4X1IB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 151
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1iB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1iB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1iB01
5ITZB 3WGMA 3JATA 4O2AA 3JATB 4E6EA 4WBNA 5EZYA 3VOAA 5EZYB 4DRXA 5LXTA 3WGNA 5LXTB 4EI8A 4HNAB 3RYCA 5LA6A 3JALB 3RYHB 4O2BA 4ZOLA 4TV9B 3WGLA 5KMGA 3HKEA 5KMGB 3HKEB 5JCOC 4EB6A 3JAKA 4EB6B 3HKDA 3RYIA 5CB4A 3RYIB 5CB4B 1JFFA 1Z5WA 3JASB 1OFUA 3UT5A 2Q1XA 3WGKA 3ZBPA 5EIBD 4O4HA 5JCOA 4YJ3B 5FNVA 5FNVB 4O4IA 3JARA 1RQ2A 3JARB 2BTQA 3JAWA 3JAWB 4X1IB 4X1IA 5MN6A 4I55A 4I55B 4FFBA 4O2AB 4FFBB 1W5EA 2XKAA 2RHLA 3ZIDA 4WBNB 4DRXB 5IYZA 3E22A 4TV8A 5LYJA 5JVDA 5LYJB 3RYCB 5LA6B 5BMVA 2VAPA 4O2BB 5BMVB 4ZOLB 4ZHQA 4O4LA 4X1KA 1TUBA 2RHJA 3M89A 3HKCA 3JAKB 5KX5A 3HKDB 2GVIA 3M8KA 4M8IA 4LNUA 1JFFB 5GONA 5GONB 2XKBA 5LP6C 3UT5B 3HKBA 1FFXA 5EYPA 4O4HB 3V3TA 5J2TA 4EI7A 3CB2A 4O4IB 5LOVA 2RHHA 2BTQB 3N2KA 3N2KB 3VOBA 3R4VA 1TVKA 5LP6A 1Z5VA 2Q1YA 4X20A 3RYFA 4X20B 3RYFB 3E22B 5IJ9A 4I50A 5IYZB 4I50B 1W5FA 4TV8B 2VAMA 4U3JA 5JVDB 4U3JB 5JQGA 4U39A 4ZHQB 4O4LB 4X1KB 3VPAA 1W5AA 4EI9A 4I4TA 1TUBB 4I4TB 5CA0A 5CA0B 5IJ0A 3VO8A 4XCQA 1RLUA 3HKCB 1W5BA 5KX5B 2R751 4LNUB 4TUYA 5M7EA 4TUYB 1FSZA 1W59A 3RB8A 1SA0A 1SA0B 5ITZA 3VO9A 3HKBB 3C8LA 1FFXB 5EYPB 4X1YA 4X1YB 5J2TB 2BTOA 4IHJA 4IHJB 5LOVB 4YJ2A 4YJ2B 4HNAA 2VAWA 3RYHA 3JALA 1W581 4TV9A 5CA1A 1TVKB 5CA1B 5LP6B 2RHOA 2VXYA 5C8YA 5IJ9B 5C8YB 2R6R1 5EIBC 5JQGB 3N2GA 3N2GB 3JASA 5IJ0B 4ZI7A 5J2UA 4ZI7B 5J2UB 5JH7A 5JH7B 5MN5A 3WGJA 4B46A 4O4JA 4O4JB 4KWEA 4IIJA 4IIJB 4YJ3A 1RQ7A 3ZBQA 5MN4A 4B45A 4F6RA 4F6RB 4DXDA
chains in the Genus database with same CATH superfamily
1L0BA 1COWA 1M9NA 1MHPA 2QS9A 2CMFA 3ZK8A 4ISBA 4RPCA 1T0UA 5FUXA 5H5JA 4X45A 5KIAA 3EEOA 2WU4A 4R8KA 4MKGA 1JLHA 3ISJA 3N07A 1G2QA 1U8CB 4A91A 4TGLA 3VKUA 2VP6A 3ZP7A 4FYVA 4X6XA 5K09A 1WF3A 2EHDA 4IGFA 4L1KA 2WJGA 5E6RB 3V4OA 3MTAA 3FB4A 1L7VC 1YS9A 2NQTA 5TPWA 1T4MA 1ZZEA 2WZBA 4DMRA 1ZNXA 1OC2A 3EFOA 1NMUB 3TRFA 3BRSA 3BM5A 4F93B 2CXSA 1P39A 2IYFA 1QUFA 3CC4F 2ANCA 4QTZA 2QE6A 4A0GA 4NU6A 2XXJA 3T7RA 2PS9A 1QV7A 3VTAA 1U2PA 2VEDA 3X1WA 2ENUA 4PSCA 2Y4TA 5MN4A 3KUXA 1CQJB 1MEEA 1Z29A 3JZDA 1WBDA 3UCEA 4OQPA 3EXFA 1GXSA 2G9NA 4J0HA 3PXCX 3EZ2A 3OHSX 1DX6A 1XPUA 1LQ2A 2EIMB 2WWFA 1VQ5F 3WK9A 2OAGA 5BVHA 3ISTA 4MB2A 2EFEB 4EECA 3WA6A 5EIWA 2NZXA 4BLUA 3QU4A 1YVRA 3UT6A 2IA5A 1JDBB 1LWNA 4DIFA 3AK2A 2ZQ5A 5F7ZA 2I7VA 3IOCA 1T24A 2WAXA 4ZTBA 1ISSA 3TRJA 2W6JD 2ZBQA 1LBHA 1R5OA 1A69A 1HDGO 4Q3NA 4TRJA 3OFNG 1NI4B 1YL6A 1UZMA 1K7SN 5MFPA 2XBUA 3IAS1 3PFGA 4DJTA 1TTQB 4NWIA 1JQ3A 4NH0A 4H59A 4TXHA 2RJNA 1XDDA 2F64A 3SM9A 3I4FA 3R40A 4ENSA 4WZ6A 2BJWA 2I8AA 3EF3A 4RF2A 2AIZP 5C9ZA 3D8UA 1BVHA 4RIGA 3RS0A 4RCYA 4BKOA 3SICE 4TLEA 1RKQA 1SBZA 3K8ZA 1Q3KA 2OV3A 3A6ZA 3VX4A 3T4DA 5JNSA 1Z7YA 5TNXA 1YK1A 1NNSA 4KPUA 4HDNB 4WACA 1OAKA 5D85A 1GGKA 2G17A 4ZGGA 1UMKA 3UB3A 5IVKA 5KQLA 3C43A 4B3RO 2DGDA 2V6FA 2X1MA 3TX2A 4QM7A 3UQYS 3GO4A 2VDWB 3C3YA 1YWGO 1DLBA 4RLSA 3K08A 1RI1A 4CKWA 5FO0A 2X0DA 3K1TA 4Q6WA 3MJCA 3LYLA 3HYNA 1GQQA 1FFDA 1FQJA 3RU2A 3L77A 3M6UA 2Q1WA 1AR5A 1N77A 4FOLA 2K5UA 2W0FC 2FRVA 2DFDA 4TN1A 4EJSC 2VWPA 3TKLA 1KVSA 2H2AA 4LK2A 4D0NA 2WC1A 2H08A 5L3SA 3TS1A 5MN6A 2NTEA 2W6NA 1MB9A 4FX2A 1W47A 4BO3A 2IYRA 4P0QB 1NXVA 3RIGA 3QMWA 3V4ZA 2VK4A 1V54B 4FI3C 4Y1RA 3OW2U 4JNKA 1G4UR 1CS4C 1AJNA 1NS1A 1E6MA 1TVCA 4TZKA 5JSYA 2YVQA 4YRAA 1HC7A 4JR0A 1YHYA 2NVUB 