8LA 4G5RA 1AO0A 3DTNA 4IIVA 4LCJA 1QQ5A 5CURA 3RAFC 2DHRA 4GQAA 1ISIA 5WRFA 3L41A 1OH7A 4MWEA 4DUGA 1QF6A 1DG1G 2RC5A 1S4MA 4UM5A 1I14A 4M9CA 1UC8A 2OVBA 1F48A 4R31A 4PSCA 5GZ6A 3HM9A 3TLGA 5JU6A 1J8FA 1J8QA 3F0TA 1PV1A 4LJSA 2PGNA 3O8OB 4V2IA 2KQUA 2BSKB 4MLDA 3WVNA 1E4YA 1NIJA 3AF4A 1R73A 1P7WA 1W581 3WMWA 4DCOA 3MIIA 3WTCA 4MLZA 4ES6A 4YP9A 5KOJB 4DQVA 1FFGA 3G2OA 3VNUA 1XZGA 5DW3A 1BHSA 1NKDA 4KQHA 3TNLA 1MF7A 1VMGA 3NIWA 2L6LA 3BGOS 3SJCA 4BECA 1NSYA 2ODEA 1YHZA 2WMYA 2YSUB 4J10A 5ARCA 1QO9A 1KH3A 1G6Q1 1MJGA 3CUSA 2Q45A 4YACA 5TNXA 1UC4B 3I76A 3QXSA 3RJZA 3V4VB 4IIBA 5J43A 5ALGA 3A6GA 1M1NB 3EEYA 1LD3A 4QD3A 4UJ5A 3K5NA 1IULA 1BGXT 2RHWA 3MK31 5ALIA 4RENA 3RASA 2VDOB 1W0KA 1NW9B 5EJ4A 2X4LA 1H05A 1Y7PA 2C0CA 3JD2A 4PRYA 3D54A 3B5EA 4O4HF 2PAAA 2ACEA 1QQ6A 4YAIA 1RYMA 2VRCD 2O2CA 3PUXA 4Q01A 5AJXA 1RM1B 4EL5A 1OCCB 3C6ZA 2O8FB 1D0VA 3IP7A 2R2AA 2NLOA 1U8TA 2NAFA 4UHBA 1XNQO 4DYHA 3ITKA 2QN2A 4XUGB 2HP3A 3HEBA 5DH9A 1GK9A 5I4IA 3RT7A 1IY2A 2EKQA 4DMUB 1HQCA 2NU9B 4PS1A 3UENA 1W76A 2DMRA 3UG6A 2ZI6A 5AXDA 3AEQB 2WD7A 2SICE 1YOVB 4IHJA 1HTTA 1UIMA 2PD3A 1R12A 3NORA 4IV0A 4RVNA 3KPVA 4NPAA 4BLWA 2FQWA 4LF9B 3PXDA 4XJXA 5IT4A 4R1TA 4JBWA 4QNHB 2EBOA 1HNZO 1UPTA 1W88B 3B1FA 3MCTA 1H5UA 3ONDA 3MTGA 1U2RA 4KWHA 4E5KA 1YJ8A 3VPAA 2Y68A 3HKEB 3W7SA 1ENOA 2OQRA 4FPXA 5FJJA 4EW2A 3ZHVA 3WL4A 1EJ0A 1PDWA 1P8AA 3AIIA 3F8TA 1VL1A 1ULUA 3EXHB 4CFYA 2FJPA 1C9DB 4TWZA 4BLRA 5LFAA 4CM9A 3O03A 2O2ZA 4NLLA 5E6RB 4WJKB 3Q7RA 1QHXA 1XTJA 3A6EA 5FUQA 1MXFA 2ZDIC 1U0EA 2I6QA 3AU8A 1NNSA 4WZAB 5LP6A 4HFRA 4GICA 4L3OA 2IHNA 1FFYA 4RGBA 4R1SA 