4X1IB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 151
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1iB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1iB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1iB01
2BTQA 3RYIB 1W581 4WBNB 5IJ0B 2GVIA 3JARB 1W5FA 4B46A 4O2BB 4O2AA 5J2TB 4I50B 3R4VA 5CA1B 3RYIA 3VO8A 4I55B 1JFFA 4TUYA 2BTQB 4M8IA 4O4IA 2RHLA 4O4LB 4YJ3A 1Z5WA 5CB4A 4KWEA 3ZBPA 4EI8A 3HKDB 5JH7A 4FFBB 4DXDA 5JVDB 4IIJB 3N2KB 5LXTB 4O4IB 4ZI7A 5M7EA 4I55A 5CA0B 4EB6A 4ZHQA 4X1YA 4O2BA 3JARA 5IJ9A 5GONB 3WGJA 5JVDA 3VO9A 5EYPB 4X20A 4FFBA 4F6RB 5IYZB 5LP6A 3RYFA 3RYCB 4O4LA 4HNAA 5CB4B 1SA0B 4ZOLA 4X1IB 3HKCB 3WGKA 4IHJB 1TUBA 3RYHB 4LNUB 4X20B 3VOBA 4EI7A 4I4TB 1RQ7A 2R751 4E6EA 2VAWA 4X1YB 4IHJA 3JALB 5MN4A 3HKBB 4B45A 4X1IA 5EIBC 5LYJB 5J2UA 1W5BA 3RYCA 3C8LA 3WGNA 5LOVB 1TVKB 4O4HB 3N2GB 5BMVA 1JFFB 4O4JA 4TUYB 3JALA 5FNVB 4EB6B 2RHOA 4I50A 3VOAA 1TVKA 1RQ2A 3V3TA 3JASA 5LYJA 3HKCA 5KMGB 1FSZA 1W5AA 3RB8A 4DRXA 5C8YB 2RHHA 3RYFB 5MN6A 2XKBA 5IYZA 5LP6B 5EYPA 4F6RA 3WGLA 1W5EA 4I4TA 3JATB 3E22B 4EI9A 3RYHA 4U3JA 5JCOC 5KX5A 4YJ2A 3HKEB 4TV9A 5LXTA 5MN5A 5ITZA 2VAMA 3JAWA 1Z5VA 2BTOA 5GONA 3ZBQA 5J2UB 5JCOA 5JQGB 4TV9B 3HKBA 3M89A 4YJ2B 5KX5B 4ZHQB 4TV8A 2RHJA 4U3JB 5FNVA 4ZI7B 3E22A 3WGMA 2Q1YA 3JATA 4IIJA 5LA6B 1OFUA 5LOVA 3JAWB 3ZIDA 5EZYB 5KMGA 1SA0A 4ZOLB 3M8KA 4HNAB 5CA1A 1RLUA 5EIBD 2XKAA 3CB2A 5LP6C 2VAPA 5LA6A 4LNUA 2VXYA 5C8YA 4DRXB 3UT5A 3VPAA 3N2KA 3JASB 5EZYA 4O4HA 1W59A 3HKDA 3JAKA 4X1KB 5JH7B 1FFXA 5ITZB 4U39A 5IJ9B 3HKEA 3UT5B 5CA0A 4TV8B 4O4JB 5BMVB 4O2AB 5J2TA 5JQGA 2Q1XA 4XCQA 3N2GA 4WBNA 5IJ0A 1FFXB 2R6R1 3JAKB 4X1KA 1TUBB 4YJ3B
chains in the Genus database with same CATH superfamily
5EHXA 1G5TA 1RWWA 3BZBA 3PJDA 1SOVA 2RKWA 1EINA 4Y6RA 4RF4A 4GKJO 4HNUA 3IGAC 1W4LA 1XP5A 2P2DA 4I55B 4OXNA 1OIXA 4YQFA 2R8ZA 1DEKA 1H2YA 3GNQA 3CC4F 4WY5A 4MWGA 3T7CA 4MCJA 3UY4A 4C03A 4ED9A 4P82A 4NE7A 3STZC 2NXCA 3L73H 3T1CA 2C94A 1U4SA 3OPQA 3BPZA 3L7BA 1WOMA 3H87A 1X14A 4C81A 3A2LA 1E62A 1SWVA 2P5UA 1NHGA 3NGXA 3PK0A 1W6UA 1Z36A 2G9QA 4LY9A 1XBLA 1KKUA 2FE4A 2C20A 2HU5A 4XSGA 5KVCA 3BA1A 4X88A 4GPTA 4KGDA 4JLDA 2G36A 4Q3NA 4WOKA 3SF0A 2GTPA 4V03A 1IN7A 1ESZA 4ZOLA 1L5ZA 3IUQA 3NNSA 3U0ZA 3LIIA 7YASA 2GEDA 3QBEA 3UJ8A 4CHGA 4LVNA 2JFPA 1W4AA 1MO5A 3IXQA 3RGBA 4PA7A 1U40A 2GH1A 3UMVA 4ZO8A 5B4TA 1UJWB 5HRCA 1E3SA 2OHIA 1EUYA 4MV0A 2LD4A 3D4BA 3JALB 2XAUA 5TNXA 3ILXA 1PWEA 2J5RA 1M75A 1PEDA 1H8EG 3OFJA 4X6LA 5FFFA 4JJAA 4DG9A 4HEJA 1NWHA 1TO2E 3Q3IA 4R4JA 4AC9A 3V48A 2COUA 1Q0PA 2D7DA 2WAAA 1KQPA 2JAHA 2OT3B 3LJKA 5EGSA 2RGXA 1TAEA 3R5HA 2NU9A 1X1QA 2OYSA 5J63A 3R75A 4BCBA 4TKUA 3GRFA 1TEVA 3DSQA 2I7XA 3BVOA 2G06A 2P90A 1FP7A 4XTCS 2Y77A 4GZMA 3DWGA 1N6PA 2GPBA 1PWZA 3I72A 3U10A 1YHYA 2QP9X 5KMGB 4XR9A 2ZRAA 1GTOA 2F6RA 2OV1A 1IBSA 1R37A 2JA1A 1SHJA 2ZWPA 1WSWA 2P6UA 4FYXA 1LWOA 3E3MA 2XNDD 4ILKA 4LF8B 4YDQA 1E2QA 3M4XA 3G71V 2CD7A 4RKQA 5IKPA 5JRZA 4BVSA 2IEZA 3SZRA 3STVA 2WBLC 2FPSA 2VDOB 3F0FA 3M4JA 4PYQA 2V65A 2Y4OA 4IUCS 1KI6B 4TTAA 1K97A 1RPAA 3NTUA 1OTXA 4GZ6A 5HDBB 4BVGA 1XZDA 4RQTA 4WI1A 2H59A 3GDGA 2CFRA 3MFQA 4C30A 4BB5A 4C6RA 4F3TA 3K5MA 1P29A 1VHAA 2JGEA 3ODPA 5AHXA 4LKRA 3SC3A 1S02A 5C1PA 2F9FA 1GXSA 2JAOA 2MHCA 1U3DA 1V1JA 4P4SB 2P6NA 2EBHX 3AEKA 5BVHB 2O14A 3GLRA 2QJOA 4F5YA 5AVXA 4YJHA 4Q4HA 4U3FH 2X8AA 4X7RA 4H13B 3KWFA 5FXMA 1MN6A 3W9BA 1QG6A 1M6NA 1AUVA 4JI8B 4HAIA 3VR6H 4R16A 5FWNA 4K05A 1RYFA 1Y5MA 1R1DA 2ATEA 3C48A 3GCDA 4MAFA 4RGVA 3V1NA 3W04A 2KSDA 4LDRA 1Q22A 1YH3A 3UJCA 4HDMA 4B75A 5E2IA 4GI5A 4W5QA 3C8HA 2PD6A 2A59A 1FU4A 3I12A 4AY2A 3P9IA 1T13A 3TSOA 4DCGA 3DKVA 5CXUA 2WFZA 4N5HX 3IEVA 2B98A 2H1LA 4AO6A 4J0EA 4DJDC 4PZLA 1BDMA 3IAS1 4K9KA 4OHFA 3VUEA 2ZIEA 4ZT2A 4BO4A 2JZNA 2F3PA 5BMVB 1XZMA 4BEVA 3BCSA 3VC3A 2AZDA 1U7OA 4UHEA 1U0EA 3O95A 3V4OA 1CDDA 5K51A 4DLNA 5LPNA 5FL3A 1J0DA 4N0MA 1VJTA 3A6ZA 2O5EA 3NH9A 3VOSA 3OJWA 1OXVA 3U3RA 2OD7A 1ZRMA 3KDAA 2X19A 1WABA 3QYJA 2Z1DA 5DHPA 3VYVA 1Y9EA 2VF7A 1YB7A 4WW0A 1I3CA 1VYTA 3OR6C 3KALA 3MBOA 4F4FA 3GFBA 1W0KA 2CMGA 2O2ZA 1VFNA 5IUKC 4B35A 2OZBA 3U4CA 3DEFA 3UEOA 4HQRA 5KU7A 3LVFO 3ZBPA 1Z5WA 1I3OA 3ZWKA 1GGHA 4FMCB 4TN1A 1T2UA 3IVMA 3OQIB 4UTOA 3FCOA 4RMGA 2X4LA 3WB1A 1NQWA 5HFLA 4ZT4A 1FS4A 4GT1A 1W9HA 1CB7A 2PVPA 3RSQA 1QHYA 4IAOA 1NW3A 5DX1A 1SWWA 3W8FA 1SZXA 4JCCA 2BR4A 3UQ8A 3COPA 1SXQA 1YIJF 1DFGA 2AV6A 4AKIA 4H0FA 2KB0A 5T3YA 4C4RA 1A4XA 1N7GA 5CLGA 1DO8A 1RZRA 1SB8A 3CH5A 5EINA 2OFFA 4FM0A 4KEAA 1JB1A 5HY0A 3HM2A 2VK1A 4NECA 1HZZA 2Z6UA 1IONA 3F6EX 3MQFA 4Y98A 1NVVQ 2AGVA 2ZYVX 3CY6A 3II6X 3R7WB 1QP0A 2IE0A 2WPDA 3FBGA 4ZK6A 2GLXA 2K87A 3BQNB 3HGMA 4P58A 3C1TA 4RIFA 2B4AA 4QSHA 3PX7A 2A9PA 4GF5A 3UFXA 4F4UA 1ZA1A 3MCQA 2WV9A 3IQEA 3CC8A 5EBMC 3ZYZA 5AO9A 3A11A 3P3PA 2AMLA 2VIIA 1XROA 2FMKA 3DEHA 1U1EA 3DZKA 3RJ9A 1F38A 3QFCA 3TQCA 2WE8A 1RM0A 1Q3KA 3DL2A 2JJ1G 4DM4A 1QAQA 3WZLA 3GEMA 2QF7A 5HHTA 4ZBMA 2C0QA 3OWHA 4G2KA 1AQYA 3W7AA 5EJ4A 1AS0A 3ISTA 4GMKA 3TS1A 2ZRCA 