2Q7HA 1V6CA 2QTBA 4A3SA 4MW1A 1ZH0A 4IJ6A 3T3OA 3ZY3A 3JRXA 4J7UA 1O9BA 4JVLA 3OG9A 1CUYA 4UOZA 4NABA 4R2HA 4AQDA 2G72A 1RXSA 2I7XA 4TYPA 1TGYA 2QWRB 5CRIA 3PWTA 3UA4A 2DHEA 2CVFA 5JXWA 2CUNA 4GG1A 5KHJA 4PCLA 2ZYTX 3H8VA 3DB2A 2RB4A 3HVRA 3BSYA 3ZHRA 1VB5A 2ZT8A 1VG9B 2HIMA 1E2IA 4R50A 3BSWA 3S0HA 3KE1A 1H5QA 5GJBA 2O9JA 2BAGA 4MW8A 4F38A 2TMYA 3LK6A 5BQPA 3BVPA 2WMNB 2QL6A 3EIXA 2FKNA 3H5WA 2V5VA 2Y1DA 1GT91 3L7YA 4Q7QA 3EC7A 5IEBA 1V8PA 3R65A 4H4DA 3DAGA 3DL4A 1RRGA 4N5LA 1DJOA 4I1SA 1VKNA 5EWJB 5A5VA 4IIJB 1KMHB 1QV6A 4ACAA 4JF3A 5I7EA 2QWOB 4AUMA 1R8XA 4JEUA 1TW2A 1JVSA 2G08A 4PN7A 1KYYA 3GH1A 4P5DA 2AD1A 3GBVA 3SM3A 4JI5B 1RWPA 2H8PC 3DTVB 3ZJVA 4M98A 1CJCA 2Z9CA 2ZYGA 1OXTA 3FUUA 1RRKA 3CVXA 3IKMB 1GTZA 4PY2A 2ZUEA 3NCTA 3OCXA 1WDWB 3HJUA 1XL6A 4PRKA 2F67A 1ILEA 3SKVA 3T4UA 3DKVA 4OX9O 3PHJA 5CDFA 3SZ3A 1M5IA 1FCJA 4CHTA 4MV9A 5CGQB 3V7QA 1VQ6F 3BD9A 3WIOA 1V2HE 1NN0A 1HE3A 3AEZA 3AG4B 5EHZA 3G8DA 3T3NA 3H2YA 4JU8A 3TZKA 2ZRLA 2JATA 3ZUGA 1R0SA 3X1KA 3HBLA 2F3QA 2NZVG 3FNHA 3LKZA 3KT6A 4RS3A 2Z09A 3FB8C 3QF7A 1HE4A 5TMBA 4UTRA 1T1IA 4BTVA 2D62A 1DF5A 1NQVA 2YXYA 3TQCA 1HUQA 1UF9A 2MSLA 8ADHA 4RQEA 2XIQA 5TISZ 2WUGA 1BTOA 1L1EA 4D45A 3H99A 1QZUA 3BH0A 3ZEIA 3G7NA 1L5YA 4AI8A 4Q7JB 1Z83A 4DG8A 1IHDA 5I48A 1N33B 2PY6A 4ZVVA 3M1IA 5JD4A 2A30A 3CSUA 1NATA 1Y4MA 1IHXA 2QIPA 1WSDA 3EAGA 1U2ZA 4E33A 5DN6D 3PNKA 4P4LA 2EG5A 3A4YA 3UHJA 1QX3A 4XI9A 3WX0A 5ALZA 3HXTA 1TEVA 3W2GA 3Q8XB 1OA0A 2M1ZA 2WIKA 1LF5A 1OH8A 4LJKA 1WHTA 2DWCA 3UCFA 2GO1A 3CX4A 5KNDD 1R10A 2H9AA 3FYUB 5CXXA 3BRWA 2Z6AA 1M1XB 1REQA 2YJ5A 2P27A 4NG5A 3G3EA 3WGTA 4DA8A 3NW9A 1XVAA 2V59A 1CY4A 1YRWA 4UNSA 3R9WA 3FDIA 1YHNA 4UVEA 4DMFA 1G3IA 3ABIA 1HBJA 1AB5A 4S35A 2WJIA 1NW8A 2K7FA 2HGZA 1E32A 1E3WB 2YJ6A 3UK6A 1EB9A 4YRZA 4MS1A 1X80A 3AG3B 1F38A 2RJZA 5TPZD 3OIDA 1ZOSA 2GHIA 1CB0A 3UCSC 4F5YA 1TM3E 4AY6A 3CRW1 1LLFA 1QQCA 1A98A 1NZDA 1OPRA 1GFZA 1Q0PA 4D0LB 3NP7A 2B5UA 1C9EA 2R3SA 1PK8A 5IZCC 3HNRA 3UFBA 3U4HA 3PUWA 4K2AA 2P67A 1ES9A 2EIKC 5FPTA 2AX3A 4NV3A 1H69A 1XOUA 1PR0A 3W9SA 2QZJA 1UJ4A 4DWJA 3A9RA 1FNNA 4JTCB 4IO0A 4DIKA 1K0FA 3OTWA 4LHSA 3AG1C 2NZJA 3A0UA 3RYCB 2GHTA 4ROSA 4AMZA 3UH1A 2VOEA 2NYVA 1QIFA 5EHNA 1RAIA 1GR0A 2G38A 2WVGA 4B08A 1OHHD 2PQ6A 2VBFA 4EA6A 2I80A 5IWAO 5EINA 3F4BA 1NYLA 4DGSA 3LPNA 4LRUA 2O8FA 1RZVA 1AO0A 3L9WA 4G0MA 4XR4A 4EHIA 4H31A 2VTEA 4QG7A 1GU1A 3IBFA 1TFUA 1MX3A 3OZFA 4XASA 5FR1A 3HABA 1R8QA 2W42A 1FBTA 1QGUB 2UVDA 5AVOA 4DMMA 1W85B 3JSAA 3AEKB 5KUMA 5BN5A 4ZV7A 1GPAA 1YRBA 1KJIA 3K3PA 3TSYA 1RM3A 4G81A 3QTCA 1Y6JA 3MC1A 4F72A 2YXLA 3CCFA 3ZH2A 3KKEA 4FN4A 1VBKA 1NBME 4X41A 1BJTA 4LYGA 2WSIA 3TYXA 2QGNA 1WA5A 2Q0OC 1WTCA 3DMRA 3WWEA 1VQ1A 1HRDA 2CLSA 2IP4A 3ET5A 1UH5A 4C6RA 4OMFG 2BDTA 1PAUA 4M1TA 5IKMA 2ZJ4A 1AV6A 3CO0S 3BN3A 2WWHA 3MM4A 5C4MA 4Q9LA 4DJ5X 1EHIA 4UVDA 1XT6A 4J0DA 4AM8A 3GIWA 4HB3A 3ZVKA 1DELA 3H0KA 4QDZA 1EWQA 4I2NA 4DLPA 2HWXA 4DEYA 5JXGA 4B9EA 1XCPA 1H6AA 2R2GA 4OHMA 2YR0A 2R86A 1GQYA 4YPFA 4BVFA 4ZTZB 4ZQGA 3D64A 3WLOA 1F1JA 3SPHA 1QDUA 3AF2A 1POWA 3LBHA 3ZWBA 1IZ8A 4QLOA 3IGAC 1X2EA 1XL4A 1RQLA 3ANTA 2QTPA 1TGVA 1XDWA 3P30A 5BSKA 4ND1A 5GZ6A 3T7KA 4EHKA 3DAYA 1Q3EA 5HF5A 2KI5A 4PTLA 4UM9D 1S2NA 4I4TB 1UBTS 4ZT4A 2QMOA 1YQTA 3GLFE 1YCHA 4EA8A 3KC2A 2WZDA 4F2HA 3BMCA 1U2QA 4DA9A 1MOFA 4L8JA 1YDMA 4Q37A 1F8FA 1N2XA 1G18A 2H0AA 2ID4A 2DQSA 4Q0MA 1WXGA 2VPPA 5JWRA 1GCAA 4RK4A 2YN2A 2WB2A 2C3OA 4IUDS 2J6BA 5E9QA 5JJBA 2I7CA 1KE2A 1N6HA 1QPZA 4ZXFA 5BXYA 2C2BA 3H9JA 1Z38A 