3QNUA 4TVOA 5IH3A 3VKUA 4KDCA 5JNWA 3H3JA 4RHFA 2EGGA 4M1TA 1EXWA 3I9OA 4DV3B 3IKVA 4UVEA 5E2AA 2ZF8A 4LYGA 7MDHA 5CM2Z 3EC7A 3L49A 1UINA 3ZD8A 3U5TA 5L3GA 3CXCU 1OU4A 1EBBA 3UB4A 1LPBB 4MO2A 1P77A 1KO1A 1F8UA 2PA3A 3K5MA 3C3AA 4CH4A 1I51A 1RIFA 3EEFA 4U5QA 1DKUA 1RD4A 4ZWNA 2AZXA 2XT6A 4QOIA 4MV0A 3KT8A 1QK5A 1A8IA 2RGCA 4I1IA 4B08A 5FT9A 1L4GA 2WYOA 4FNMA 1O03A 4MRSA 4HI0E 2P7TC 3M5PA 4RGQA 3RFVA 2YXDA 1E9AA 4HH0A 4Q48A 1YS4A 1FLNA 2WA2A 2ZU0C 3JRXA 2PK3A 1WP7A 4UOZA 5LU8A 3IMCA 4RA9B 4F06A 3RAJA 4JJ4A 2UKDA 4V0RA 1RQ7A 2C82A 4Q7MB 1E7QA 1GRQA 1NVBA 2PL5A 1SUCA 2VRZA 2FHSA 3G13A 5EXXA 3UH0A 2AVNA 8OHMA 3VKFA 2UUAO 1DZ3A 4RESA 1SK9A 3LMEA 4L2IB 4RMGA 5CCDA 4JV5O 2CF6A 3SIXA 2Q3MA 5JV5A 1F2UB 4QBGB 5DCVA 2JLZA 1HNNA 5CB4A 4N41A 1DGSA 1YKFA 4OQNA 4ER7A 1C50A 3AM1A 1DX9A 2PZ8A 1E6LA 1LXCA 2P8JA 4LYEA 1M0SA 1LEHA 4N6OA 5CT8A 1N75A 1OVGA 2OR3A 1F6BA 1S8NA 1BCCH 5L8VA 2XPCA 1CP2A 4UTVA 3QYAA 5FWYB 4XGIA 4REQB 3LG2A 3TGUH 1NJFA 1YDWA 3CW9A 4W4KA 3RVLA 3EDOA 2J6HA 2XAHA 2VWKA 1J99A 2RHDA 3ITEA 2CXXA 3C3DA 1KO7A 2OWDA 4F97A 4UCVA 1KYXA 4RIHA 1YU6A 4K6GA 4JL5A 4UFNA 3U4AA 3H5TA 3HXQA 3C7TA 3V3TA 3I01A 4RTSA 3D2LA 5HG0A 2CYCA 2Z8XA 2Z6AA 3HHPA 1T1RA 2Q5EA 5B1BB 3MDOA 2JLWA 4U2KA 1FNNA 1C7QA 4V24A 4WX2B 1Z5PA 1W4RA 3T7KA 1FS4A 1U2PA 4N7MA 4CH6A 3ON1A 3LPNA 2OOSA 5C5CA 2GSMB 2GZDA 4IG4A 3FKSG 3TUZC 1U7ZA 1N2SA 3H19A 1T34A 4QIHA 3O9MA 2W0SA 4FDAA 4D8UA 2VR1A 1RYHA 4R41A 3SZOA 5JJEB 1MJFA 3UM7A 1GCUA 4BFZA 4B3MB 3VVMA 3WGYA 4QUKA 1V3TA 2P2LA 4CBCA 1WHTB 3UMYA 1ZVVA 3QLVC 1CDZA 4C2BA 3T5AA 2UVPA 5ILGA 2PUWA 3A4YA 1GZUA 3HRIA 2OZLA 3P45A 