4Q34A 4NXMO 5SY6A 2K7FA 1JT9A 3OLYA 4PLTA 4C7MA 1M2VB 1L7NA 3FE2A 2ZBFA 4GZLA 3ZX6A 4IXTA 1H22A 4U1RA 1OZFA 4AUMA 2BTOA 3KTAB 4WSOA 2HJHA 5EUMA 3E6AA 4TM8A 1Q2XA 2ZIVB 1YJNF 3UAYA 2C9MA 3H83A 1MAAA 1O4VA 5AKHA 3P9XA 1A7UA 3R40A 4FSDA 1C4XA 2JAWA 2BHLA 4BMNA 5K8TA 4WJKB 1XZLA 5C81A 2QTHA 3LYAA 2FW6A 5IJWA 2BKVA 4TMZA 1C7RA 2HD4A 3KD3A 2H9IA 4MRMB 4KITB 1I7PA 4KP7A 3EXG2 1OI2A 3QNWA 4NYJR 4Y2GA 3IDSA 4TS1A 1MAUA 3ENVA 5ALTA 3WLPA 5KTRA 2AFRA 5LGUA 2FZCA 3U9LA 3QVWA 2ZE7A 4P84A 5DHUA 1RQLA 1TX4B 4KGZA 5FWXB 5K6AC 2TSYB 2UYCA 3GXBA 4GLJA 3N2KA 3CNNA 4BWYA 1PUXA 1Q7BA 2YS6A 3B4SA 2Q4DA 3LKZA 5IF3A 4RCZA 4G86A 1NUSA 1G17A 3CVJA 2FUG6 5C9ZA 2QMOA 3H2SA 1XDWA 4X44A 5C8ZA 3F96A 3O3OB 1I0LA 3LFUA 1XMQO 4X62O 2H7VA 1P4RA 2HHLA 4DIKA 3E8MA 4N01A 3SVZA 1GP2A 3D2AA 3FFQA 2HIAA 1RKXA 2VLIA 1TYDE 2ZBDA 1V6CA 2V7XA 5KNDA 3T7RA 4JHXA 1O8BA 3IPXA 2EATA 4BNUA 2VTDA 2FWPA 4BVRA 1ZX3A 3DOEA 3DZGA 5ALHA 3ZGYA 5GIOE 2ZJ5A 1GN3A 1L7EA 5B1SA 4EFMA 1I7LA 4D45A 5BSUA 3UMFA 2NUAB 2CJFA 2JLQA 2IF0A 4MI6A 3D7SA 1IU9A 1T1SA 1VXRA 1IB6A 4FFLA 2V45A 2Y48A 4JB2A 5T6MA 2AOUB 3NEYA 3QVTA 5CFPA 1TJPB 2AEMA 2NVBA 2OCIA 2V5VA 2VA9A 4EG5A 1IBKB 2F43A 1KVTA 1UZMA 4OHRA 4DR4B 3B6MA 4K88A 1TIKA 2AOXA 3L72H 5AHRA 2X58A 4L5YA 4HNTA 4MUYA 3QSYA 4P86A 2NSDA 5JVDA 3E7WA 4WFIA 3ZRWA 3I39X 4EELA 3AG4B 1QF9A 3JD3A 4OXYA 4RPJA 5HKBA 3LZCA 1LF5A 2I7VA 2A88A 5P8WA 1I2BA 3HU5A 2N42A 5FR1A 4F8YA 2Y1DA 2PUJA 2X7JA 5HKLA 1E6UA 2B1QA 2HZ7A 1GR0A 4C7UA 1I6WA 1S5HC 1NPYA 1VLQA 1U1IA 2BWJA 2LZ0A 3P0HA 4QUHA 4RFSA 2YY5A 3T6KA 4BO0A 4KQHA 4Y1RB 3C6ZA 2BGKA 1R4NA 2QOEA 1ENYA 3O4IA 2LRHA 4MLDA 1K4CC 4P0QB 1YVPA 1JHAA 3WYAA 4BAZA 3DGEA 3CX8A 1H5UA 3LCJA 2YXEA 1E1NA 1SVNA 2Z8YM 3COZA 3MERA 3Q1LA 5FPSA 4C7BA 2QA4V 1PXWA 4B2LA 4H0LB 1QB7A 1M2OB 2W0SA 3IT2A 4AJ9A 1LBIA 4NOMA 5CYFA 3JVEA 1P2BA 4U7JA 2GUZA 1X7ZB 3FAVA 3L93A 3QVJA 1TTHA 1Z82A 3LQ1A 3VU1A 1WBDA 3ZDRA 2MWMA 4BEWA 4CV1A 3QW2A 5DYTA 5G40A 3RLFA 3TZLA 2XUGA 3G8YA 1NXSA 4Q39A 5B66Z 5DTEA 3ZCXA 5DM4A 3Q4HA 2R6DA 4J90A 2IOYA 3AESA 3WFIA 2QJ1A 2QAGA 4YRMA 3K9SA 3DWEX 4AMVA 1Y3AA 3THXA 3MXTA 1XCLA 3DHYA 1ABEA 2JKYA 2JGRA 3G5AA 4X1OA 1K88A 2CF6A 1BSVA 3WWDA 2I55A 2FFAA 2DWCA 1AQ6A 4XGRA 1LD3A 1NL3A 1JFRA 2J3JA 3K8OE 5FWYA 4G28B 2AYZA 3UO8B 3V1KA 3GHYA 1N8RH 1E6EA 3F6BX 3WLKX 1H3NA 4Q47A 4MW4A 4MULA 1TZCA 2WICA 5E3JA 2X0NA 3WGMA 2JIPA 5EAIA 1XLUA 1M56B 3GLQA 3BYZA 1WXEA 3GZJA 4IWNA 2QT1A 3RFXA 3ZIDA 1TGYA 3M7IA 4TMYA 1R6BX 2JLBA 2IRWA 3S44A 2B1GA 1MPTA 1XCPA 1IQUA 1XDGA 2QL5A 4QOJA 2JLUA 5LP6C 1VPVA 1MB3A 3PFNA 1WOYA 3OD1A 1U98A 1Z5NA 2RCVA 4TL7A 5FRDA 5KKAA 2NU6A 3H17A 2CW4A 2DZDA 3NK7A 2IHNA 3VSCA 4CQMA 3H1JH 3IP8A 3MWEB 1PT7A 3K92A 4QQRA 5CEJA 5KB3A 1LTKA 2YV1A 4O4HA 2FFJA 2KM1A 3AXSA 4G09A 3T15A 4ZK2A 3LGSA 3CXCF 4B3SB 4FB4A 4OY3A 2JEUA 3IEXA 2RB5A 4PBSA 4QGFA 1MMFB 5CFMA 3GYGA 1US8B 2C88A 3EFOA 5HMMA 5TPWA 3T52A 2YIJA 1WZUA 4Q4AA 1CUJA 3KEQA 1Q57A 4RQBA 2GV9A 5FD8A 3DMHA 1FFXB 2V1UA 2I3GA 2JATA 2YV5A 3NHLA 3VU9A 2IE8A 4HEQA 3ZU6A 1IPAA 4ER3A 1QGYA 2IYWA 3LYHA 2LP7A 1YE8A 2VPTA 3DZCA 3E9NA 2PZBA 3VKUA 2NZVG 2O8BB 2V6JA 4Z3KA 4MAMA 1SVUA 1QGZA 1ZH0A 1Z34A 2DECA 2JCVA 2JIZG 1JSRA 4J7JA 1QGUB 1BQZA 2B61A 2NNUA 3H9EO 4OJYA 3ZW8A 4B81A 5LB4A 1TADA 1QNLA 2JCXA 2YWDA 3N0WA 2O7SA 4QIHA 3TNJA 3GDWA 1X7XB 3THYB 4TKZA 5H4HA 1RWNA 2AOWA 1GD1O 1M8JA 1ZINA 3LLVA 3ABIA 4LTNA 3RBAA 1JHVA 2CFCA 4XM0A 3VTAA 4M1ZA 2ZF8A 3D9QX 1TYCA 4B6SA 4WQMA 4DIFA 1GWNA 3ZGXA 4PV1B 4U7WA 2KX7A 3MQ4A 2HQBA 3CA8A 3LMKA 3CW8X 4JVMA 4MQEB 3CCVV 4FMTA 1HFWA 3IOEA 3CCBA 4N5NA 1ZJ5A 5I7WA 4UAGA 2YCLA 5FBZA 3BK1A 3HKCB 5AI6A 2BLNA 1QH8A 1QDEA 1YBAA 4JLAA 4Z9FA 1BEZA 3MJ4A 2IVZA 1LBEA 1U3UA 5AJYA 4TQAA 2CMFA 3QUWA 4AXXA 2VXOA 5A3VA 5CBPA 1QYWA 3W7VA 5GPBA 5TV2A 4NCBA 2O7VA 3EUAA 1QIKA 3MMNA 4LBEC 2B21A 3KE8A 4IIGA 3ZXSA 1J2RA 2ZR0A 1N33O 1XU4A 5B58T 2HPHA 4B79A 3GXOA 3CSXA 2J33A 3ZHUA 3PSAA 2RHCA 2MT9A 2V98A 1MB4A 1NDQA 1RXUA 2I62A 1OASA 4FDVA 4NZZA 3VPDA 1HTWA 3I7TA 4J0CA 4YEDA 2VRZA 3PVZA 1HNZO 3FYHA 2Q1SA 3VJKA 3FTPA 2P69A 1I4WA 4L4YA 3U6BA 1JI3A 4B3GA 1YR8A 2Z1FA 3C43A 5B5EZ 1WQ1R 1BWRA 2KQUA 5I9BA 3FNEA 1VQLV 5IN4A 4LE0A 2VRNA 4P98A 4U6NA 1RQGA 3FTNA 3HKCA 1JWBB 4JY7A 5FF9A 1XDUA 3CNBA 5LWQA 4G4IA 4Z4EA 1JJ7A 3H01A 3NBYC 1VE3A 2DOSA 3FTEA 2ID8A 2BBTA 2JFOA 3DM5A 2GMWA 5C0OE 3M83A 5H3CA 3M6LA 2YUIA 5G0WA 3SYLA 5KYWB 5LMCA 4PAOA 1XWFA 3K4HA 1SMKA 4QPCA 3KCQA 5AI0A 1KDZA 1XL1A 1X94A 1XIVA 1CY1A 3HCFA 4QO7A 4DFDA 3PR3A 1H2BA 4Y0NA 3VVLA 3H9GA 3SS8A 4GG1A 4HJRA 4B6PA 1VRCA 2X0JA 2UV8A 4Q3DA 4RDXA 4B6FA 1FDUA 1R4AA 3ZD8A 3NDJA 3TK1A 1EBFA 4PYMA 3ANTA 3HP1A 2MCFA 3K0BA 3I6QA 2CCKA 4EPTA 3CBQA 5K2OA 1OH8A 2Z4SA 1OJHA 2AFIB 1SVKA 4L73A 2I33A 3G5LA 3SKXA 4M83A 3DDZX 4XB6B 3BYQA 4EKGA 4W7SA 4AKGA 2X13A 3B7WA 2RDMA 1Q8IA 1CQIB 4OXXA 4QXOA 5A0FA 2E9SA 1PFYA 5AW5A 4DA9A 4KQ1A 1F6BA 4X6YA 3RVOA 3E1GA 2HX0A 3E9EA 1CF4A 3PI6A 3C0KA 2NOAA 1QIMA 2YJNA 3E05A 3GJXC 3L4EA 3L8ZA 3QU9A 4U6QA 3PC4A 1NN3A 2GCNA 5K3FB 5K8JB 1AIPA 3PZRA 4H6VA 1DBFA 3CZPA 4B87A 