1V41E 2OB1A 2VP2A 2UYKA 1C14A 4BFVA 1SXJA 3VR5A 2KMLA 3UWKA 1YASA 3S3XA 2OO5A 2WFMA 3F49S 1K9MH 4G8JA 1FFYA 1VMEA 2EX3A 3QTYA 3SSMA 3T8YA 4FBLA 2PKWA 3GAMA 1U3TA 2ZSDA 3CB2A 4JJKA 5JADA 2A1UA 4ZEXA 2BMVA 1ENVA 1Q3TA 4R71A 4JQZA 5DI3A 4ER0A 3GJ5A 1HQKA 1JCHA 4MLZA 4BP1A 1QZXA 3I6MA 3KB8A 1I0LA 5JCZA 3IQHX 1T9HA 2IDKA 4XFKA 5LR6A 4EHHA 1VF6A 4JZ2A 1MXHA 2WA3A 1YXBA 5IKEA 4BZQA 2QTWB 4TLMB 3BEHA 2LRHA 3CEAA 1W7AA 3VDXA 1XDGA 2CDNA 4JBLA 1OMOA 5JNUA 1FS5A 1LDBA 3L0CA 4R8LA 1UT6A 1X8KA 2HQ1A 4YRRA 1BE8A 4DANA 1I24A 4QHYA 5CBGA 1XEXA 2GYVA 4D9JA 2QX6A 5EMHA 3KUUA 4J42A 1VL6A 3DHYA 3W5BA 1LBQA 2AKYA 1GAWA 4Y7DA 2AXTZ 4HAWA 4JT8A 1ZITA 2RKBA 3OEHG 1YUMA 5HX7A 4RIFA 2C77A 2UYHA 5KOHB 1ZG3A 1PEYA 4MV5A 1HKHA 2N1BA 3AERA 4XYGA 3AU8A 2BOCC 1U8EA 2JLWA 1Z63A 1BDIA 3P3PA 4B3FX 2B69A 2P5YA 4G65A 1PO7A 1SUWA 4DR3B 5H82A 1RQ7A 3GHZA 4DMLA 4LGCA 1OX5A 1NBHA 4BWAA 1NJ6A 3Q72A 5KJCA 5EWMA 1KWGA 3RK4A 3AFGA 4BNHA 3B89A 2D1RA 2IGTA 3U3XA 3D8NA 4AO8A 3X2SA 1NI8A 2BGGA 2ZIXB 3JZIA 2ZB8A 4NNOA 1MC5A 2OYSA 1EMDA 3CCEF 2RGEA 3EMKA 4EL5A 3G23A 3ZCUA 4DMUB 4YJGB 4EPWA 3T94A 2NM0A 2O3QA 3CW9A 2P9ZA 2QPTA 3WYFA 5HRAA 1F0NA 2PS0A 2OCHA 1M6VB 3D0KA 2JBAA 2GCIA 1X42A 1V37A 2O1XA 2B9ZA 3U9SA 5BY2A 4YJ2B 4JHLA 4OPMA 4ENQA 4JUIA 3LHSA 3ED1A 5A9SA 5ALPA 4UFOA 2VF5X 4TQAA 2QK4A 4Z9XA 5AW4A 2C9OA 4QTTB 1V3QE 1I7SB 4RH3A 2GNPA 4K6HA 1JTEA 4J75A 3AIMA 3U4CA 1Z4JA 3HA7A 1SQPH 1QRTA 5IP5A 1Q0TA 2G36A 3QIVA 1GDTA 4IDOA 1XKLA 3MXOA 3B6EA 3G2JA 4KYVA 4Z4EA 3LCMA 1E59A 4GOKA 3M89A 1X7XB 4Q4AA 4IZIA 2ZI6A 4Q7LA 2P4QA 4X1OA 2V7WA 3A6PC 3E7PA 4PRZA 4NZ9A 4BP9A 2CLDX 1NQOA 5C51B 1UFYA 1SD2A 1WY7A 3CFYA 3CMEF 5CA3A 2VHXA 2WR8A 1S9DA 2PX0A 4XDKA 3VO9A 4XDJA 1Z4NA 1Q82W 3DXZA 2QI2A 5E1MA 1T8WA 3E1YA 5KYGA 4DA7A 5E8RA 4FC6A 5FLYA 2BLLA 2VF8A 5KSZA 3BORA 4IFBA 1HYBA 3NR7A 4Z1MA 3FYEB 5JBQA 3DWFA 2JLQA 2DMRA 4CU2A 3L6UA 4IPTA 4D7TA 4KGZA 4AIIA 1GO3F 4GLOA 2PZEA 4A0QA 1LH0A 3NLLA 4ARIA 3NEPX 2XE7A 2VR1A 1D4FA 2DN9A 5A4JA 3HM9A 1FMCA 3LRTA 1ODFA 2W4IA 2OZKA 2LDXA 3JS5A 3U0BA 2JGMA 3JQGB 2G04A 2YYSA 1XEAA 4XJSA 2DY0A 2B8JA 4D0GA 3M0EA 1CU1A 5IDWA 1EZ1A 2HRYA 3GLGA 2H6LA 2O50A 1A9PA 3D6TB 3DEJA 2H1FA 2ZGVA 3GLQA 1OLUA 1OCRC 2QLTA 4CEIB 1GPDG 4PBTA 4GMKA 1S72V 3F67A 3DLIA 2DFKB 1QZ3A 4RTNA 3UK1A 4R1UA 1U3CA 2E74B 3TIVA 1DWPA 5JDCC 4C4AA 1V8ZA 4FUQA 3H2KA 4F4UA 2FL4A 4RTJA 4OVKA 2ARKA 4N3BA 2AI2A 3TW0A 3Q8LA 4MYUA 2IFTA 3OT4A 2C2AA 3MELA 1BD3A 1Z26A 1EZVH 3ZX5A 3D00A 1E7RA 4KQXA 1UK7A 1M83A 1T35A 2PL5A 5CFPA 2RCNA 1ESNA 2UYPA 2ZZMA 5JAUA 5IYBO 4CMHA 1FE8A 3KQQA 2NP7A 4A8HA 1PN3A 3B77A 2Z1EA 3P2YA 4D80A 3L8DA 4KX3A 3T4ZA 1E1LA 2F8SA 3GCDA 2BSQA 3N0RA 1E0DA 1UKZA 2DH6A 3RYFA 2DBQA 1ZTEA 1ZGAA 2KG7B 2IIBA 1HF3A 3R5JA 1WS6A 1MQAA 3EH2A 2PYLA 5ADWA 3Q8WA 4CDRA 1RPAA 3L7AA 3IB6A 3R0XA 1LD3A 4L8LA 5JQGB 2OGSA 3WLRA 3C8ZA 5JH7A 1LZLA 1U4OA 3Q7IA 4KKXB 5DRYA 3RS4A 3WIEA 3HUDA 5E7MA 3UMBA 4A6PA 2CVQA 2R9RB 2X3UA 4F4FA 4X7RA 4CQMD 2NZ2A 2X6BA 4RD3A 1SVWA 4NQ3A 1JR2A 1QVZA 3PGKA 2V7QG 2RH9B 1QIJA 2PUTA 4AKTA 1AM4D 8GPBA 1K97A 2ZI9A 1J2YA 5GONB 3HKBA 4CMCA 1X92A 1FUKA 1VRWA 3HYSA 5E4JA 1J39A 2YYYA 5FFFA 3M2TA 4JI3B 4NOKA 1RYDA 2GPNA 2W00A 2H1SA 3NOOA 5CAEB 3MLEA 4G36A 1O94C 3N9IA 1F1BA 3H5LA 1OBFO 4E7OA 2X1HA 5AXCA 1U0FA 4OHOA 1H65A 2IU3A 5D1NA 3F2VA 2JIZD 4L8FA 4NBVA 2CXRA 2HQSA 1ESCA 3DEIA 2ZXWC 5JWPA 1YA8A 3DBHB 4EF5A 3OOEA 1AKEA 3MJEA 1A7KA 1Q0HA 3CEHA 1LPNA 1D3AA 1IPAA 1Q6UA 3AHCA 3CXUA 1TM2A 1PF5A 3F9RA 3HKEB 5JH7F 3ASYA 1W0JD 3MJFA 3JSLA 2CLIB 3D3KA 1ICEA 