3P2OA 4LMAA 3CEJA 1TCVA 3RBXA 1MW9X 3L8MA 4NFLA 2H63A 4MWOA 2PZMA 3R77A 3TRDA 4EB3A 4NOKA 5IM4A 1T0IA 3CNHA 2WY2D 5GAPK 2FW0A 1AGXA 2JH3A 4J76A 1NJ5A 5EXTA 1KOJA 4F4IA 3VU9B 1I3OA 2HZ7A 4FIPC 1IXRC 4BPRA 4F4FA 4AY6A 1D2CA 2HSJA 1ISMA 2G9VA 1SZDA 2ROQA 3FNHA 3TK1A 1ES9A 1J2EA 2I2WA 3NHYA 3MTBA 4LTNA 4F3TA 4FX2A 4LMBA 4B7KA 1S96A 1QDLB 4AW9A 3CB2A 5LMNO 1D2MA 4NV0A 5JDCC 1U7OA 1XZQA 4MHOA 3S5UA 3WOHA 2BE9A 1EQ2A 3QKSB 3E9RA 2ZODA 4QBFA 5F23A 1SXPA 2VF2A 3FY4A 4JLSA 3H16A 5IJAA 5DIZA 4BGEA 1IEQA 1K7EB 2X7JA 2PO7A 2PAFA 4AYTA 1KEWA 1PNVA 3ZEIA 3KQNA 2G9UA 1CJBA 4P3KA 5AUPB 5GONA 4G0NA 4URHA 2Q5OA 1EFCA 1N6LA 3ET5A 3ZWDA 5J1SB 4AY2A 2E18A 2ZR8A 1FDVA 5DRTA 4CODB 4CM5A 1MZFA 3FJOA 4BB5A 5IFKA 1AB5A 3RYIA 5SZJA 3OMWA 3DE0X 2ZJ2A 1HKUA 3FWKA 3LWBA 5BR8B 4MW7A 3U4GA 3ICQB 4U02A 1SPBS 721PA 1Z5OA 3ANXA 1SKUA 1EFVB 1RHKA 3AEUB 4F5ZA 1MO4A 1ARZA 4PI2A 1X1QA 1L7DA 3A14A 3GT0A 4IP0A 3R7WB 4DDVA 5CXUA 5M5BA 2PUAA 2YS7A 5IK2D 1KS2A 3T3OA 3TMAA 2VTEA 3A6PC 3TXQA 4H08A 2GEUA 3CUTA 3L1IA 5DM0A 1M10A 2ZYSA 5KEIA 2Q1UA 4J94A 2I3DA 4AG5A 5B1EA 2XLCA 2M6SA 5BNIA 1PZNA 2DU8A 4MRMB 4NU8X 4UOQA 1Q3HA 2DWUA 3B6MA 1QD9A 2QW8A 4DWOA 1UFKA 1JVNA 1MD9A 1R9JA 3UO3A 1SKYE 3BMQB 1VL0A 4C0KA 4G0WA 1XEWY 4ALKA 4Z2AA 1U1CA 4XLLA 3WK5A 1G20B 3VDNB 2J08A 4TXMA 3B70A 3ABOB 3I5DA 4ZOQI 2E4AA 3DAOA 3WK7A 2IS2A 3B8NA 4H27A 1IBLO 2A92A 4KEAA 1GN2A 2GHRA 3OBBA 3WGHA 4EUEA 1I7FA 3NO4A 4ND8B 1G1AA 5ELMA 4TSFD 1J2UA 4DUPA 3DF9A 4JLNA 4AP5A 4BO3A 3F4LA 3OOYA 4BVFA 4CEHA 1EIWA 3BMQA 4BAGA 5EUBA 3RRBA 4QDJA 4CS3A 1T36A 1ZTEA 4OFXA 5C8DA 2OTCA 5FLXM 3FVVA 1QVZA 16PKA 1NJSA 