5MGNA 4P6VF 4DJFC 2ZRDA 4CQMB 3UUGA 3NASA 4F2DA 1F8XA 1O6FA 1QCYA 4DV0B 4RDCA 1MFPA 1D4AA 3OEYA 2FX3A 3MUOA 4KV9A 3DLHA 1T0IA 4CEIB 2X40A 4JI7O 4Q7JB 3RVZA 3ROXA 5JCJD 1IY9A 3P0IA 5EA2A 1GSOA 4ZD6A 1VHJA 1U5BB 2ZFUA 5AESA 2FVXA 1KFCB 3GAFA 2VHWA 2VWHA 3SHTA 3IMFA 4ZICA 1P1KA 3T1HB 5KJFA 1Q77A 4G4GA 2POQX 3QNUA 4CNBA 1U81A 1N2OA 2A4MA 4H18A 2VZLA 3CV3A 3L1JA 3V8PA 1Y8RA 1XZQA 4XPIB 4CMBA 1O4WA 2NT3A 2V9CA 2XGGA 1G8SA 4IZHA 4UU7A 4W4LA 5DSXA 4PG5A 2RHDA 1SKUA 2R8PA 4P32A 5G0UA 5TF4A 1S6YA 3K06A 1E7SA 1FYWA 3A1NA 3K1AA 1T9AA 1YJBA 1P18A 2QAGC 3GJ8A 4TT3G 1Z0SA 3NC1C 4MVJH 1K7FB 3KR2A 3TL3A 4F2WA 4PN7A 4WWHA 5HJEA 4IHJF 3UXMA 4YWJA 2OXEA 4FYPA 1E2HA 1RLOA 2BSAA 1E79G 3WGKA 3CFYA 1X7WB 3R7SA 5CD9A 5GVSA 3NDBB 1J24A 3DEZA 4AQDA 3GI1A 3WDMA 3E86A 2YHUA 1OB5A 2O7NA 1R5JA 1CZUA 1G18A 2LNDA 4ICIA 3LDUA 1H2HA 2MR6A 4P7KA 4V0ME 2HLDA 4Z9AA 1NTRA 3X1XA 2V3WA 5KHAA 4QUGA 3C3PA 4EI2A 4HN2A 3O8CA 3MW8A 3R9WA 2P9GA 1S8NA 2XBLA 2YZMA 4OVKA 4DMGA 1WW2A 4BWVA 4HBGA 2BI7A 2L19A 3JVDA 4BMVA 3BAFA 1IULA 2F3QA 5BVGA 3MLEA 3N7TA 5BSGA 4LOHA 5F12A 1WA5A 1XILA 2AOVA 1AF4A 4K6OA 4LNHA 3M34A 4RMIA 2QV7A 1TC2A 2XYRA 4BRZA 2C2MA 1OW3B 4DE5A 4MPDA 2GN6A 5JJNB 3MTAA 1EVJA 3MTEA 3GC6A 2JFGA 1G63A 3F1LA 1QMGA 1JOYA 2J6BA 4QXQA 2HB6A 3MWEA 2HP3A 3QTCA 3L5KA 5MN6A 5ALFA 2NU6B 2DTXA 4BJHB 1URFA 2KTVA 1W88A 3FVTA 1DKRA 3OFKA 4FWTA 3RHZA 2HNAA 4Z4HA 4BPBA 4FJ1A 4BIOA 1WKCA 4G6ZA 4HI0E 2EC5A 1Z56C 4MW7A 3AG1B 1I94O 1P9NA 2O0MA 2O20A 2XYGA 3L46A 5J2UF 3IXLA 4UXJA 4KDCA 4LRTB 3BMNA 4QGAA 3NOVA 2ZCJA 1OGYA 2Q67A 3WZ2A 4OFZA 2PV0A 3PUWA 3ZGOA 3M89A 1ZVMA 3CF6R 5EE5B 3WK4A 1G8KA 1P4AA 5K1XA 2V1XA 1ETUA 1W2WB 3BL8A 4KAAA 1MJFA 2JDID 2JA2A 1QK3A 3AG3B 3AB7A 3IESA 4MGIR 5EC8A 3FB4A 3I92A 3IOCA 2OXIA 3R09A 1QRRA 3WKCA 3IEMA 1UEIA 1JECA 2HLNA 2LIPA 3GY0A 4XIYA 5FO0A 4AG6A 1GQQA 1W94A 3Q87B 4Z3DA 1XQ8A 3O2JA 4IOKA 2H08A 1US6A 4OHCA 1A27A 1T4DA 3H7IA 4GU5A 3TD2A 4EQZA 1M90W 1NM5A 4QBHA 3CLRD 1Q2UA 4Y6PA 3WGTA 3WLSA 4EO7A 3BTSA 3SHFA 3GRKA 2FU5C 1OCZC 1DXQA 3UM7A 1I0HA 1PUIA 1P62B 1XJCA 1Z8HA 4HGPA 1FVFA 1YU9A 1P39A 4EHFA 3D3QA 1T5OA 5C18A 3DDWA 1RLGA 3SYOA 1V37A 1WCIA 2PQ0A 4FIZA 5EMJA 4TTRA 4KR2A 3VYUB 1UOQA 4L3VA 4YA6A 1ZW1A 3ZCQA 3ESRA 3MS4A 5CH3A 1Z75A 1I2CA 2B36A 5U4QA 3N6VA 5ICCA 3W6OA 3PL1A 3CZRA 4KIUA 1YQXA 4LWOA 1NXQA 4D6YA 4QODA 2J45A 2QGFA 4NP6A 2AKAB 3RUHA 3TYXA 4FINA 4MUNA 2JJ1D 1DOAA 5B12A 2JJ2A 2WQ6A 2Q3MA 1DX4A 1JQLB 1LSOA 2JEOA 3K30A 4RFSB 4NY1A 3MD9A 2Q29A 4OKNA 1ZWLA 2NWQA 1DLBA 4KQ2A 2CXUA 1W0KG 2WAMA 2PV7A 1V26A 3QA9A 2PFGA 2X8JA 2DFPA 2GAIA 1QIDA 2XOKD 5BSTA 5HYVA 2HL6A 1UPBA 5JVDB 1GQRA 1AGXA 1DL5A 1O87A 1TF7A 1ZAKA 2XE7A 4PDLA 2CHUA 1IOVA 2QSUA 3L0CA 3OQMA 2QVYX 1TC1A 2AYYA 1RIFA 3SG0A 1OBFO 1X3SA 2E2WA 4KUEA 2WJPA 3HXLA 4MI3A 2CKMA 5JYBA 1E8MA 2PUTA 2ZEJA 3QEAZ 2JHAA 3L9WA 5CW1A 1L5HA 1HT1E 3SAJA 2H17A 4R1NA 2UZIR 4JZGA 1KBHA 3JQRA 4LDPA 2X2OA 4GKVA 3TRIA 3PIDA 1DKMA 1W44A 2ZDHA 3UANA 5BPFA 2LGWA 3G7NA 2R751 2AQKA 3OEEG 1U7ZA 1N77A 1EVKA 2IZ5A 1TLFA 3CF4G 4F4CA 3CT4A 2JRCA 2O1XA 3LHSA 3S70A 4YV2A 2PLNA 1X38A 4NONA 1HNXB 3GJ3A 5LP6F 3AH8A 5HTKA 3UCEA 2LQTA 4DR1B 1E4EB 3P9RA 4W6QA 521PA 3E27A 1QVGF 4ZWNA 5CBGA 4OQNA 1MZVA 2VPZA 4EB6B 5LQSA 2R84A 2IUTA 2QSYA 5T5QA 3AM1A 3THOA 1OI4A 1TZJA 4PF1A 3WG9A 1K4MA 3G2IA 2J3DA 4RA9A 5DHSA 2MINA 3W5HA 4BJ1A 2CXQA 3F1KA 5FUYA 3U7JA 4MEAA 2I4LA 3I1FA 4K1XA 4FYIA 2ZIGA 1C8KA 1FFTB 3SJQC 1Z0JA 3EIHA 4CKBB 3OLCX 3VR4H 5HQ3A 5J1SB 3WWYA 4B40A 3IKTA 5TSDA 1X80A 1KBQA 1O5IA 2CL0X 2W48A 1RP7A 3HU2A 3NHZA 4BNDA 4D9JA 4WESA 2NACA 4EVRA 2VUHB 1QE0A 2NV6A 3FSEA 5ALRA 2IYEA 1J21A 3DT6A 3MBIA 3OQIA 2NLJC 4KQXA 3AMVA 4P4LA 2KHZA 3QPCA 3W3ZB 1MTZA 4N9QA 3K09C 4B3HA 2Z2XA 4TV9B 2B5VA 2YVAA 3O4RA 2FWBA 3PT9A 1XKXA 3A3OA 3QTTA 3P45A 5HY1A 2F17A 3ND6A 6ADHA 5CG2A 1Z88A 4FR0A 4J07A 2UZ4A 4NH4A 1Y6XA 5F2KA 2HHHO 4TQ9A 3S5JA 3CR3C 4UBNA 4R1OA 2EZOA 1VE6A 2IPOA 5IULC 4EB3A 1U1GA 3AG6A 4P7FA 4IIBA 2X86A 3ZTYA 4INJA 4DIMA 1Q7YW 3UB3A 4RM2A 3NOQA 1A9TA 2QV0A 3RFRA 2A3NA 4NAVA 1TKRA 3G0OA 4TXHA 2WA3A 1JKJB 3P27A 2WUVA 3LY8A 4MQEA 4PSAA 4B09A 5HRAA 2ZITA 2CL5A 2P75A 2RCNA 3FDIA 3OM0A 4ZOCA 1SCDA 1E2GA 5TB5A 5TT1A 4BNDB 3PRJA 2CWDA 4Y8VA 3CCEF 3O3MB 2JLZA 5DNYB 1IG0A 4I8IA 4HPXB 2RHWA 4AZVA 4LWZA 4DWJA 1N5IA 4ZEOA 4D0SA 1YL6A 3QYFA 3TIXB 2C2BA 2FZWA 3EUFA 3DZDA 4Q4HB 5LQDA 2PZLA 1RWMA 5EIXA 2AZ2A 1F0PA 1PJLA 1YZYA 1ZMXA 2FK7A 1EH5A 1XVUA 3V7UA 4DN6A 4BO7A 4F3YA 5IT5A 1EESA 1OJLA 5REQB 2GVIA 5CJ2A 5CB4F 2VP3A 1PWXA 4PQGA 1QNFA 2E7ZA 5DU2A 5KYWA 1ICEA 5FDFA 1O2DA 1UC4B 1JLSA 3LFOA 1HE1C 2QY9A 1XZCA 5C93A 3V7WA 4ZV9A 3D2BA 4DIUA 3TETA 3H5IA 4X5OA 1KI6A 3LV8A 5KDDA 1U80A 4WKPA 3NLLA 3ESZA 3P9YA 2WQ7A 1S96A 4FUTA 3T3OA 4DR7B 5EI5A 4DR4O 2BI4A 2V7QA 1YVEI 5KDOA 2GZSA 1KC3A 3KTOA 4Q9JA 3W3AD 4NJOA 3S81A 3CEJA 1RYNA 1WKBA 1VB3A 1GZ7A 1AZSC 2WA2A 4OGGA 2OGUA 4IBOA 4L8LA 4QJBA 2Z6AA 3VMFA 3STTA 4EA8A 1XL0A 1OLSA 4GLFA 1CD5A 4IF4A 1IJFA 1JYFA 1JJAA 2AUMA 4KUHA 5DULA 3RUAA 2VEOA 2XAAA 3BK2A 4B2PA 1NQTA 1UBUS 1UBLS 