4K6FA 4IYJA 4ZICA 4HI0E 4DCJA 4EFDA 4DZTA 5JS8A 1KL7A 3Q3HA 3CG4A 3UQZA 3M8KA 4F85A 1JA9A 3RFRA 2PFGA 4PRYA 3DSRA 1W48A 1RWVA 2QUAA 3TW8A 4EHBA 2DUNA 2QNBA 2WTXA 2BTQB 1OB2A 1OWPA 4S0ZA 3CD6F 2L6LA 3QNMA 2DYYA 1MX5A 2CZQA 4NFSA 5E1OA 3F7YC 1B42A 5LJIA 1P7WA 1DC7A 2H4FA 3AJAA 4EQZA 2ZRHA 2EYUA 4BO0A 2EIJB 1VQ8V 4L28A 4M1KA 4HYOA 1AGXA 1XU7A 1EIWA 5CGZA 2FW9A 4NPAA 3Q5DA 3FF1A 4JT4A 1DAEA 2FSFA 3UW3A 4FVMA 4B5LA 1U2GC 1WB7A 3DA8A 3UMMA 1CUEA 1ZWZA 4PGHA 1KI1A 1GNQA 5HRUA 3E7FA 1G8PA 3NUZA 3S44A 5JCOC 1PVVA 4KQCA 1RJ9A 4DCGA 2MW2B 5AKYA 5B57C 2BOBC 3RK0A 1FLDA 3CO5A 1K5PA 2JI4A 1E5XA 2LPMA 3LL4A 1ZCBA 2NW6A 1PL6A 5JYCA 3OJLA 3T3PB 4AY4A 4PLPA 4DHEA 4KV7A 1SD5A 5KA6A 3OEEG 5JSZB 4PSAA 1U81A 1UP4A 3IPLA 2C7OA 1RC8A 2HF9A 1Q1NA 2SICE 5ESRA 1QIKA 4E6PA 3JSXA 2XUAA 4R3NA 1ZONA 1OKKA 1WNSA 1V7CA 3V9PA 4NU5A 1OFHA 2FC3A 3KZXA 3PICA 2OOKA 4UCFA 3VAYA 3AR8A 1EBFA 2I4MA 1E1QA 1ZR2A 1OGJA 3PXEA 5KAMA 1AKYA 2FLVA 3FD9A 5GP1A 1DEOA 2YWBA 5K0LA 3GEGA 2IYTA 3HU3A 2HSJA 4NJEB 2P9JA 2B2NA 2CEAA 3OOSA 5A1JA 1MJHA 3G5AA 4XRRA 2YIDA 4ESOA 1NRIA 1UQTA 4X61A 4D99A 4MQFB 3VYTB 4WBNB 3N2IA 2WD7A 2YWDA 5B37A 4GDFA 1ICIA 4J1TA 5CM8B 3HY4A 5IM5A 3UWDA 3T7EA 2F9LA 1SELA 2RHDA 3I2GA 4PQYA 5JAIA 2QZ9A 3PFNA 1LRJA 5FHRA 2QRPA 4PO9A 3S2EA 4AULA 1HFWA 2FR8C 4QAJA 3OTOB 3MMZA 2VDRB 1PXWA 3INYA 3H1LH 1FFHA 3A0RB 4LF7O 5TRTA 3HXPA 2N75A 2FZ4A 2WHPA 3I01M 3FGPA 1FPOA 4IDAA 3NPAA 2W2VA 2C88A 4TMKA 4IL6Z 4GIBA 2VCEA 1HDYA 1WEHA 3VTZA 1T5OA 3PNSA 4V3CA 1F5SA 3ZU5A 4Z1OA 3B7WA 2GJ8A 4J0JA 4MPDA 1WBBA 4NBKA 1NAHA 1TQ6A 1ZGJA 1G64A 4FYYA 1HM5A 5TB5A 4DV3B 5IJWA 3QU5A 4G1UC 4WIAA 4X1IA 2WYVA 2JGEA 4XE5A 3TD6A 2CZCA 2CBZA 2ZRFA 4NXMB 3F5TA 4CG3A 5JVDA 1I2ZA 2D5CA 4QTYA 2PBFA 4PNZA 1CJBA 3AWIA 4FB4A 1IBLO 4YRCA 5DLPA 2ZYRA 4IFTA 3TX6A 1PFWA 2BFBA 5JMTA 4C30A 2PXAA 2AMYA 1NV9A 5DNYB 4A6EA 4MVJD 1SC6A 4W4LA 2VF7A 4O3FA 3I39X 2ALEA 3HLTA 4JUBA 3CBGA 3D5TA 4R9NA 1QMPA 1T5SA 1EFRD 2J67A 2JVKA 2MK3A 1N6IA 2RC6A 3NEAA 2VK2A 2GD2A 2YKGA 2OV4A 3QFCA 3MG9A 3HC7A 2H11A 1GPWB 1Q0LA 4ZIRB 3OPQA 4X88A 3WJ7A 4FNMA 3CPWF 3AW9A 4QNMA 3ZGNA 4KO1S 1B3QA 5AD1A 3WB1A 3JYLA 4JLMA 3F7TA 1Y66A 4WAUA 1WE2A 1QYXA 2QMHA 1N34B 4RQTA 4PYKA 1A7UA 4XBFA 1SIWA 2IIPA 1LU9A 3LGSA 1MAHA 2ZCEA 2A8YA 4JJ8A 5IFLA 3L82B 4QKQA 4RPLA 3CG6A 6NULA 2O8DA 4WECA 1NQAO 1QORA 2GK6A 2B61A 1OXMA 1PJTA 4ZCTA 2OV8A 5JVDF 4R2JA 1SXQA 4MB0A 3R6DA 3HBAA 3PTAA 2D54A 1M0WA 4DV7B 2IPOA 1BAPA 2JFZA 3LRPA 3QO5A 4R83A 3GNTA 4F2GA 4JASA 2Z57A 1Y8QA 5JASA 1FXKB 3PQ8A 2Q2OA 1WMSA 5F5LA 4U7TB 3AEQA 3VGJA 3QKSB 2ZWIA 2R9VA 5KJ1A 2F3SA 1W2BF 3IUEA 4ZRMA 2IXEA 3GLFB 4Y0NA 1Q0UA 2RHBA 2P9TA 1U9CA 1XA3A 4I08A 1DL5A 1JFFA 4EBFA 3JASB 2FP3A 1NXXA 1UWCA 1RVV1 4QG3A 4BZWA 2IF0A 2H3HA 4LC0A 3LIPA 1MX9A 1XRJA 1VJ0A 2RI6A 3DS8A 3F6CA 1IQUA 1K98A 2EKDA 1CIVA 5J4HA 3KAJA 1H7MA 2E85A 4LY0A 2IH2A 3EHDA 5DBGA 3CNQS 5BORA 3F6BX 3K8QA 1N0IA 3KT8A 3HRIA 4R1MA 1YBVA 3B1VA 3A1TA 1R8YA 1TZJA 1H2LA 4NMXB 4NAVA 3FN4A 1P4JA 2Q3DA 2WEKA 3KBOA 1AGRA 4PA3A 3IPRA 5H6RA 5F2EA 3NETA 5KHGA 4K6KA 2CWJA 4P3XA 3RVSA 1QKIA 3DVQX 5LQKA 5BSEA 1DU4A 3P9RA 4BQPA 4E5KA 4NWOB 2X0KA 5JRJA 3M6WA 3KZMA 4Q34A 3BHJA 3W5VA 2LUOA 1DG1G 2R1ZA 1B43A 1DC3A 4F3RA 4MW3A 2AQIA 3FDZB 4YLEA 1KBQA 1UZNA 2QZPA 1QR2A 2AZMA 3RAPR 2AXEA 3NJ8A 1P1IA 4I4LA 2J33A 4AMBA 2UYOA 3Q87B 4O4LA 1XAHA 3D8HA 2Y0PA 5KDDA 1NGSA 4NI5A 2ZREA 3K9GA 5GY7A 3LC2O 3X2FA 3GVIA 3I3FA 4YBRA 3E58A 1CDZA 1BL8A 4MDHA 3ERNA 1T8YA 4EYGA 1G5RA 5FI0B 3PGLA 1BSMA 2X14A 4NTYA 3H7IA 1EX7A 4YP6A 