1E2EA 2BOBC 3LKDA 4RY8A 4OB6A 1RZRA 4X7BA 1RWNA 4NKGB 1LDGA 3C14C 1NM5A 4LWQA 3P4YA 2B1IA 1FE8A 2D2IA 3ZCTA 3H9EO 4A0HA 1GN3A 2YWCA 3EZXA 1YBMA 3DE2X 3HB7A 2QRQA 3L8EA 1FOEB 3C7DB 4MKGA 4YDSA 5D5HA 4KR2A 3AIKA 3FVRA 5BXQC 4RIIA 1QVFF 5TE9A 1UBSB 1EZZA 4ZCRA 4AZ0A 1RPRA 2XUJA 4GSYA 4UASA 5AVKA 4IH1A 1BDJA 5EZYF 4IICA 2IIVA 5DXJA 2GEVA 4QFCA 1L5QA 1U2QA 3L6OO 1HQYE 3G3EA 3W7AA 1C3VA 3EIFA 3Q10A 3QE4A 2NYVA 4G89A 5CP8A 1YQEA 4B5KA 5A62A 1RXYA 3RTGA 5JS1A 1VF6C 3ZUPA 2QVBA 1M1YB 1KY3A 5G4KB 4CKCA 2VH5R 1P75A 1MJNA 4JQSA 4IIGA 4F4CA 3ZEAA 4B5LA 3WA7A 1KWKA 1J6UA 5ES4B 1YASA 1N77A 1KVUA 3COWA 3F3MA 3WG7B 4G2TA 4YV7A 3U10A 1WY7A 4QNMA 3WB0A 1YE5A 4CM3A 4RIFA 2BCGY 2BFCB 2DFNA 2PSHA 4IOJA 2YI8A 1WXXA 4Q4HB 3TOVA 5B4TA 1L5OA 5K0EA 1AZLA 3O7WA 4IGGA 2F4NA 3ZDFA 3KWJA 1DZIA 4DIOA 1LGYA 4NBWA 1SUWA 4RPLA 5LQJA 3E1KA 3L1UA 4F3YA 1UPAA 2QN3A 1JVBA 3GGGA 4K6MA 1V1JA 2V3CC 1Y42X 1NN5A 3D6AA 4Q6WA 5HKKA 3KQHA 4FYPA 4U2GA 5ISMA 2Z01A 3BFJA 1NT2B 1JTEA 3R3ZA 1USIA 3SR2C 4D9MA 2YY7A 2XB9A 4MCJA 3I58A 5H83A 2OZLB 4ZZ2A 4CKYA 5ESXA 4ADSG 4F04A 1WDKA 3QO5A 2LE0A 1FJHA 3FYUB 3WGKA 3B89A 3FUXA 4LZWA 4CS4A 1KKMA 1YNSA 3CEMA 4FJ2A 4RZSA 3UV6A 4EBFA 2J4DA 1NUAA 5B1HA 2QWOB 1X7XA 1SVWA 3W5VA 1QKKA 2O8NA 1MB0A 2JIDA 3DBRB 5G4LA 4BU0A 2O6HA 4HMQA 2DSTA 2ID7A 5ITSA 4XPIB 1M6EX 4K6OA 5BRJA 4FGLA 4H0CA 3V55A 8LDHA 4CW7A 1A7UA 2DGDA 2YV1A 3LHFA 4B9AA 3UQYS 3BHNA 4KLNA 4MKHA 1W47A 1W93A 5FV4A 5FA8A 2XWJI 5BSMA 1XZJA 5GIPE 3WGLA 1FNSA 4OF4A 3EVZA 1SVUA 4LFAB 3IUBA 4OKNA 4WOJA 1IY8A 3C15C 3V7QA 5B3JC 5LMUO 4X1IB 4CLRB 2WTMA 3RC3A 2CLOB 4IQFA 5A2QA 4WNYA 