1WLEA 1U6JA 2HRBA 4CDRA 2V6BA 3EEYA 4XVHA 4E88A 4NE9A 1ISHA 2C1XA 1DWQA 2ZRBA 2OD2A 3P7MA 2JIOA 3LO5A 1RZVA 3U7EB 2FSHA 2I76A 4RK1A 4YAOA 4ZU3A 1Q7RA 4WL0A 3T7TA 1ZLZA 4XJXA 4P9NA 3NBMA 5AG2A 1DCTA 1AURA 1EXDA 3O1HB 2FEOA 3KV3O 1EFUA 3GVCA 1DAMA 1DTWA 3D8UA 4KHPB 5DX0A 2GAAA 1QS0B 1SUBA 4MPTA 4UUAA 4O1MA 1PDOA 5DFAA 3TLYA 3JALA 2X3UA 2YV2A 1ECPA 3A05A 3RS4A 4EF6A 1E64A 1EK5A 4EW6A 2IAFA 4Z0NA 5AIBA 4WCFC 1MB0A 3IJPA 3V4RA 1JF8A 2DYSB 1GYRA 1CE8B 5FBLB 3TR5A 3IE0A 3UJBA 1PAUA 1R4MB 3VTZA 1BDHA 1DJPA 2QT9A 4JGSA 4YONB 5IJAA 1FYDA 3AKCA 5ALQA 3ULKA 3CCRV 1C9JA 4ARZB 5K3EA 3TE7A 1VQ6V 3ND9A 3A1UA 3DQPA 4OHVA 1ZYUA 3L8HA 1ZL8A 1P0CA 1S72V 1TECE 3LHFA 5E4FA 4QM7A 1UJ5A 1Z62A 3WY9A 4JQCA 4QGHA 1MJ5A 1EEXB 4IGFA 3L6DA 2X7HA 2WIDA 2B5WA 2AEFA 3ZP7A 3VO1A 2GTHA 4IPTA 1PK9A 3CRAA 3FKSG 1QIFA 2RMKB 3ICXA 1UOPA 2QUIA 2C42A 1K73W 4LF9O 2QW0X 4YCDA 2CTWA 2IHBA 3O3CA 4JLSA 2BL4A 1Q90D 1KNQA 3JQEA 4ZDJA 2W8BC 1PLJA 1YZTA 2WWWA 2VZEA 3MMSA 3ANMA 2ZUUA 3N2EA 2A0YA 3B89A 4KRXA 2PS0A 4UVIA 4OLAA 4QE7A 1XKTA 1GPKA 2PBZA 5JADA 3TECE 4PZAA 1GQFA 1YHNA 2HRQA 1TXGA 2WD7A 4Q1DA 2Y1FA 3D3WA 4U0KA 2B30A 4Y0AA 1I3NA 4BV9A 4E5SA 5F2VO 1UT6A 5AJUA 4O3FA 1IIBA 2G83A 2XYHA 4M8KA 5DBHX 3RRYA 2Q3FA 3WL5A 1W59A 3B3FA 5FPQA 3SP1A 1EQUA 2ZIXA 3VJLA 1V8DA 2IUYA 2ENUA 3HKEA 2IX9A 4D9CA 1H2XA 1HDGO 1YDXA 1YKFA 1FXVA 1GADO 3B6ZA 1MZEA 1GY8A 2PEZA 2PKCA 4PYKA 4LFAO 2P9EA 1KXJA 1T4MA 2WF6A 3SF8B 3I8SA 4DJ5X 1L3CA 2ZT7A 2ZUCA 3TCNA 3WNDA 3HB9A 3D3KA 2YEVA 3VZCA 1YOVA 1F2DA 1Q1QA 2I6SA 3KJHA 4MVJA 4UDXX 3W4KA 5A4IS 2DETA 3LDDA 3IPYA 4TRJA 1QYCA 1EMDA 1CZHA 3HB4X 3T1VA 1WTAA 1R0WA 1C4KA 3FFTA 3NHYA 2P5TB 1F7UA 2ZULA 2OC4A 4JI7B 2HO4A 1K98A 2PGLA 1JT2A 2INGX 5E0KB 3HR7A 4Q6GA 3OZRA 3ZHZA 1QIGA 4D8TA 4FONA 5L4LA 3KR9A 4M6WA 4UNRA 2FW9A 4ND3A 2FDCA 1YS6A 2ZDGA 1YJQA 1RJEA 3PDIB 4CFZA 5DO9A 1Y8ZA 3ERNA 3ITDA 3K5IA 4D5GA 2I2XB 5BWCA 4G8JA 1X1AA 4PZZA 2XB2A 1ZI6A 2AGAA 4NYIQ 2ZDIC 3MTIA 4W7HA 4UE3S 3H8JA 3QE4A 3RTGA 5DT9A 3ZDAA 4A8TA 4JPRA 1UKZA 3A04A 1Q92A 2MIIA 5CCBA 1R3KC 2PMDA 3IV9A 3HVUA 4I1UA 5EOVA 2PAFA 5JI3E 1TU0A 2ZAMA 1PO7A 1I4OA 4QHSA 1FX0A 2XDWA 3F2VA 3GGJA 2PQMA 2PZSA 3V8MA 3RF6A 1H0SA 5E79Z 1U63A 5B36A 1FUYB 1PWYE 2BLLA 2W2LD 1Z2GA 1XQXA 2QSAA 4DV5O 2IUSA 3BWMA 3MEQA 1B6RA 2XZPA 3PGLA 3PQFA 4C07A 1QLEC 2G9UA 1G98A 3FF4A 3HJBA 3ELWA 3EX7C 4Y6LA 2C2YA 3AHJA 1F8UA 5K0JA 3GN2A 2OPHA 1EGQA 2J5QA 4LWPA 2O3QA 3QMVA 4RSRA 4KVGA 2CEKA 3S0JA 5BY2A 3CE2A 1YT5A 2VTVA 2GVNA 2YQZA 3RRBA 1I2DA 1DUVG 1CT9A 3LDGA 3EEQA 4P5EA 5K4HA 1GN4A 4CE6A 1Z5PA 3WG7C 1L1QA 3MTGA 1BXGA 1NRJB 4ETWA 2E0IA 4PSCA 2V3CC 5CDUA 4BMCA 3WL8A 3GJ0A 4KR7A 5JYEA 4XYLA 2I66A 1HGXA 3UAZA 3DXYA 2I0FA 2W6NA 3F78A 4RTNA 4AKHA 2DFDA 3KEGA 1JL3A 1B1CA 5LUBA 2CVQA 1R3LC 2J30A 3EZFA 1X8LA 1J00A 5DM2A 3BABA 2GF9A 4FDAA 4QFMA 3R7NA 4C0XA 4C4WC 1DJOA 1FTWA 5K0TA 2IH3C 4PX9A 2PRZA 5JVDF 4YQEA 1DHTA 2H2GA 3BDAA 2WTBA 3OQJA 1JPJA 1NX6A 2FEPA 4GSKA 4OOEA 4MCAA 1V8OA 3D4PA 1HH4A 5AM5A 4ZGBA 3C9TA 4X93A 4BLSA 2WMYA 2GBLA 2OMEA 2X0FA 3TZBA 1PR5A 5IHPA 4HGYA 1YF3A 1ZIOA 4Q3LA 1SA0A 3EDMA 4DMRA 3G0IA 1MIHA 2I6DA 3WB2A 3DZJA 3R7WA 4EG1A 3DBOB 1LX7A 2C2AA 4C8IA 2Z1EA 3H16A 2Z1NA 4Q1VA 3ONFA 4YRQA 1KRHA 1Z0KA 4NJEA 4E5PA 3BPSA 3DZ8A 1GPDG 5IBRA 3CW2A 1R0LA 5IDQA 4HF7A 1IPFA 3RRXA 2RJ3A 3R9XA 1R0RE 1O54A 2JHGA 2QMHA 3W2FA 1LPOA 4CF5A 3DH0A 4Q9LA 4I7ZB 1KO7A 2GX6A 3GLFE 1E3WA 3M6VA 4S1VA 4MW3A 2Y3IA 4MRNA 3VX3A 1X59A 3DE3X 4HYOA 3QEJA 3HBFA 2XF2A 3JQFC 2ZJ4A 4DLLA 2D2FA 3UO2A 4YWHA 5TX7A 2NXEA 4NCAA 3ZDDA 3HDGA 3M2TA 3CUUA 4B3FX 2YYYA 1VBNA 3RVDA 1O3YA 5DMHA 4Z4QA 1HMYA 2R00C 3ZI7A 1CULC 3KSAC 2JIBA 3GQBA 4O3MA 2XXJA 3U0VA 2YC0A 3JAMN 1W581 2ABWA 4KTVE 1NBAA 3OQPA 1KE1A 2E5LO 3IIKA 4JF3A 1N32O 1NVTA 4ZJZA 2ADPA 5F98A 2GF0A 4HDKA 4P31A 5C5EA 1QYXA 1RADA 4NYMQ 4BLOA 3ZQ4A 5BXQC 2EHJA 4ABYA 1WS6A 2FPIA 2I2CA 2PG3A 4FOSA 4G4JA 4OHXA 4FHFA 4Z5XA 3EQ9A 4XGQA 1YONA 3SYCA 3FCUB 3N27A 1T1JA 1IUPA 1VKRA 1WCWA 2W6QA 3EXIA 3Q15C 4FQ5A 4GDFA 4F6RB 1OE0A 5BSKA 5PGMA 3DE2X 5AR1A 4PO1A 3ZWXA 4UM7A 4JEIA 4DSOA 4IJQA 3GMSA 3UOWA 3VBBA 3H1KH 4B7EA 4ENWA 1PJZA 3RGGA 1PWHA 2ZPAA 1V43A 1XPJA 1T1EA 4WE3A 3U7IA 3VNRA 4BUJA 5A4JA 3L4KA 1Q3TA 2HHAA 3BVPA 4HRVA 2IDKA 3UB2A 5DNDA 1D3AA 3KZ1E 4QL3A 1HBJA 3T1YO 5LMNB 3C41J 4KO4S 3TI7A 2JAUA 2O9JA 5CFOA 2P6PA 1R9MA 2WLHA 3EC7A 3GVHA 5K3AA 5LC1A 2G1PA 4C0QC 2X1HA 3DD5A 4KQCA 3H1BA 1MABB 3EY9A 4CM5A 3WA6A 2NPFA 3FTFA 3E84A 3PA6A 1TDJA 3IQHX 2ZAGA 4BE7B 4EIWA 1ZRHA 2H4HA 1HC7A 3KYJB 1YFJA 2QVXX 2DLCX 2I2WA 4GUAA 4AILC 4FLEA 5TQ0A 3V8RA 4NQ3A 2GDJA 4LZLA 3TRDA 4PHHA 3EGVA 1P3DA 2C29D 4AIRA 3J81k 3I62A 2E75B 3P30A 2WWIA 2CGOA 1DLIA 1QIJA 3H65A 4MIKA 1XMQB 5SYMA 4NEHB 4MT8A 1Y6JA 2GPSA 2FK8A 5A7HA 3OE7A 5IXJA 5JCOC 2EQBA 3A9RA 4NJMB 3L3BA 2UYHA 3WISA 4OQYA 1E6KA 4PS1A 4MVMA 2JFXA 4MMZB 3O90A 1AJNA 2BFBB 5IBPA 2I3ZA 1L7DA 3I2FA 3KKLA 3VCZA 3LQKA 4WPGA 1UKBA 1K8RA 1SEVA 5DOVA 3UOAB 2Q8NA 2XJ9A 3P2IA 2IWHA 1KYTA 4CI9A 2FPRA 3CTPA 4OMFG 3KOZA 4HG2A 1BW9B 2AN3A 5JSQA 3VKWA 1F14A 5BWLA 