5HCUA 2Z83A 3QXGA 4WLUA 1EFAA 3VQXA 1JJBA 3DC7A 3WNZA 4M87A 1U63A 3WQSB 1LK0A 4MQ5A 3WLLA 2OR3A 4DUYO 1P5FA 2CEKA 4HP8A 1MXFA 5JZ9A 1W94A 3C9UA 1AU9A 5EG5A 4ZPXA 1V8FA 2FQXA 4NR1A 1FMJA 4C4YA 5G40A 3CCJF 2FWRA 2YS8A 1OLOA 1R0WA 4JUAA 4EGFA 4D4LA 4QGPA 2QM4A 5FWDA 1L7DA 5LA6B 3KR0A 5AKKA 3OTIA 1OV4A 1SOUA 1GZ4A 4LOJA 4Q9AA 3EYWA 1NY5A 3GVCA 3Q9UA 4N5NA 2XR1A 1JQBA 2Q67A 5LHIA 4TTPA 4LBZA 1BMFG 1C9JA 4O4LF 2VZ9A 4F9EA 2JFWA 1BQ0A 2ES4A 3ZWPA 5FH9A 1NXOA 3QYAA 3TQHA 1VMAA 1YE3A 3R5TA 3UG6A 1TM1E 1ECFA 5CT4A 5GAJA 4RDXA 4N1AA 3HCWA 4OHWA 2R44A 1HK7A 4E14A 1Z39A 2ZBPA 4NTWA 2LCIA 3ESBA 2ARHA 2Z3YA 2JB9A 3FMOB 1IU9A 5I4CA 2BWJA 3WGQA 2AE2A 2UZHA 1FSSA 4DUZB 4XEUA 2ZPUA 2EKQA 4WNCA 4KU4A 1K6XA 3BILA 5DTJA 1UOQA 1IOWA 2ODAA 2OHWA 2DFVA 2IHNA 3DKRA 4M9ZA 2WD8A 4C05A 4O2AB 1SBTA 3UW1A 3OUZA 2IKQA 1P1CA 5AUQA 5A2QA 4TTQA 4JMLA 1PT9A 4FPPA 1LDMA 4DZRA 1PDOA 4TS4A 1QHGA 4Q16A 4G4JA 4HGOA 1NM5C 2EKPA 2A14A 2ZJ2A 3TLYA 4KXUA 2J0EA 1T10A 1IUNA 4C29A 5K3BA 3WL5A 3G8CA 2D7CA 3W4KA 4KCGA 4BE4A 4LHEA 4KPGA 5CX1B 5CVDA 1YR6A 4PSUA 1BDJA 4QBGB 4IIEA 5T4HA 2G1KA 4X64O 3OSUA 4U7NA 4KN9S 3MCQA 1GZSA 3EG9A 1KIFA 1J5XA 1PL7A 1NMYA 3NVMB 2Z8ZA 1B4DA 3KYJB 1P9WA 5FI3A 2R60A 4OQQA 3VYUC 1F2TA 3E5NA 1PEKE 5F2KA 2OO7A 3SX2A 1UMDA 3F7VC 2VJLA 3AETB 5LUBA 2FJPA 4G5FA 3IR6A 4KQFA 5FWYB 5JNVA 1ZHOA 1SM4A 3DFKA 4YXWG 2JANA 3K6SB 4NYMQ 3CIOA 1W96A 4DEVA 1I5XA 3FLMA 5A0TA 3ZJTA 3HV2A 4NQZA 2BSKB 5EQJB 2C31A 5G02A 4M88A 3T3MB 4PYRA 1ZD4A 4IGKA 1SIUA 3WAGA 3FUCA 2CMDA 4J2TA 2IOFK 3F1KA 3KV1A 2AMLA 5KU7A 4EY5A 1XUOA 4DBLE 5LD2C 5CLJA 1F2UB 4ZXPA 4E11A 3O03A 3LYHA 5EMLA 4EELA 4CH4A 5IT9N 5T3YA 1GM9A 3W79A 3UO2A 3GVHA 4N82A 3E3OA 3EYAA 4ZHVA 1ECGA 2BEUA 4W9NA 1KDPA 4I14A 3MD9A 4DJDC 1ADBA 5I7OA 4WLOA 5HJEA 2XNDA 2IM9A 4QAQA 2G4CA 4TV8B 3W7AA 3I55F 5AVQA 1O08A 1NLYA 3CYFA 4KMRA 3L9DA 3DEKA 1C1YA 3R7WA 2FPGA 5B2FA 2AE1A 2O2JA 2PD3A 3V46A 1IDSA 2R1TA 5T4EA 4BGEA 1OBCA 1L7OA 4JEMA 3FCOA 1NUTA 2Z58A 5A3RA 1XD9A 5FWNA 1JG1A 1T5LA 5DHRA 1O58A 1LK7A 2R00C 1R0BA 1WZ2A 3EVFA 1XROA 5F4BA 3I4LA 4ZOAA 1CR6A 4GGOA 1JKXA 5HILA 1LJUA 2XE4A 3T7IA 3T9EA 1A2KC 4GZ6A 5K3DA 4KVFA 1ZI8A 4KRYA 1KOFA 2QT1A 3QELA 1MQSA 1QHIA 3G9QA 3D8SA 1U7XA 4GMXA 5K99A 4QE3A 3L8HA 1FNKA 1MZEA 1TO6A 4WA7A 1ISJA 3IR9A 1TZKA 2Q4BA 3F5WC 4MKXA 1XU4A 1ZINA 1SEVA 2JDID 1U0LA 4MVCA 4KE7A 2C03A 2CK3D 1Z45A 1WVGA 3ZGYA 2NAPA 2AT1A 1QGED 4D6YA 3MWEA 1S4MA 5K8VA 4Q3CA 1YONA 4MP3A 3ONDA 3QXJA 1YRQA 3J7AU 2FR0A 3DDWA 2O20A 1I7LA 3L74H 4PJ0Z 4NMLA 1XBLA 5AIAA 4JJAA 4YRIA 2CL5A 4PNEA 2M9MA 4RHXA 2PO5A 3KL4A 621PA 4DQLA 3UF0A 3KOWA 4HAYA 4ZKIA 3E15A 3FWNA 1VP3A 4N21A 1GPLA 4NK5A 4FEEA 3BD8A 3PGVA 3GUUA 5AP9A 4RPKA 5IK2D 2CT8A 1VH8A 2ZUSA 2QPLA 3O8QA 4FLZA 1CQPA 4JI1B 3IHWA 1PZGA 4X7MA 1IXSB 3R0ZA 1MFZA 4G9BA 3ZJ4A 1BXGB 1YB2A 5IZ4A 3ZV7A 4F1KA 3GXOA 1LCIA 5LZ4A 5DASA 1B3BA 3C98A 3LNCA 4QQ8A 4HSEA 5JISA 3SZLA 1ML3A 2Z6UA 3TNJA 2FP4A 4ZIBA 2HCJB 4RY8A 3T99A 2AQ8A 3D7RA 1DQPA 3LBIA 1JDSA 1Z6GA 3V8EA 3FM9A 1C5KA 2FCAA 3A9UA 1VQ7F 4MTCA 5I9BA 2HA6A 4ERNA 2PFKA 1MEJA 1G8KA 1OE0A 3LHDA 3QX7A 4OH1A 4A2QA 3NPMA 4DR6O 4RSRA 4CS3A 1VPTA 1ONOA 1DEHA 3RRYA 2VPYA 2CW4A 1VQ9F 4WPGA 4GUAA 4UXJA 3NYQA 2BFDA 2WUWE 2J0VA 3T4XA 3KCXA 2AC4A 2JAHA 3S2IA 1OTHA 4UFZA 3ZI0A 3LQQA 2ZUTA 1H1LB 2DT8A 2HRCA 5IFKA 1W76A 4PZEA 3EJWA 4QGFA 2CDBA 2FFHA 1PSZA 2QMQA 3IQWA 2MMGA 4R8VA 5T57A 1OYVA 5EHIA 1TI7A 1Q90D 1KSJA 1S0UA 4RWEA 2WOOA 1F4NA 3ZVLA 3PXAA 4MT8A 3QVWA 1Z4QA 3PEFA 5AJZA 4RHAA 2FUEA 2CF6A 2GSWA 1Q86W 4TL8A 