1H5QA 1V0JA 2H1WA 3DEHA 1QS0B 4US0R 4X63A 5FLKA 5T41A 1DE0A 4D41A 2IHKA 4MS3A 4PZCA 1KSHA 4MR7A 4CL8A 4MW4A 1GDTA 2QRKA 1HWYA 1UANA 4GD3Q 2AZDA 2VJNA 2BGUA 4L73A 4UFZA 3PRHA 3PTAA 1X74A 5FI1B 5L3DA 4C8GA 1E3TA 2E7ZA 3HCAA 4HAYA 4KSBA 4WA8A 5L53A 3D5EA 3PR3A 1NKVA 1UKYA 2JH8A 2P9FA 2Y0DA 1A96A 1FK8A 2FPGA 2GJ4A 2Q5CA 1VLZA 1OR8A 3VO1A 2YXLA 3A6ZA 3JPWA 4IUDS 4PSAA 4AUMA 3T7JA 2PEZA 1C7RA 4DK1A 4LBWA 3SQWA 9ATCA 5FOXA 3IUEA 3OW2U 5H82A 2H0RA 2CSLA 1NJ8A 2G8LA 1SC3A 4PQGA 3HL0A 5CLLA 1PTJA 1T8YA 2MR5A 1CQIA 3GRVA 3KZKA 3P2IA 4D0LB 2AD1A 1RSOB 5KA5A 1ENZA 1SXJA 3GEMA 2ZM6O 1QDEA 4ZIRB 4FJCC 4L8LA 1HXHA 1VQNF 2ENWA 4ER3A 2A9OA 5TEWA 3TPFA 3K9WA 5KAPA 1RCFA 2QI2A 4O0MA 3A4NA 4YPVA 2BLLA 2WD8A 4MPRA 4A8JA 2OAQ1 4J1TC 5K0TA 1ZRMA 5KYKA 2IZ5A 1OZFA 1J07A 2VSFA 1ZUQA 5HFJA 4EFEA 1Y66A 4N40A 5CX1A 2H8KA 1S8AA 1YZKA 2BLNA 3PGMA 1G3UA 4U4AA 1C1YA 4G65A 3H99A 1HI9A 3C4QA 5HF6A 4NFHA 3VYVA 4EATA 5KX5F 5ITZA 1BQ4A 1IUNA 4L27A 4JGSA 3IVAA 1BS1A 2IU0A 4O4LF 2HDWA 3HJFA 4J49A 2C2AA 3OQBA 1QB7A 1QHNA 3ETCA 4JLAA 4JR1A 3F5DA 4ZT7A 1ICEA 3FB1A 1FLDA 3GR6A 4WEQA 3NZEA 3RUHA 3H18A 5K0SA 4TQDA 1D2HA 1DQSA 3HVUA 2VDVE 1G1XB 3JYOA 4HGZA 5FPHA 3RVSA 3UFXB 5GJVC 3SEFA 3TE6A 2YWGA 1TLLA 2Y2UA 5GVRA 3B77A 2YIMA 3GLSA 4BCCA 1NJIW 4CKXA 1I4TD 1P0QA 5IDXA 1YL6A 2XZLA 3SI7A 3R5SA 4TV8B 5A2GA 1KFCB 3U3OA 3UMVA 3GJYA 3IAHA 4TTRA 4ZYVA 1I8TA 1F12A 3DE1X 2JEYA 3WGQA 1Z2OX 3DFMA 3GLHE 3OAAG 2FZKA 5A5DA 2C2WA 4DMRA 4YDQA 4JNCA 2RGDA 2Z8ZA 5JJKA 1TVCA 1YOVA 4ZA2A 1E58A 1I1HA 5CXSA 5ECWA 5ULLA 3NBUA 1W42A 4NQZA 3FD5A 1D0SA 1QFJA 1AU9A 2GPAA 3E5HA 3K1YA 4LDQA 1G5TA 