1GITA 2YFYA 5AJZA 4A6EA 5KQMA 2IXTA 3SFVA 1HDEA 3UB4A 3E82A 5HIAA 1W55A 3HBMA 3QKSB 4KX5A 1TJ3A 4BEBA 3K08A 1YJ9F 1SCBA 4WUTA 3TW8B 1NPDA 1OFGA 2PX4A 4RK6A 4CW7A 2IPNA 2QRQA 3IJRA 3OCVA 4IO1A 4LGMA 4AJIA 4B7CA 3IQZA 1Z37A 4II7A 4LKOA 4B6GA 1VQPV 2FAXA 5LFAA 5TIIA 1VHQA 4MVJF 4OLHA 3R23A 1EVEA 4QTXA 3CCMV 4NATA 2J5XA 5JNSA 2VA8A 1DI0A 1L9KA 3ZCVA 5DLQC 1GU0A 3KYCB 5EPEA 1DBSA 4GOMD 4H1WA 3ZNPA 2XZOA 1NW7A 4MYUA 2BJWA 5AVVA 1DIAA 2WTUA 3KXIA 2PWBA 1GZDA 2FF5A 4JV5B 1AKTA 1K8XB 3M2PA 1ZU4A 1EG2A 1LPAB 1QJ4A 3URMA 4BVAA 1H93A 1LPNA 2H07A 1P81A 2QTLA 3GH3A 2WUGA 3S7TA 3ZJUA 1BXKA 2YL2A 1WZCA 3EIUA 1OYYA 1C8VB 1Y37A 1RM4A 3DYIA 4LRYA 3FCSB 4NTYA 1RAEA 1KMQA 4HAXA 4NOKA 1XCMA 4Y1GA 1KMCA 3H13A 3WKBA 2E87A 3ZU4A 1V5EA 2A5DA 4OJQA 5FV7A 3NS7A 3MCZA 4F7DA 1BCRA 2NUTA 4YRAA 5AVZA 2QS9A 3KQVA 1Z2CA 4Q7EA 2H1HA 3BGOS 1NE2A 4CCYA 3BTOA 3SOZA 1OKKD 4D7TA 2O05A 3TWOA 3MTJA 4RK0A 5CJJA 4ESEA 3BZUA 5H6QA 4FCCA 1UKAA 3PNSA 3GW8A 3LPLA 1NAIA 4B4WA 4HNSA 4ZGGA 4CLEA 3W05A 5ULLA 4EFEA 2HUNA 4DIDA 2QR3A 4FNMA 1A96A 5LL6P 1V3VA 2JC3A 3FBWA 4I1SA 1SQ6A 1ZI8A 5F5NA 5THQA 1LNSA 1NSTA 3FMIA 4O33A 3S29A 4QECA 5I51A 5INTA 2Q4EA 1CN7A 5KVVA 2OPBA 2G82A 1KEPA 3ETDA 4FXPA 5CN0A 4LJAA 1E59A 1CUIA 4PS0A 5LZ2A 3KOUA 2PYLA 2CB9A 4PFKA 4FFPA 1DO2A 4CETA 4NTWA 5EIBC 1TMOA 4MZDA 2A94A 3BMOA 3KZKA 1WD5A 3VHQA 1OLOA 1SKYE 3U2QA 3QUQA 3T0GA 4N39A 1NATA 3QPVA 3MLBA 5EXPA 4JCOA 4NS1A 3R66A 2FZGA 2ZRIA 4FTWA 3SQDA 2CHVA 2HAEA 3DE6X 2SKDA 4GICA 3WYGA 5FPTA 4ACAA 4HLUA 2VF4X 3OTOO 1JVNA 4J0HA 3T7EA 4R50A 1SU4A 4Q20A 2J3MA 3B1KA 3N39C 3NC4A 3WX0A 1REQB 4EVSA 5ES4B 3KJZA 4QPJA 2FUCA 2DFNA 5KYYA 1GSAA 2E3CA 2VDWA 3HYCA 4EUFA 2H8EA 2VP4A 1FMCA 4P7JA 4B0PA 4W9MC 4P4TA 1COWA 1C3OA 1UK6A 3ZUGA 3OMWA 2VWQA 3BIOA 2WZQA 1JV2B 2XMPA 3OFNG 2FHSA 3A58B 2CBZA 5EMMA 4JI3O 5E1MA 2JIQA 5LP1A 1DKUA 1SHTX 4JVNA 1PP9H 1B7GO 2CL6X 1J7JA 1MOZA 3MB5A 1J2YA 4BJ3A 5BW6B 3W8DA 1Z5VA 1NQUA 1ZRSA 5HBRA 3ZK9A 5A4AA 3DULA 4LHYA 3QELA 3O0TA 2AW9A 1YVUA 1E1CA 2GVZC 3CNEA 1B1AA 3LLSA 3WNZA 5LQAA 3SC4A 1A2KC 3ET4A 3HLTA 3VAYA 3MWLA 1DADA 1C1XA 2VJMA 1M6HA 3AEUB 5DF1A 4IQ0A 1H0RA 3H5AA 1P3JA 1NTMH 1R6NA 3L07A 4PXYA 4CNQA 4C2TA 1G1AA 1NF8A 1TA0A 2KPOA 2HR3A 4J7ZA 3WNBA 5JXGA 1I32A 2WEKA 2AJBA 2CNKA 2JJ2D 1XNJA 1YVRA 4UAUA 2A1TS 2G5GX 4KPYA 1GN6A 2WKPA 4KYTA 5AOCA 3KPWA 1VKHA 3DBHB 4GE0A 2B3TA 1EXVA 4Y2UA 1H69A 1TJNA 4L6IA 1GLGA 3OESA 1IOLA 1JDBB 1MENA 4TTQA 4Q3EA 1RJ9B 3RRZA 3VYRB 4BPRA 2FPXA 4RYDA 4G5GA 2HN9A 4J7XA 4WK0B 5E1BA 2VJQA 3WLFA 3ZZNA 5LNK1 4YAUA 4LG1A 4TT3D 1VCHA 3A14A 5IK2D 2EEZA 1RXSA 5EXDA 5EZYF 1PE0A 1DBWA 5COQA 5KCMA 2RI6A 1Z0ZA 2GLTA 2NQTA 4GM1A 3UT0A 4REMA 2AN4A 1NXTA 3LF1A 2VTEA 3IBYA 4JD5A 2CNBA 4CM9D 2XX3A 3CLUD 4KIWA 5FOSA 2Q2NA 2REQA 4MKGA 1T24A 2AXTZ 1Y1RA 3H3XA 4CFSA 2YIBD 1KSFX 1D2GA 1UQRA 3OHSX 1A4UA 4HNRA 5JANA 4A36A 4QELA 5DISB 3B9RA 2O57A 4ZDKA 1YO6A 3TO5A 1FK8A 3LUTB 2A4KA 3WJAA 4BRUA 3UKMA 2C9ZA 2E49A 3BM5A 3FGOA 4ER7A 1TQHA 4LNAA 2VF5X 5IAOA 1Y7HA 1W0JG 2EIJB 1OLUB 3ED1A 3B6JA 4GMXA 3ZVMA 2O3SA 4P5PA 4EYQA 1PSDA 2QQGA 4AJJA 2QWQB 4PI0A 2VRCA 4JUFA 4QT4A 3NHKA 3CC2V 1ZKDA 3AHFA 3QK7A 3GELA 4P08A 4CS4A 4DMLA 2AIRA 4D4JA 3GOQA 3PYLA 3IJ4A 5EIHA 1IEQA 1WQ4A 4IIJF 4MS4B 1E4VA 5EHNA 1BCRB 2NUTB 5TJ9A 5JJ5A 1BFKA 1G3UA 1CZRA 2R4UA 1XD8A 2Y6VA 4F1WA 4URVR 1L9XA 3ANSA 3RHTA 2CGEA 4OHKA 1TFUA 1PFWA 3NTVA 1X25A 3J7AR 3PLRA 5T67A 4IH9A 1M57C 1N0NA 2E6UX 3I9NA 1VJCA 4TQFA 1GZ0A 2I6RA 4PHTA 1J09A 5FBQB 1EWYA 4C4AA 1NXPA 4ZEVA 1WE2A 3ZU5A 4UMFA 3GFQA 3LGAA 4F2GA 5I5EA 4C21A 2CFTA 2W6JD 3NC0C 3DVLA 3OH8A 1DO0A 3TLAA 1WDWB 5H6RA 2GJ8A 3FHJA 3S2EA 5KNBH 2HQ1A 4WK6A 2WLNA 4LFBO 4B73A 1SCNE 4IX1A 2NVWA 2YASA 3I0ZA 3IKVA 4Z99A 3FPKA 1TTQB 3QUSA 2WZCA 3ZX5A 4GZ5A 2FPUA 4MUGA 3K9FC 2DB3A 2GD2A 3V32A 2FJ0A 1X87A 2FW7A 2ZBVA 2OZLB 4QEKA 4RFLA 3CHYA 4TWBA 2FN7A 4UD6A 3NJ4A 5JSUA 2QQ5A 1G19A 2R6FA 5JXIA 3AVXA 1PJSA 2WW8A 1HRKA 3BUSA 5G0VA 1H2ZA 3QMWA 4QE9A 5F1PA 2PNFA 1XZNA 2UAGA 2WPNA 2XNCA 1C2YA 1P4HA 1WG8A 3AJEA 5KOYA 4RPLA 4DLXA 3A9VA 3T7AA 2EG5A 1KMHA 1UFVA 4E5MA 1LDMA 6PFKA 3ZRXA 2PANA 3FYUC 3PUHA 5H5JA 1ONSA 1U2DA 1M33A 3NVKE 4DR3O 1FXUA 4YP0A 4D42A 1QGOA 2HGZA 3HZRA 3LXMA 5J59A 4UQOA 1VE1A 3KZXA 3Q3JB 4QOGA 4GQBA 4Q7KA 3ZYCA 1TD1A 3APOA 1JIUA 2OGSA 2Q27A 4G25A 1WPXA 2Q28A 1U0HC 4QOSA 3DCJA 3CWCA 1OTYA 1DVRA 1X7YA 4BNWA 5L4NA 4PYRA 4TZTA 3CUYA 2CVLA 1KRXA 1JLLA 1OWMA 1R0ZA 2M6SA 5ELMA 1BMFA 3ZJ4A 5IAAA 2EIHA 1H4QA 3P2JA 1T1RA 1NBME 4CQNA 2XB8A 1SVMA 4M22A 2ZKLA 3B3GA 4MR7B 1E4OA 4DW8A 3MRXA 3FCAA 3AHEA 4UHJA 2ZTUA 4D9BA 3O2SB 1XREA 3GBSA 5J4VA 3HACA 3ZEIA 3LO8A 1Y1QA 4G0UA 3C85A 1JJOA 2V4ZA 4EKDA 1FP4B 2IQQA 3ML0A 4J8PA 4F5DA 1K8AW 2YN4A 4KQWA 3SSOA 3I4LA 1DPGA 1J0EA 2H0AA 1LDBA 3FX2A 3H1AA 4ZIBA 3Q3CA 1OFIA 2B4QA 2GN2A 3QI2A 5CK5A 2V5AA 2WALA 2WNHA 3AU8A 3E5RA 1G4YB 4IDEA 2JIZA 4KSBA 5DLPA 5FI1B 2Q0AA 3ZIAD 2QG9A 4RKEA 1GKIA 3GROA 1FS5A 4K2HA 1DRUA 1HOXA 2FTKE 4MPJA 2GN8A 1NVPD 1I94B 1GNTA 1KMNA 2C2KA 4BYMA 2WNSA 3UICA 4PAMA 2QWNB 4D9KA 3L02A 1JE0A 