3SVZA 5BW8A 5FOQA 4RZUA 2AJBA 2VJPA 5KNLA 2ZR3A 4LV8B 3TINA 5LMCA 2V4UA 1KD1W 4W8OA 3OZCA 4C0SA 1LW6E 3PZRA 2EOAA 1K5HA 5HP7A 5AVUA 5H02A 3GFQA 3CXHF 1SU4A 1RJDA 2OAQ1 3A9CA 2R7AA 1IN8A 3M5CA 1IBMO 4OBWA 3V4SA 2GJAA 3E9EA 4JL8A 3DSQA 4YCNA 2RKWA 4EI7A 5G3YA 3H2BA 3GOHA 4B7CA 1URPA 2PQ0A 4KFRA 5F3WB 5AXDA 4YQZA 3HPLC 1H2EA 3N0XA 4HEA1 4B3XA 3C48A 4J0CA 4N0MA 3GPLA 2AFIE 3FXAA 3BE5A 3TLKA 2XYHA 1SUPA 2Q07A 3EQ9A 1M54A 1YE8A 1COWG 2DCMA 3KYCB 3HBNA 1V1RA 2WMDA 4LOIA 1MB2A 1O5OA 3UMRA 4EATA 5BW4A 3PUZA 4RA9A 4K35A 4G28B 2RHMA 2ECQA 1ONNA 5ALSA 2FX2A 3RLFA 3C14C 2GBLA 4DIBA 2PFSA 2X4GA 2YWEA 1U9IA 4CGYA 1XMOO 1D0IA 1FP4A 3AR7A 2G1JA 4X3CA 3PC6A 3DVRX 4WY2A 5K01A 3DJFA 3QWAA 2QUHA 1G5IA 2FUG6 1KOLA 1XHFA 3RC1A 7MDHA 4J2HA 3RANA 1SZCA 1RHUA 5DE3A 1O97C 1Z36A 1N9GB 3TQQA 1PDVA 5J5AA 5ED4A 2ZS9A 2IHZA 5M29A 4AN4A 2RG1A 4AS1A 1AKQA 4E03A 5E9JA 2ZXEA 2DKFA 3LHKA 1JYEA 2BJVA 3JVDA 2E4YA 2HRUA 1KZ4A 1QBGA 5CK5A 2P4UA 1JLLB 2Z5LA 4E2FA 3DF7A 1H8EA 2GPBA 3DVLA 3Q6IA 4N7BA 3LSTA 5FRDA 4QU8A 1GPNA 3CN9A 1IDOA 1KI6B 5EA2A 3ADOA 7REQA 2F00A 2ZTVA 2A3NA 4XWYA 2XUFA 3MGGA 3NWEA 1JWAB 2BJHA 1X1AA 1ADFA 1R88A 6ABPA 2EGUA 2Q6OA 1EHYA 4MUFA 2W4MA 4YHHO 1BMQA 4QOSA 4D3ZA 3OAAD 5KQPA 2B34A 1FVFA 1E79A 1Y80A 2WSSA 1GITA 2O8NA 4I5IA 1SHLA 4QDUA 4O0MA 4XYEA 4ERXA 5FXMA 1QR8A 1E3DA 1QO0A 3MCUA 4B4DA 1ULSA 3CUTA 4ZHQA 3OO1A 4G0WA 1O54A 2Q3CA 2Z30A 4K03A 4ZU6X 4YDHB 2DF8A 4G4YA 4AMYA 5ALKA 2H54A 2WE8A 3A04A 2GPTA 4JK3A 4Q48A 1BRMA 1HI9A 3RUIA 2QE7A 2AYYA 2XTMA 3VKHA 4Y7CA 1CY2A 2OFFA 4D3FA 3L0BA 2GLZA 3ZHCA 1U3PA 4PF1A 1ULUA 3OIYA 6REQA 1U9ZA 2NSYA 3KU4A 2XVAA 4M3NA 1N32B 4NDZA 1YD7A 4CW7A 2QZZA 3P96A 3T5DA 1R27A 3U56A 4C78A 2HF2A 5KSOA 1X8JA 4DG9A 5LBTA 1TPYA 3CC2V 2FF5A 2VYVA 1XZFA 4Y6PA 2BIFA 3FPLA 3HE3A 3C1TA 1H5NA 4Q9KA 3V4VB 2C2YA 5FNVB 3R5KA 4Y1GA 5EWLA 2PCLA 5B1BC 2JNBA 2XXAA 4EGCB 3RVLA 3H97A 3JY6A 3ABKB 3EVDA 1DKQA 1YULA 1UDWA 4CG0A 3FTEA 1P9NA 5DHUA 5IULC 1PF7E 2IYXA 4XQ9A 3ZOPA 1NZJA 2VRBA 2IP1A 3A10A 1P1RA 3VOAA 4ZHQF 3PD0A 2UYYA 1RD4A 3IPYA 2HIAA 1RQPA 1JAXA 1QH9A 2O8BA 3PNQA 4P35A 1V11B 2HSDA 1XX6A 2W0SA 4COKA 3IAS6 1XN4A 4FP9A 5U4QA 4Y2PA 4CI0B 3ROXA 4BT3A 1E9BA 4BMNA 3I8OA 1IV2A 1I2BA 3EA5A 3IYLW 1GO0A 1GVHA 2RJ3A 4Y1FA 1USWA 1GSIA 2HYIC 3QBVA 4S2UA 3FRJA 4QUAA 1RPZA 3CE2A 3DC6A 1KDRA 1WAMA 2OTJV 4LJYA 2ZS8A 2Q8PA 4XQEA 3NV9A 3DEHA 4WZAA 3C6MA 5BR4A 1YR9A 1J5EB 4KO4S 4MQEB 3EEIA 4W4KA 2Z1TA 4FGLA 4YRKA 1AX9A 4YCCA 5CVTA 4FN5A 4DV2B 2O2GA 2VUHB 4LZLA 4D9GA 4KITB 1U65A 3ZE0B 5AVKA 1LY1A 4ZWNA 3RKRA 2YXNA 3O8OA 5LP6A 1F06A 4LI3X 4G5SA 1KEEB 1O8CA 4U2CA 4G8DA 2Q9UA 4DM4A 1TL7C 3QXCA 1WDMA 4FYJA 2X13A 3DEFA 2H00A 3OA2A 3I23A 3M7MX 4FMTA 3DO5A 3RF6A 1OAPA 3CCRV 5DDIP 1ZC3A 5CITA 1Z4OA 4QTUB 3RPEA 1SOAA 4BBAA 3KJEA 1DXQA 5JSUA 1ZRMA 3BIFA 4C5CA 4AI6A 5AHKA 2WF7A 5TQ2B 1Z37A 1ZHHA 2D2IA 3H1TA 4RDIA 3B8HA 4DK0A 3PIRA 2D4AA 3H2ZA 1E0SA 4BBZA 3QVTA 4PZCA 2YY7A 5IARA 1P7BA 2FFQA 3AGQA 4RPIA 1IY9A 1SVOA 1VEWA 2P5UA 1ISFA 3C85A 4BLVA 1M75A 2O1EA 4TVOA 4J9UE 1AQ6A 1WXEA 4I5EA 5DYWA 3VYVA 1H23A 5B5EZ 4UCUA 2IYEA 2FSPA 4D1YA 2IH5A 1E63A 3MAQA 2QAGC 3COSA 2DERA 2E75B 5J4YA 3VR2D 5GADl 1ZBDA 2V8OA 4ZMSA 3HB1A 3KQTA 5CMLA 3VYWA 2CHSA 5LP6F 3WYAA 1E89A 3RRXA 2OORC 3EX7C 2HP0A 1KP9A 5K3CA 3QWHA 2ONZA 3G79A 5AVWA 2H2IA 1UBNA 3M6LA 4PTYA 4FCWA 3I5UA 1FA9A 3MWDA 2AKEA 4AS2A 2VHVA 3CG0A 1T4DA 2Z6QA 3JALB 1KEPA 4U6SA 1RYYA 4Z4QA 4EB6B 4ZDWA 5ENVA 5I3ZA 3MJRA 5HS4A 3SF8B 4IIVA 3U0ZA 1JFTA 3WLJA 4DRXB 5K4AA 2RB5A 4QM6A 3FVTA 3G02A 