4PCAA 2Y3IA 3ELUA 3MGBA 5GMOA 4DJJA 5B7PA 3DDWA 1T2AA 1W30A 3EPRA 3G82C 3TQOA 1I4LD 2VYCA 4KXMA 1FKAO 1NW4A 4RSMA 1BVUA 1QCEA 2GN1A 3JRNA 3ZBHA 4G5OA 1B1AA 4P82A 5EIAA 5IDYA 3KR1A 2F90A 3EXHA 4JT4A 1VYUA 4CQJA 3VHXA 3ZZ0A 3CCJV 1RKVA 3Q3IA 2CXSA 4LCKA 3ESBA 3I56V 2J41A 3MT8A 3HKEA 4WKNA 2W2VA 1DEHA 3U62A 3N87A 2DEUA 3HJUA 2F43G 3GIDA 5HF8A 1TC2A 1IMOA 3G8YA 2ZYGA 1ZCJA 3LC0A 4NZNA 2PYLA 3U0ZA 1JU9A 5KYXB 3WFZA 3I1FA 2X1MA 2ERXA 4S1WA 2CJWA 1RWKA 1SCKA 4OHOA 4YMVA 4RTPA 1WXIA 5BO5A 3VR4D 3QOWA 1Z6PA 2ZB7A 5LQNA 2QMZA 4QEDA 5FBHA 4HDKA 1UBOS 4PGHA 1W1UA 1E32A 1NXXA 1XZBA 1U1IA 3MTDA 3G71F 4RFLA 4E21A 2IU3A 1VIBA 3O7MA 3KTDA 5EKDA 4BX3A 3MCUA 3NAGA 2X3FA 5BQXA 2CDNA 1L7OA 4B76A 4Q3EA 4YJGA 1SWVA 1IJFA 4BE9A 4NE2A 5A03A 1Q2XA 1JIKA 1YRQA 1CQJB 1GYQA 1YJBA 1FSGA 3AOEC 4TLLB 3C4JA 4W7IA 4Y6QA 1U9JA 1Q11A 3S40A 4W5OA 3SPXA 4G0OA 4JB8A 3JQAB 4L51A 3RTCA 4E12A 4EJ6A 1O5TA 3T5CA 2QRZA 3WLTA 2GJAA 1DMSA 1K4CC 4ZDKA 2VZEA 4X66B 1KJWA 1ZVMA 2KMLA 2CCJA 2OBBA 1AS2A 3DC7A 4OGKA 4LE2A 4JJIA 2YJZA 3TXAA 3O4RA 2P6JA 4MQFB 4IXDA 3OCWA 4TS9A 3WWYA 4EUNA 1RFLA 3NBAA 2IVFA 5D87A 4KFTA 4MW1A 1IQRA 3TFOA 3R24A 4JXXA 2QV0A 2VJYA 4DM4A 2A88A 1J24A 4R40B 1W55A 2OGWA 4DW0A 3IHWA 5A4FS 3LUTB 3ZP7A 1NBMD 4ZHQF 2PMDA 4ACAA 2C9OA 4PSDA 4DNQA 1NPYA 3G6BA 2ZKOA 4I9WA 3M1XA 1GQQA 2XHZA 3H7AA 4NYMQ 3LLMA 4NBKA 1YVUA 4NAHA 4HB0A 5JPIA 4QLBA 2ZULA 2CHEA 3DCNA 1YGPA 1I80A 3C7CB 1AJQA 1K7XB 3WDMA 3S8EA 5EN4A 1EXVA 5T57A 1L7BA 4K6KA 2DQ3A 1K5PA 2A4KA 1Y1KE 4JLOA 5IARA 1EH5A 2JIOA 2CV2A 2NZYA 1D6MA 2MOKA 3A1FA 3D2BA 3QHAA 4QARA 4R16A 4MEJA 3K06A 5C1IA 1NJGA 2GRUA 