3MT7A 3QBTA 4Y7CA 3TNYA 4XWGA 3VVMA 4BN5A 1NVUQ 4E51A 3FFBA 1X1BA 1BA2A 5KJ6A 1F2TB 1T5TA 2CFIA 4ESHA 2FP4B 2GD1O 3FDXA 4U02A 3RUPA 4HQOA 3WMWA 1GDHA 3HZZA 4O8ZA 3JARA 4FHCA 5T8KC 2XH8A 4R6WA 4UPEA 4X64B 2J8ZA 3FOFC 1G1MA 3NETA 4XX0B 2VNIA 1OH7A 2FPOA 9MHTA 5A0VA 5D5PA 2BMDA 1P8AA 3H9QA 3OD4A 2RIRA 3K0AB 1B4DA 2YJTD 4PC6A 1GZUA 1U1FA 1WU8A 1Y4ZA 2G1KA 2GPYA 3C3WA 4JJ7A 3KLBA 1VHTA 4JLOA 1RQ7A 5CLJA 4MHTA 4C8EA 2GHRA 3PV0A 2WIJA 4WKGA 3IR9A 1SPXA 1I6KA 3FRIA 1OU4A 3K16A 3V8NA 3TD5A 4X65O 2X23A 3EGOA 3I01A 4N7RA 1KYYA 5EXTA 4PBTA 3WL6A 4Q05A 3QVXA 2FSPA 3A0BZ 4ZU1X 4JDPA 5AUOB 1DG1G 4U7OA 1K9SA 4Y2XA 5L3VA 1RCFA 3L1KA 1OGIA 2J48A 4HDKB 1GCGA 5EQTA 4IZIA 2Z09A 3K9NA 4NABA 4DV4O 5H3HA 1YXBA 4YQZA 1R00A 2DUNA 2HI0A 1JCHA 2KW5A 3EVAA 1S2DA 1XP8A 2V0CA 2WWHA 2FOXA 3PNMA 2R6AA 3KBBA 2EJBA 4G5RA 4MB2A 1QPZA 1JI0A 4Z51A 4RIGA 2DUMA 3HFRA 1KIMA 3PGXA 1I3KA 4Z9XA 3D3EA 3ABLC 1ABBA 4V1CA 2BM8A 4YRJA 4BU1A 4N7JA 4Y2PA 1S2MA 5DGHA 4YJ2A 4AO8A 5J4KA 3E9CA 5IAKA 1A50B 4Z0TA 4NR1A 1MC4A 1U2EA 2QU8A 1EDDA 3UO3A 4OQDA 3WZMA 3V55A 3DDOA 3H5WA 3ZI0A 1C80A 5IU6A 3A2KA 5HJ7A 1I7SB 5AD1A 1GAJA 2PKQO 4IEFB 2XT0A 3OJCA 5IKEA 1N2GA 2QZJA 2IYNA 5I3ZA 2DHDA 1V1MA 1YQDA 1HWYA 3PQCA 1EFRA 3AYZB 1ISSA 4V0SA 4BFVA 2ZVDA 4G1UC 3JY6A 3ZY5A 3E1YA 5KSPA 3ICWA 3EDYA 3ZUPA 5CNIA 1N5OX 1GARA 2QRLA 2A9VA 2W9XA 4B4KA 3SFZA 5DP1A 2EZ8A 5ELXA 4BKUA 4DYVA 3BJZA 1E9AA 2X1LA 1P0FA 1TTPB 3E23A 3G2KA 1CY8A 1KBZA 1OXTA 1XXHB 3I4CA 1Z12A 2QQ0A 3B70A 3DXFA 4GKBA 1Q1AA 4R2IA 4DW1A 2OVFA 1NFRA 2VLBA 4BNGA 3KQSA 3D02A 5DTIA 5CB6A 2RBGA 3H8VA 5EHZA 1A69A 3TLEA 3UN1A 5ITZB 2C8LA 3KQWA 2JFZA 5L7WA 3ND8A 2ZYIA 3TSCA 3RPEA 4K7JA 2PT5A 2JCGA 1L5LA 5SYAA 3SX2A 3LNMB 3MGGA 4YDRA 1V3QE 4BRWA 5BT9A 16PKA 2DP4E 2Q3HA 4AWBA 1RP1A 1FXWA 3LPDA 4DS3A 5KTOA 4KAJA 1PV4A 2CJXA 1FYXA 3N2LA 4CQMD 3OEHA 3V6LA 2JNWA 2VPPA 3RRFA 3ZTWA 3TNFA 1LQTA 1X0XA 1PYDA 1K8ZB 5AJVB 4PXAA 1ZHHA 4F8EA 5B58C 2GYYA 5JDIC 2NZWA 2AMTA 2DW4A 2A9KA 1JAHA 1SD1A 2C04A 4ENSA 4N41A 5AI9A 2XTZA 3F3YA 4W5TA 1TRKA 3OTWA 3QITA 1RPTA 1Z2OX 1M6EX 4JELA 4MP3A 5I5GA 4JYPA 4AECA 5JZMA 2D2VA 2A30A 3EVEA 3NG1A 2VK8A 3FMGA 1DU4A 1JAYA 3P4UA 1GO2A 1U11A 1O77A 2O1WA 4HYQA 5CCDA 3K3WA 1AY0A 1C14A 1JZQA 4ZYUA 5BPHA 3LCRA 4JB0A 4XGIA 1I2AA 1UIMA 1Z28A 3BRSA 3OQHA 5EXEA 3WV4A 1JG6A 2IKSA 1AJQA 3L92A 3N75A 4Q3OA 4V02A 4CQJA 3U39A 3E2PA 4NMWA 1DF5A 1AD2A 3KJIA 3Q10A 1CETA 1W2BU 3GB7C 1KYOF 1NNI1 2JLAA 5TF0A 4OKIA 4KREA 4L8JA 5HG0A 4LNUB 2V0NA 2QROA 2ZT8A 4JKOA 4DRYA 3H3FA 1APBA 3SYKA 3C24A 4DSUA 5JJBA 4A10A 2GDSA 5CBHA 1N33B 1M6VA 3F7TA 3O03A 4CJXA 3N0VA 1MH1A 1MA0A 5C8YF 8ATCA 2PXCA 2IY8A 3A9WA 2P2LA 3BMQA 5KYYB 2DFKB 3QWFA 4GYKA 1HNNA 2O5CA 1BGVA 1E6LA 1R0KA 1KI9A 2VBFA 1Z45A 4DV5B 1AXGA 3KQKA 3CCUF 3LKVA 3TX6A 1GVNB 5I8PA 4RXTA 3I8OA 4BQNA 3S5UA 3FI0A 4YUAA 2PH1A 2WFLA 2EBOA 1PEKE 1I24A 2GBIA 3RS5A 1X1CA 1ZBDA 4GQIA 3UV3A 4AP5A 4B84A 3PXEA 4UB8Z 5JAOA 1YK1A 3LCVB 4ILEA 2QE6A 5EJIA 4LBYA 4J6EA 2DR3A 2NUPA 2X2PA 4UD2A 2ECQA 1HNWO 1J70A 1GCOA 1KVUA 2G17A 2AXEA 2HXSA 3I58A 2PF4E 3U44B 1KYQA 4PEVA 3SI7A 2ZYAA 1SXJD 3LTNC 2WAOA 3UBTA 2ZR2A 1N2EA 2NSHA 3PQ5A 3ZLBA 4DTIA 3HKEB 4NZYA 3F9CA 1VQ5F 4C89A 3EIOA 4C4YA 1SQBH 1E1DA 3I30X 3QUCA 4RAOA 1QVFU 4P38A 4R1TA 1E2UA 1KAQA 5FBRB 3WGHA 2G4CA 1XQ6A 2Z2KA 3WAKA 5FORA 3DCYA 5B2EA 1MO2A 1U3GA 2R9VA 3ELYA 2C2OA 1JU9A 4P3XA 4CCYB 3T7DA 5LOVA 1ZG3A 4QQKA 4FLTA 4KOEC 3L01A 1PL4A 4ER5A 2PT7A 2YICA 2IBMA 2QUKA 2LDBA 3K1ZA 5EKTA 1NW9B 2UYGA 4FJ0A 5KHKA 1USIA 4EG0A 3MOGA 5CX1B 3GGDA 2CWJA 2J3KA 3UYLA 4QE3A 2JBAB 3NIBA 4ARZA 5T8KA 4JZ2A 2Q0OC 2XY4A 2WK1A 1VJ5A 3A9CA 3WRXC 1N2SA 1M8KA 4F9GA 4YV1A 5JAHA 4H35A 5KINB 4LFAB 2PPVA 4RZQA 1KIAA 4L5IA 2Z8XA 3EEFA 2R96A 1D2MA 1TAGA 3WP0A 4A2WA 4J2OA 3R0XA 2WMNB 4ALIA 1E18A 4L87A 2P4SA 2XQKA 4PPNA 1KQGA 1PT5A 2VJOA 5IC6A 4DNQA 1ZL8B 1T43A 5K3SA 2VXBA 1ETHA 1YRBA 1Z4LA 2JGLA 2X4DA 4OYYA 4QBKA 5JLAA 2OQVA 3CEIA 3UJ3X 4JEUA 3RBVA 1X70A 2DT4A 3OLWA 4A6XA 1JEYA 2C1EA 3S0HA 2WR8A 5EWMB 2ADOA 1QUEA 1IHPA 1JWAB 1ZGJA 1N9KA 2R48A 1RPNA 1W2GA 1R4MA 3OTIA 4LOLA 4MRPA 1VB5A 2W6JG 1OYVA 4HOYA 5CPBA 3T3DA 4AWAA 3E70C 2Z2ZA 4BZQA 1LBTA 1IDSA 3B9BA 4RSGA 1S2OA 3AUAA 1T6YA 4UREA 3K72B 4AX4A 3C97A 3ESAA 1DWOA 3VYUC 4BV2A 4GOOD 1V54B 3LXUX 4KH1A 4NYMR 4EBFA 3S4YA 2ZXWB 3H2KA 1NBWB 2ALJA 4FBGA 2GBLC 2MMGA 3BD9A 4BNHA 1T25A 4EJ0A 5JPDA 1HDIA 3ICCA 5AT1A 3VO9A 1JVSA 4BTVA 4LHVA 1ZI9A 2EKLA 2XDYA 4TS4A 4WKNA 4ZAZA 3ORSA 3V4PB 4DG8A 3QKIA 1IOWA 1KAEA 5JTTA 4YT4A 1E1QG 3EXHC 5GV8A 3ZS9A 3EXG1 3RS0A 2YXYA 5M5BA 4G9BA 4UXHA 5DNUA 1P74A 1XB2A 3A4MA 4BB9A 3NWEA 4E33A 5GM2A 1XVAA 4QHYA 2LFRA 1PP4A 1VQMF 1ULTA 3PB3A 5IMBA 3EORA 2C83A 2QTSA 3JYPA 2QMYA 1J90A 4RVFA 5ER6A 3KVVA 1FB5A 2H2HA 5TQ0B 1JTFA 1ZJYA 3KZVA 2W11A 5TY0A 2N0SA 3H99A 5AUNB 1P2UA 1ZITA 3CLTD 3AI2A 4N48A 4C29A 1U9CA 1FS0G 2FVYA 2GM5A 2H1CA 2IXDA 1U0RA 2HGSA 3B3QA 3E8SA 3FZNA 3LNCA 3M82A 1VG1A 4NX2A 2Z0MA 3VOAA 1SU7A 4IRUB 4X7BA 1B3RA 4FIDA 1G20B 5JCJA 4EHHA 5F3WB 5KTPA 2ZRFA 5C52B 5IH3A 2QUBA 4JLMA 