3JAKB 3RVYA 1XC7A 1AKNA 1W25A 4HG2A 1J6UA 1Z2CA 4LJ4A 4JB3A 4TWZA 5F78A 3JQ6A 3WLMA 4PG5A 2HWWA 3H9QA 5CG2A 3O38A 4FW8A 1A9TA 4LJSA 1T5BA 1SVIA 4KOEC 3O4GA 2W8BA 5IAAA 4J7XA 4BDSA 2XWSA 1W5BA 3NWOA 4N3AA 2Z6VA 3N6RA 4J0FA 3UMVA 2A9HA 3W9YA 3HXMA 4HGZA 1B8PA 2J30A 1WTAA 3SJQC 1JIXA 2H2HA 4EG6A 4M1OA 2N9UA 4F5ZA 4YT8A 2AJTA 4MCIA 2XT0A 3IEVA 3DHVA 2CW5A 2ODNA 3KCYA 2ZEJA 7AT1A 4J4TA 2K2QB 5H3HA 3D36A 2RGGA 2FETA 1RWWA 3NAGA 8AT1A 4I5DA 5EKUA 2ZE6A 2PDAA 1ACJA 4G1MB 1IFXA 13PKA 1E9CA 2ONYA 4BCBA 2L42A 5CT6A 3H86A 2AJLI 1YH3A 1FDIA 2ZUCA 4KIGA 3NIFB 2OBXA 3VO1A 5FOXA 1WEKA 2AHYA 4H7IA 1G5PA 4YP1A 4MW5A 1I5EA 2X4IA 1HFJA 2QYOA 5M3BA 1I4OA 2TS1A 4DDTA 4XVCA 4GS5A 5CIWA 3C8LA 4NBWA 3WK4A 1A0OA 3B5IA 4OHYA 1U7PA 4KIFA 1LNSA 4DV1B 2VXYA 3L1KA 5I6DA 3W7BA 4D74A 2VAVA 4XDZA 2ZM6B 4HEA6 4HFMA 2M6RA 5LBUA 2OA0A 5A62A 1NPYA 1PFYA 3N4ZA 1U2SA 5EBMC 2W2PA 5BV7A 3T0GA 5LMUB 1Q50A 1S0VA 2NXEA 3CLRC 1NQ5A 4TQGA 1M5RA 3VYSC 3Q88A 4FFBB 3AUAA 2ZDHA 4MYHA 2ZDIA 2W6JA 4Y9UA 1K5DA 1Y7LA 4Y6QA 1U97A 1ENYA 1NUAA 4BDTA 2Z3VA 1YB1A 2XYRA 1VQPV 1OCCC 1RABA 5D01A 2WLHA 1S3JA 4UBMA 2ZROA 3RAJA 1U9JA 3FVRA 5FPYA 1GX1A 3Q2KA 1V9LA 4Q4CA 1ZYUA 4DMHA 4Z7JA 1CZLA 4AY2A 1ZK4A 2GCNA 2PH7A 1TUEB 4LHVA 2C4KA 3LLCA 2KWIA 1AS2A 2HMVA 5CDSA 2V7BA 2NLOA 2A4KA 2BHTA 2H4HA 4CCYB 2O7RA 4BECA 2N3ZA 1U6KA 2PGGA 4CKEB 4AS3A 4HDCA 5CBPB 1ZJZA 1JMYA 2ORWA 2QP9X 3SOPA 2AOTB 4GZMA 3QIAA 3IEMA 2LR0A 4FZJA 1IRIA 4NHEA 5TGTA 3EGWA 2YHIA 3AF5A 3BCRA 5HUJA 3PDIB 2E2WA 1NDUA 5JZOA 4PGAA 5CEJA 2LFSA 3CZRA 2GZAA 3T61A 2CYAA 4CC5A 1XR3A 3R0VA 3OOJA 2QSYA 1RC1A 4LWZA 3I37X 5GTIZ 4ZOEA 5K6RA 3FWKA 5L4SA 2NO4A 5IPFA 3KJGA 2LGQA 3D7SA 2VAMA 1WMAA 3GH3A 1S5PA 3V97A 2NU9A 2VOJA 4TMYA 3LUCA 1ECPA 5DBIA 3MBMA 1GTOA 3O94A 2C1ZA 4YBZA 4GR5A 2HRDA 1V6AA 3MWGA 2QGZA 2WUEA 3WDMA 3IKEA 1P5RA 1T1GA 3T2MA 4AY5A 4ESVA 1BFKA 3GGGA 4F9TA 3HXQA 4F6EA 1I4EB 2FRDC 2QUKA 3C7DB 3VAAA 4LY6A 3VH2A 3BMOA 3O0DA 5LQMA 4W4TA 3NHWA 4QL3A 2AH5A 1COMA 4BASA 4XDYA 3HR0A 4N41A 4RKYA 1ZIPA 1A2OA 2MSCB 2FSVA 5DMHA 3JAWA 4QPKA 2J5XA 4HLCA 2Y0CA 4E3WA 3WQBA 1RXEA 2F55A 2I6SA 3OD4A 4BNGA 3BE4A 3COVA 4RJJA 3MCAB 3VQTA 5BQFA 1P73A 3G2PA 4KWCA 2B4AA 1TYZA 4JLOA 2WF5A 3VJLA 2R8ZA 2J3HA 3VUEA 2NN4A 2VNHA 2FYUH 2R751 4RF5A 2EINC 3D7LA 2BH2A 4HZGA 3U62A 4G07A 3BCCH 4FUTA 4RXMA 4XVRA 5IJ9B 2IPMA 4W1PA 2MCFA 1G7SA 1E3JA 5C8DA 4OLJA 4OOFA 4DTIA 5HQ3B 4IXWA 1NVTA 4OFBA 3VMFB 4WXMA 1C0PA 1OLXB 1YNSA 2G9VA 2CKMA 2QLMA 2Y1OA 2YIAA 3D7NA 1L4YA 4MHSA 1VJRA 2IVZA 1DKNA 1T9KA 3H16A 4KW7A 1A1VA 1Q6HA 2V7UA 5GJVC 4XM1A 4B6JA 2D4HA 3B70A 1GG9A 2DUWA 5THQA 4XPZA 3ZBTA 1CIPA 2C4MA 1JXOA 1HNWO 4M0EA 2A0LA 2JGRA 3D3WB 1VL1A 4BAZA 4IVQA 3CLSC 4XSHA 3VKVA 4DQ0A 1ROPA 3U37A 2VDPB 3AI2A 3H5RA 3PUYA 3OJWA 2XMSA 1U7OA 3KJXA 1VQOF 1W52X 4Y6GB 3EEYA 3ZHVA 2ZWOA 3UOGA 4QPCA 4FHFA 5DX0A 4RC9A 2ZT7A 4N6OA 4LF4O 4KH0A 3IIKA 4JBHA 1FW6A 2G9QA 3V00A 1Y4SA 3WXMA 3VBBA 4EYQA 3C0KA 3VFDA 2JK1A 4POOA 1Y9JA 1TJNA 4IJ5A 5UKDA 1E2UA 2IZOA 1K4DC 2XKKA 4CF7A 4AJ1A 4QJBA 3RHFA 2F95B 4W5WA 3L6BA 2J59A 1CJTC 5K0GA 3EOZA 1QOPB 1WNTA 3G9ZA 1T8UA 2QVGA 3DVSX 5EIBD 5C1OA 4DB2A 3MTBA 3H1JH 1KWKA 1Y3DE 3CCLF 3NTLA 5I45A 5AW8A 2C2WA 4UCSA 1Q0RA 2QGFA 1GRRA 3HWRA 2XYQA 4DDVA 1Y63A 3P2JA 2P75A 1G8JA 3B1KA 4CM8B 3BE8A 2VHJA 3EXHB 1BA3A 3L0OA 2PBLA 3Q11A 1C9NA 5D5HA 3DZGA 2XJ4A 3QQ5A 3OPYI 1JTFA 3GFPA 4YPOA 1CUDA 4GAEA 4UMEA 5K6AC 1R6TA 1YUBA 2OMKA 3FPHA 3KLBA 1E4YA 2CV0A 4D02A 3JPYA 4J80A 3O75A 2RBEA 1YR8A 3ZDFA 5AM1A 2HF8A 4G67A 1OV6A 1OYWA 5ECGC 