3SOZA 2DN9A 4HR7A 1NGSA 1PJ4A 3E7FA 1O87A 2B9VA 4GLFA 4BNYA 3G9TA 1GITA 1BEEA 1VSUA 2P35A 2BEWB 4HQ6A 4MWGA 3Q0IA 5BT8A 2GCOB 5B3LA 1W5BA 2ZYUX 2QRVA 3THOA 1JJAA 3ST7A 1R74A 2GD1O 3DEZA 3VZPA 3ISTA 4NICA 1JU3A 1PFWA 3D3QA 2R47A 1F7YA 3HR7A 2NSDA 4I1PA 1OPXA 2JJ2D 3LY8A 2LZ0A 2H5LA 3LQ4A 4EGJA 1WZEA 2Q5ZA 4I5EA 2O2JA 2WIKA 3DEJA 1DJOA 5EZYA 1Z7YA 1XA4A 4L8FA 4Y2HA 3L43A 4KW7A 3O2JA 1ORTA 1C1DB 1QP0A 1DC6A 4QTXA 1KMMA 3EUEA 1T0BA 3FDIA 1ZD5A 3W7TA 4J80A 2M6LA 2R8PA 3OA0A 3IO5A 5JYEA 4BKUA 1JZTA 3TECE 3HO1A 3OHPA 3RLIA 1BSVA 1QH0A 2XR1A 3S8MA 1KRHA 2QYTA 1EX6A 3O65A 1W9MA 4HYOA 1T9HA 5KTMA 1JFVA 1I08A 2WPDD 2QMUA 4AJLA 4I4LA 1P60A 2QTGA 2AG8A 4XDHA 1DAKA 5K3AA 1N7GA 2J3JA 2BGNA 5E0OA 5TS3A 2QUBA 3CR7A 2IEDA 3IP1A 4MNTA 1ODEA 3DPIA 2NNUA 2EKZA 4BEVA 1GUZA 2XIJA 3BF8A 2P3OA 3BMNA 3BSYA 2YRWA 3KEGA 2DM6A 4HNHA 4WKGA 4B0OA 5IT9A 2ZLBA 1RKUA 1SQSA 5CLJA 3PSAA 3N86A 2EFJA 3QE3A 1PUJA 2GESA 2QK4A 4E2YA 1I4EB 1N0HA 1WNTA 3CN7A 5BYAA 4XGRA 2Q99A 2CVLA 1EX7A 4ZHWA 2AXEA 2RBEA 1W94A 4D3ZA 1TRHA 2BFWA 3IC7A 3BERA 2ZYHA 2JFQA 2DRIA 1B26A 2FPKA 2TS1A 4GM1A 2O52A 4U9IS 5AXBA 5AHKA 2XB4A 3T7TA 3GIWA 2ZWOA 3F5QA 2Y1LA 5ERYA 1GG2A 5BNZA 3FPGA 3SKYA 1POWA 1PP4A 2GBLC 4RKRA 1FJGB 4IZHA 2PBRA 1N9GB 2L0XA 1ORHA 4HZ3A 3HJWC 1YUNA 1CPYA 4WD3A 1A76A 4HAMA 1UDBA 5HZGA 4KK4A 3JPYA 4ZKIA 4I8IA 4ZO8A 2R6FA 3JWPA 3PDIB 3A1SA 4IINA 5K3DA 2JI9A 3OURA 2V7TA 4R4JA 1TTHA 1SUSA 2R6CA 4FM0A 1GSAA 1XTSA 4IHJF 1X70A 1F9EA 2IEYA 4OU4A 4LHYA 5EJAA 1Y1LA 2HRCA 3RC9A 3J80M 2HVKC 1RP3B 4WN9B 1ML4A 3ZCQA 2DR2A 3EPJA 1VGVA 2Q07A 2E49A 5E4TA 4QU8A 2QN1A 2PRIA 3DEIA 3MMPA