2XRZA 3IJ5A 5KKCA 4M0CA 1ORIA 3JVVA 1S5LZ 3QOYA 5MFPA 4CF3A 3QNMA 4MS2A 2WAXA 3TIGA 3I5YA 2JFQA 3IKJA 4W9NA 1W5EA 4QVKA 3OPVA 1QVGU 3OZEA 1JEDA 1K6MA 4OBEA 4DLTA 2LWIA 3QTLA 2IV7A 3OX1A 1R7RA 3L06A 4N23A 3ONVA 4CKXA 1GNSA 2EJCA 3W4JA 1SCUA 3EVZA 2I4TA 3VDRA 2D2XA 2Z83A 1OHHA 1W47A 3HY6A 1NJ8A 1GA4A 5EP3A 4TWRA 5AYVA 3ASOB 3WRVA 5K9ZA 2ZDIA 2XLCA 3H0KA 4CC5A 5CMUA 4R1UA 4FHEA 3STYA 4G4SP 3LUCA 4A9AA 2Q1UA 3ZCRA 5B4VA 5M29A 1IV3A 1K7DA 2Q7HA 4GC9A 3KELA 1DPFA 4ND5A 1C9KA 5F7JA 3K35A 2WJ3A 1MTOA 4LXQA 3DUFB 4WOCA 3LBHA 1SEPA 5JY6A 2K7ZA 1ADCA 1WUIS 4RPGA 1BHAA 2PKXA 4WXYB 4AK9A 4TL6A 2VTKA 4K5QA 3BFPA 2ST1A 3D6VA 1QC5B 1A72A 1RKUA 2A84A 3NO4A 4Y9TA 2I2AA 2PSEA 3ZX4A 7ABPA 2QQFA 3SBDA 1NFFA 1KSHA 3ABOB 1OIVA 3F2IA 4N54A 4M49A 5HQ3B 4UJ3A 1SBTA 2EWCA 3I2YX 4IRMA 3ELCA 3PNYA 2GEFA 3TSAA 1VMAA 2R7MA 3NTQA 4U7FA 3P10A 3MMZA 4JAUA 1QWSA 3O4JA 3NNNA 3M6MD 4P83A 5HMLA 1E9VA 3SJZA 1SZPA 3K14A 5I7VA 1UL1X 3QQPA 4XEUA 1H8HA 4PDVA 5ILOA 3WMEA 3O84A 3SNHA 1KP3A 4MQ5A 1PFGA 4DANA 2J85A 4DPLA 4M0PA 2C4WA 2ZLBA 4UFOA 1ZN2A 4FMDB 3RGWS 3VZPA 2CNDA 3LC2O 5EY5B 3R9XB 2XA9A 2QRVA 1IB0A 2BEUA 2FUG1 4LFBB 4JTDB 2ERXA 1ODCA 2XA2A 3B1VA 3DOUA 3PRKE 4HYYA 4UATA 3I28A 1H23A 3ZY4A 1GTG1 2GUWA 2PX6A 4J41A 2Q4OA 5D5QA 4RX1A 3A0UA 4AWXA 5A3JA 1SKVA 1RQXA 1SQSA 1VC2A 3OZUA 2PS9A 4XRRA 3JD4A 5BO5A 4CL0A 2C3YA 1M72A 5KC9A 3C6MA 1KBOA 2EYUA 2X6BA 2P67A 2I6TA 2I8AA 1H8HD 3GV0A 121PA 4N82A 1KKLA 2EWWA 1QOQB 4URHA 4C06A 4O4IB 1YDGA 1W41A 4ZHSA 1XLWA 2QBYA 1GNLA 1P0IA 4F5WA 4IDOA 1RHMA 4FGZA 3PS9A 4YUVA 1JJ2F 4R81A 2ZR7A 4AVYA 2Z2YA 3L8YA 1DOZA 3M70A 5L3ZA 1B23P 1YRYE 1B0PA 2O0JA 3HVKA 1PYGA 4DR3B 2NV0A 3LS2A 4OBBA 4ZVMA 5GMOA 3C6XA 1G6OA 1XO1A 2E82A 3IUSA 4K6KA 5GM1A 2VDJA 5HE9A 4B44A 3ZS8C 4QDUA 1PK7A 1R5BA 1YJCA 3ADKA 3UMGA 4D46A 2YN2A 1E8DA 4LV6A 4C4XA 2QAIA 5EUBA 4OIMA 1V4NA 5FLYA 1KWGA 3LX4A 2FR8C 1IXZA 1IPHA 2WG2A 3EA5A 4FX5A 3N8DA 3W9SA 3UZUA 3CH7A 5KUTA 1D03A 1XTUA 2CMDA 1HM5A 3IMKA 1DAIA 3EQZA 4KQ9A 4W8OA 3M84A 2FSVC 3TVTA 4TYWA 5KNBD 1EFHA 1Q1EA 3ROGA 1A32A 4CL8A 8ADHA 2C3MA 4L4RA 4BGEA 4WXMA 5GZ3A 4HUQB 3VZQA 3L0ZA 2ZINA 3JCUZ 1NKTA 1UFKA 1YR7A 2HF2A 1T2FA 2NADA 3LDHA 4XR4A 2WINI 5DDIP 4F72A 4DV4B 2PRSA 3GJYA 4MRSA 3QJGA 4Q03A 4CTOA 5JSFA 2FZLA 3BBPA 4XSVA 4GVXA 4YRPA 3FSRA 1B8NA 3FWHA 1ZCBA 3R7BA 3VYSC 4BGVA 5E8RA 4WF9V 2D4AA 1T3ZA 2PJUA 3PYXA 1D4ZA 3EODA 4E4YA 2IIQA 3KQTA 5B55A 1YJXA 3NHUA 3DOCA 4QC2A 1XCGB 4R31A 2GBOA 2GYUA 2ZUEA 2ZU6A 1IZ0A 3FLMA 1N1DA 2PGIA 4F3CA 5HZKA 1GZSA 2CWWA 1F1JA 2CT8A 3MJCA 3NVDA 3OCCA 1K33A 4PC2A 1DCMA 3I4FA 5FOXA 1L4NA 1QRUA 4ARSA 1CFJA 3G2LA 4DNFA 3ZDZB 3F3KA 1QHXA 1YA8A 4X89A 4H1UA 4TTVA 1C0PA 3RA6A 1DC7A 3ONEA 4D9EA 3TVYA 4GUDA 4L4ZA 1Y9ZA 1L5QA 4Q5IA 3OONA 4CUKA 1UDAA 2DFLA 5KSOA 2XTJA 4W7IA 1XF9A 3BD7A 4CKYA 1A82A 1I01A 3UMMA 3REFA 4E5KA 2G8NA 5CEFA 3IP9A 2QU7A 3ZWCA 2DPYA 4RAQA 1PFQA 5AVYA 1Y67A 1TUIA 5B8FA 4BKMA 3EVKA 1G21B 3X1YA 3IVGA 5C53B 4RKYA 4IDPA 5BVGB 3KKYA 1M7BA 2ZIUB 4P34A 5D8DA 2RK6A 1Q82W 5KYXA 4S2UA 3I52A 4B3XA 1QTIA 1Z47A 1THGA 2Q2VA 3CVOA 2V0GA 1VECA 3WQSB 1Z4OA 1L7RA 3AJ9A 4KWHA 1ORDA 3PNLA 1KUQA 1PS9A 2JH3A 1C4OA 2YHAA 1FRQA 7REQA 2E1PA 2CSXA 4RIEA 3QJ5A 2AFIE 3JZIA 5F3DA 2O8DB 3KG2A 3R6WA 4KMOA 3K0EA 1DC3A 1JJBA 4FE4A 5DHQA 1SQPH 3OE4A 3S2SA 3T5GA 3LT2A 4J1TC 2DQ0A 1AO3A 3FVQA 1DRVA 4CBCA 3LA6A 2IGTA 3FFMA 3A28A 1U96A 3CZQA 3HBLA 3F3SA 3IEUA 3RVNA 5IXSA 2OTCA 3KP1A 4DXDA 1YQQA 4MPRA 2G40A 3L9XA 4FZ5A 5JZOA 4IWXA 3ZGZA 4D7AA 3WLOA 1G2IA 4EY6A 5M7EA 5IM4A 3E48A 3DKKA 3HMKA 1FEZA 3N86A 3R7AA 2VJAA 5E7MA 2ACKA 2BCGY 1RPRA 2OYRA 3ZV3A 4XFJA 3BEHA 3OUFA 1I80A 4R8MA 3EXFA 1GPH1 1QRSA 3FWKA 2I4IA 2D5CA 1Q8RA 3R0IA 2B82A 5J4YA 3EJWA 2KKWA 2E4ZA 3I9V1 4N03A 3R5XA 2CCGA 1PQWA 4Y2HA 4FHZA 4QAQA 5G3YA 4ZKDA 5J58A 3Q8KA 4HMPA 1WUTA 3RC2A 5FX2A 4EMSA 3SSAA 5IF9A 1U1DA 1J1UA 3MCUA 2QM3A 2X0DA 1VKNA 5EJEA 1OX4B 4HB4A 1M1YA 3RAJA 3V9AA 4ZVOA 2EFGA 4PA6A 3DM9B 2KMLA 3G9QA 1WKVA 2AJ8A 3HCWA 3TR0A 4YRGA 2Q4TA 4YUZA 5KJ1A 3ERCA 1IAVA 3ZE0B 4ZVLA 5A02A 5A2GA 3D7MA 1T8YA 3BH7A 2B4TO 2C7BA 4OHOA 3WIBA 3BXZA 3M1IA 2ZG6A 5EWLB 4OD0A 1BZKA 2GTSA 4U2CA 2H6LA 5JEDA 5C3UA 4GWLA 1OREA 1ZO8A 3RB8A 1UK8A 2AUTA 1E3MA 3K20A 4BYGA 1IUOA 1J8FA 2PU7A 1YZLA 3FJYA 4FYWA 1I1HA 3CX7A 4F3KA 2ZT6A 4KFCA 2Q2WA 3RBZA 1Q1GA 3ASNC 4R8RA 4TMKA 3UMBA 1WMFA 4QOEA 4GGMX 2KBEA 4U8HA 4HVCA 3HR4A 2VYCA 3ZV4A 4M0KA 2QW1A 4V0LA 1KZ7B 4AJ2A 2VNHA 4II2A 1XKQA 5TGZA 2OFOA 4XUGB 1B73A 3HWRA 1Z8FA 4QU8A 1N34O 1KY3A 4NCIA 3AIMA 3EZ7A 3CMMA 8ABPA 5B3KA 4EY8A 3D54D 2CHSA 2ES4A 4G9GA 3W2GA 1OBVA 2ZRMA 1XEAA 4RD0A 5IAGA 5LZ5A 3NV9A 2QRHA 3QXSA 2FEKA 3ZVRA 4CLRB 2RGNA 3HJHA 1AKYA 5D01A 4I66A 1CQXA 3I55V 4F93B 4J0QA 2Q7DA 1PNKA 4WMLA 3CLUC 3KZIZ 1K2VN 1KJNA 3AVQA 4L8FA 2OESA 2IV2X 1X15A 2PH7A 5JH7F 3MJEA 1LBHA 4ZAYA 4URUR 4LF4B 3LWRC 4DEYA 1X7GA 2FQ1A 3GMIA 3OFND 4RM3A 1AHIA 4XB1A 5GQSA 4LCBA 4N5MA 1ML4A 1KFEB 2HS0A 1E66A 1JIXA 1BX1A 1TO6A 2H85A 2G9RA 1M0TA 3R3UA 5ESRA 4J11A 2XCSB 1XI2A 4L0CA 4Y6GB 1BQ0A 2NU7B 2BFDB 2W2MA 3A4TA 3DGFC 4OMCA 2ZPUA 4NXMB 2AMYA 4M8NE 4TLBA 2H1WA 1W48A 1GL3A 2AN1A 5C7YA 4O08A 4U8GA 4GRIA 1VLZA 3ZO8A 2RHBA 4TM7A 4YBZA 3MSCA 5A6SB 1BRMA 1Q1ZA 2W6ID 3I56F 2Q5LA 3SYAA 2C9DA 1COWG 3L7YA 1SELA 1KU6A 2I03A 3N2YA 4D8WA 1AK1A 1Q0UA 1X7OA 1TEXA 4Z4CA 4NULA 2R72A 4UBLA 3LCMA 1Z38A 1YITV 1Y5IA 5KHHA 2PSHA 2I87A 2Q7XA 2PM8A 2CLFB 2BFOA 2YCBA 3AX6A 4MVJD 3D01A 1K75A 3GPBA 4KE6A 4BS9A 1WL8A 2TMYA 1BE8A 5ERGB 4R2KA 5FJJA 5PNTA 3R8FA 5JARA 3FLAA 4NRDA 2ZODA 2IQ5A 1UM9B 2QR2A 4BT2A 1ZAUA 2Z5UA 1NI5A 1HLDA 5LNK6 2Y92A 5AVWA 5IBCA 3BAZA 4PPQA 2JAPA 1EFDN 4BNXA 1G55A 3TUIC 4DQLA 5BMOA 1X7XA 5AI5A 3THYA 5A2QM 3MUFA 1ODEA 3JQ8A 3ZWQA 1HK7A 2GNAA 4WXEA 5BVHA 3M81A 4D56A 4ZN6A 4JVLA 1GPUA 2Q9UA 2G9VA 1JD1A 3CH4B 4IVNA 3RWRD 2VP2A 2VYVD 5KYTA 4QDTA 1T5EA 2VPXA 5HF5A 1K7XB 4DVGA 1GLNA 4I2NA 4LWQA 5B1IA 1JIVA 1T0BA 1YR3A 3PQ4A 4L8WB 4RA9B 1ZJJA 1VYVA 1KJYA 2D7CA 4KFTA 3OQNA 1E5XA 3JTEA 5D51S 4LRXA 2IV3A 3EFOB 4RADA 2YW2A 3FB7C 4UDNA 1SNYA 3QTYA 4AKTA 4X7MA 2J7KA 3OZGA 2OCDA 2PK3A 2EULA 2OXCA 3SIXA 1ND6A 2BN4A 1VE7A 4F2HA 1I7DA 1RTKA 4R40B 1AKEA 4JBWA 1XTRA 4J4TA 1M34A 2AT1A 3VU9B 2P9YA 4J2TA 3UJHA 1Z33A 4M7OA 5ARBA 1SCQA 2QD5A 3BB1A 4KL8S 1FQJA 4ZOLF 3W1EA 5KYKA 2JLVA 3DAGA 2Y27A 1T0JB 1UF9A 4A7PA 3IQIX 1MJNA 5E1AC 3EFEA 4G4ZA 3V3KA 1G21A 4L78A 1UOEA 2DLNA 5JS1A 5K0FA 3B2NA 3QY9A 2WUDA 5G4LA 2UXXA 1ZESA 1Z7EA 5DHTA 2VUUA 4NE2A 5EL0A 3SKVA 5JUWA 3AEQA 2FLKA 3IRUA 3LTEA 2XAFA 4JBYA 5JYDA 3O31A 2I4RA 2Q9BA 1ZGCA 2G88A 3ML1A 2EILB 3HWUA 3QLUC 4I7EA 3RYTC 3WJQA 2WHQA 3MT9A 4I8XA 4B62A 4F2PA 2HUPA 4L4UA 3E18A 4R8SA 1TCCA 3CG6A 1WDLA 2RC5A 1ODFA 2J59A 2YTZA 2ZTSA 3I34X 4QICA 4QYSA 4XDGA 4ZZ2A 4DNOA 5IY5C 2G08A 4JI8O 1KL7A 4GBJA 3Q72A 1V4VA 4Z9YA 2WHYA 1DAKA 4KBYA 3F0GA 4U0JA 1DE0A 4U9UA 2QW8A 5BT8A 1RDFA 1H2FA 1M7GA 1RR6A 2W2VA 2YMPA 3FD8A 3KB8A 3WNCA 4RK4A 4BMXA 1NNEA 2OHWA 2C9CA 3MF4A 3ZE2B 5IWCA 1WP8A 1JJVA 1K8QA 3K0KA 3MOIA 4JIMA 1KOLA 2W98A 1XNQB 4R68A 1USUA 1ZC3A 2BI8A 2YV3A 1DEOA 2ZI7A 4HFJA 4QG3A 1UZAA 3VNUA 1XU7A 2G0AA 3SSMA 3UQZA 1W36D 3UK0A 3M4ZA 5B3JA 4FGKA 1M2OA 3R8CA 5CA0A 3KJXA 2XUQA 2HJ9A 2JI6A 4XFKA 3RHSA 3LDCA 3HJNA 5IJ0A 2MYTA 4AIIA 1IMJA 2RFLA 4WGGA 3FOEC 4JP5A 2WYIA 5JWRA 1B8UA 1Z4JA 2CLSA 4UCQA 6YASA 3IBSA 1VP9A 2EIJC 1W3EX 4IV0A 1GN9A 1ZH8A 1QHIA 5D3MA 2XCTB 2WT9A 3H18A 4HEA6 5IJ0B 2F62A 4Z7JA 2WA1A 5EFZA 2C5EA 1AS3A 4O2AA 1VQLF 1NMXA 2YDYA 3BH0A 4XGKA 4A6PA 1MNAA 5BR1A 1XD9A 4DCJA 2A33A 1CZOA 2IFTA 3EASA 4OLJA 4FC7A 4H44B 4DBLC 2O5VA 4I19A 4CM7A 1XGKA 3RT9A 3U0OA 3B20A 3GAMA 1P80A 3OCXA 3LYBA 4MQLA 5KBYA 1M57B 1E2JA 2OAEA 4KIFA 5CDFA 3SWWA 3KLPX 3U9SA 1RJFA 2H4YA 4LH7A 3WL4A 3OJLA 2FEWB 1NDHA 2OM6A 3JYLA 1SESA 1U90A 2SKCA 4DG5A 2AWOA 3Q7IA 4JT9A 4G23A 2ZR3A 1DC8A 3R5JA 3GL9A 1TW2A 4AUNA 3I56V 5CNJA 3DB2A 1NMSA 2EKDA 2NO9A 4ZCSA 1IC6A 2R97A 4G8CA 1NLUA 5DTMA 2P3SA 3MWKA 4I55F 5JJLA 4UU0A 3OAAD 2IOFK 1NY5A 1KSJA 1RWXA 1UWCA 2DSNA 2VAWA 2AG6A 3A3KA 4C04A 2HA6A 4RHEA 3ZQUA 1Z22A 2W2KA 4DDVA 3AHIA 2X0KA 4QATA 1E1QD 4JLVA 3OHPA 3KUCA 1HQKA 3DWIA 1SZQA 4YMLA 3FPEA 5KTKA 4JYBA 3EAGA 1GKYA 1HMPA 3LL4A 3P8ZA 4WCVA 4WIAA 5CXSA 5LZ9A 1P9WA 2GRUA 3ITEA 1NVXQ 2NNLD 3ZE8A 1U0JA 4TS3A 4CG3A 1LQUA 2BJHA 2I4MA 3C8DA 5K03A 3MN1A 2CDYA 3L7DA 4MVJG 1W8IA 3ESQA 4DQXA 4D9HA 5KHJA 1OSNA 1Q0QA 1A5TA 2GEBA 2V96A 2ZJBA 4ZHYB 3GRPA 3KC2A 1WY5A 4J16A 1YEWA 2VVTA 4LJ7A 5G02A 3G3EA 2FW8A 1SUWA 2DX7A 3R5KA 2PX3A 5IVIA 3VZDA 5FWXA 1JMKC 1M2GA 5J43A 4RTPA 3NIFB 3WYNA 4AP9A 2C7OA 2AX4A 3OMAB 3RT7A 1PYOA 1U04A 3PFKA 5EJFA 1JG7A 1FNJA 1RAFA 2I34A 2PBFA 4JZKA 1UWLA 3VV2A 4RIIA 4YP1A 4XDZA 3C7AA 1L1RA 4AY4A 1AO0A 5TISZ 1GT91 3VIUA 3Q6IA 5J2TF 4DA4A 4Q9NA 2GZMA 5HGJA 4DV2B 4MB0A 3ZBQA 2Z9CA 4HT3B 3QH4A 4B7ZA 1WWKA 2J3LA 4QQ8A 2R0QC 1U9YA 3JATA 2QL9A 1KDPA 2YWHA 2R6JA 3FYCA 5CITA 4FILA 4UARA 1GG2A 5DBIA 2WF5A 4LYAA 2HRUA 3JQ8B 3IOYA 3LRPA 2AIZP 3RSSA 5SZKB 3TRKA 5LR6A 3S02A 3HU1A 2A57A 1VYUA 3E9MA 4LJ8A 4EYGA 4QBTA 2XDAA 3FZQA 4O5AA 4XARA 1FJHA 2XUOA 2EJTA 4IFTA 3ZD7A 3AR2A 3BKWA 3GQVA 2HO5A 2YXPX 4B6JA 3IFXA 1E2FA 1KKCA 1UR5A 3VA7A 1G41A 3O8OA 4TZKA 3X1ZA 4PICA 1W93A 2BHNA 3I9OA 4O8CA 3R2JA 4UC0A 3RU3A 4BJ6A 5K7SA 1ZSVA 3PGJA 3QVSA 1CK4A 2AF3C 4M9CA 4ZYXA 2CK3D 2ZI3A 1WNFA 5IYBO 2OTJV 5C2JB 3LY9A 2XF8A 2HX1A 5FNVF 3S68A 4G8DA 2GPJA 5F4ZA 1MG0A 1FCJA 4JBGA 1OXXK 2C1ZA 3MZ0A 2H92A 2QE7D 3C6QA 3JQBC 2G71A 4DF3A 2JZCA 2YSUB 3WC4A 3S06A 2O0HA 3QXGA 4DGSA 1T2AA 4ZZIA 5I8WA 1Y4SA 3IVCA 1N0JA 1JDUA 1V7PC 3O3NB 3GUZA 4LDNA 4MA5A 4OXKA 4YB8A 5E1DA 4I4LA 2QNRA 1QAOA 4HH0A 1F6WA 1XL6A 4ZDIA 1L8XA 2WU4A 1LDEA 1IG3A 4AF6A 5AUPB 5H4GA 2GLUA 4NB5A 3HFSA 3WKDA 4KO1S 5JECA 4L4SA 2VT6A 2GXAA 4YRFA 2IEIA 4OCZA 4IDFA 3W90A 5DI3A 1R3UA 1RAIA 2CLCX 3CW9A 2PUDA 1EFRD 1U2TA 3RYFA 3KL2A 4WAUA 1CUUA 3G2NA 1B6QA 4UTPA 2PTGA 2JGDB 3CLRC 3OKAA 4KBFA 4RVGA 4CLRA 2B34A 5K5EA 2Z98A 3ORFA 1J5XA 2QB5A 2ZTHA 3FB1A 2VHUA 3VBEA 1T2DA 2DY0A 1ZM2A 1VSUA 4RHYA 4BFXA 5K01A 5BUCA 3OG9A 2X6RA 3KQQA 4J9YB 4MYCA 2R6HA 2QTAA 5AKEA 5L3QB 5H1YA 5I4KA 4KLZA 3A25A 2YBEA 5E6UA