1E2FA 4RHCA 1G6Q1 3CNHA 3EIQA 1R3IC 4DR2O 4DVGA 4MX8A 3AKCA 3CNNA 1WWKA 4LXIA 4WZBE 5JJEB 3JAMM 1NUUA 3ZVMA 4H27A 2AFIB 4TV9B 4RNCA 3SDBA 2ZULA 1S9HA 4I4NA 3OQHA 2PIDA 4R5MA 3RTGA 3F0FA 4JOQA 3G8BA 4EZIA 3M4XA 1JFLA 1PR5A 4QBKA 2CHUA 2ZP1A 4KTTE 2B7CA 2GX6A 1T2AA 4HNGA 4YYZA 4KIJA 1G9XA 4GPAA 1XLTC 5DN6A 3AP3A 1MG1A 2CTRA 1O9GA 2IZZA 2Q73A 3IJRA 4KL1A 5GOTA 5HJ7A 1H85A 5JQWA 5E6SB 2EGHA 1Z73A 3BIXA 4UMVA 4I0WB 3O90A 2CGOA 1P31A 1B0ZA 3RFVA 1L5HA 2CLCX 1AUOA 2DW4A 4UJ3A 5KNDA 3UKDA 4JAVC 3DV0A 3EBLA 3RS5A 1J0AA 4JEHA 2R1VA 4HWPA 4O1HA 1NOIA 3D4LA 1KHTA 5FEUA 3KV3O 2PJDA 1CC1S 3EEFA 2ZU0C 1V9PA 1FBNA 3VR3D 4IUYA 4F6RA 2YSUB 2KTUA 4WKBA 1MORA 2ZUWA 1TZMA 3WG7B 4D8YA 2WKPA 2XUKA 1DINA 3ZTWA 4UCTA 3ZD8A 3FZEA 3AHIA 4RL6A 3S7ZA 5B3AA 5J1TB 2C4TA 2Q2QA 5BOSA 3DLBA 3G2MA 1L5GB 2L82A 5AKIA 4CMEA 1NW9B 3GARA 3HVUA 1G6HA 3SKXA 4UAGA 5DM60 3W3AH 3AY6A 5ALEA 5KC8A 1N57A 1JDUA 2NWQA 1ODCA 1Q17A 3B5EA 1JHRA 2DBYA 4XCQA 3DUFA 4PFSA 1SHJA 4P0TA 2W48A 3E5HA 2W2OA 2YXDA 1WMDA 1J0EA 3CF4A 3R5FA 1ENZA 1MO4A 1KR2A 2IYLD 4NP6A 3IQZA 3WLHA 4B74A 5L3VA 4MWBA 3NJ4A 4FSDA 1D09A 3T80A 4NCXA 3LVBA 4RZQA 1EH5A 4XQ0A 1SZTA 4YTEA 2RG7A 3HJAA 4WCFB 1KO5A 1D6NA 2GEJA 4MPTA 3HJBA 4ARUA 3MTIA 3SJCA 1O95D 2O5RA 4OLHA 3A0HZ 1OHHA 4N8SA 3LP8A 3DMTA 3OOWA 3AYXB 5ADHA 2J9XB 2P8JA 1RSOB 2PGXA 2PJRA 2DRIA 4JI4O 5LQSA 3ABTA 3ZLTA 4A82A 2Y2UA 4Y2TA 2IXGA 2ZLBA 2QMZA 1SA0B 2OCLA 3ZMVA 4Z1MG 4LXXA 4IDFA 2OZLB 2XEXA 5ALHA 4LXHA 1C2TA 1C3VA 4BYGA 5A2QM 1CZKA 1FSGA 4DYHA 1SBYA 4C43A 3GCWA 2EXXA 1QIGA 4UTVA 2WTUA 1XL0A 1P75A 1KO7A 3TD2A 3KTOA 2HO4A 1E1CB 1V5FA 4HPWA 4II7A 4BJHB 1O0SA 2JA2A 2V96A 5JNWA 1SBCA 3EQ6A 2BEWB 2IUUA 4P4NA 4KJXA 1UXKA 1QCEA 2Z04A 3WLKX 4NBLA 5DX8A 3PPYA 4IQ8A 4LUCA 3H4VA 3I2HA 4HNUA 3SEZA 1L5NA 3C3PA 2EX4A 2WAMA 1E2EA 1XZGA 4FFWA 3TL2A 5AUNB 1NLFA 4Y6LA 1SRRA 4ASUD 2F1HA 1SAYA 2YMPA 4G4SP 1UIRA 1DKMA 2PH5A 3ANNA 5KYTA 3E22B 2X5JO 4FKZA 5ED0A 1OI2A 4AAYA 2ZANA 1FTSA 2Q4PA 3K32A 4REOA 2VXCA 3AM4A 4UVAA 1J21A 2QN3A 5E3HA 3IH5A 2EFGA 1R3DA 3RTCA 1JG4A 2XYVA 1CETA 4PI2A 1IWBB 5KTPA 4GP9A 5JZVA 1PR1A 3GEMA 3D8RA 1EUDA 1DTWA 3GCXA 1INLA 4ETMA 1QHHB 3IKJA 4MVZA 5CFQA 2M32A 2IHVA 1LQUA 3VNQA 3OFVA 1KJ8A 5LIRA 1YMUA 4NYMR 5D7BA 4ZPJA 1NY6A 5DNAA 3EBPA 3UTCA 1P5HA 4BKPA 2VDLB 3BXHA 2PVPA 3B3QA 2HU2A 1CWUA 2QA4F 3I8SA 3HCNA 2VHEA 2IPNA 2JPDA 2FYTA 4JV5O 2M6SA 2P1RA 3MMNA 4PCVA 4BW5A 1R0LA 4B3CA 5I7RA 1F20A 2H8GA 4C6TB 3AJEA 2Q2VA 3RS2A 3QNEA 3ESXA 5B3SC 3OKFA 4G2TA 3E89A 1SKVA 3CN7A 2ISQA 3V2GA 1TUIA 2YTZA 4QUKA 4J10A 1TIBA 4EEZA 3TBKA 3L01A 2NU8B 3WJRA 1AVMA 3PYLA 3E5MA 3I5DA 4NCHA 5CBHA 1WAZA 1ZOOA 4CFSA 3IEUA 2ORIA 4IOLA 4CQLB 3EAFA 2BMJA 2Y68A 4UNRA 4CV3A 1MBZA 1HDXA 4DV5O 2FU5C 3MT8A 2B37A 4P81A 5AVTA 4GCZA 2FQ1A 4EQ6A 3QXSA 1F8XA 2C2XA 4MVSA 1FDWA 3C3AA 4BVTA 1SC5B 4FFNA 2H2GA 1R74A 5C81A 3RUHA 4WHMA 1U11A 4GOJA 4DEXA 4GLJA 2W6ZA 1JPJA 3Q1KA 1OX4A 2PZ8A 1JNYA 4FLFA 3JYHA 3U5TA 5K0EA 4DCVA 2Y2VA 2BGLA 5CLHA 1HNNA 2JJ2D 4RHUA 1FJXA 4P80A 3P9ZA 2EIMC 3CCMF 1A3CA 4BZZA 2XCIA 2XUMA 1HYHA 4HXGA 4CV1A 3EGIA 1NTRA 5K4GA 1SDSA 2XAUA 5EQDA 1PKXA 3Q41A 4O2BB 1I1QB 2IGBA 4D9HA 1OX6A 2FEAA 3V2IA 3OPMA 1WB8A 3GLIA 1VECA 2UXDB 5I8PA 5IAKA 3KBBA 3OQIB 3AHDA 4E51A 3IMEA 4Z4FA 4K9KA 4REQA 4JJEA 1JHXA 2N48A 4MWOA 3W8RA 5HZKA 3E9QA 5BSFA 16PKA 2CLEB 5FADA 2QD3A 3E83A 3RT9A 1K8YB 1NW3A 1N2SA 1HTWA 3GJQA 4LFCB 4Z3KA 3HADA 4QARA 1OI4A 1FS6A 1BMTA 1L4UA 5DW3A 5FA6A 3K05A 3K0AA 1BFDA 5K3EA 4PZ9A 1NC1A 3GV0A 4BIMA 3K14A 3PD1A 2GA8A 2P9GA 1M2HA 1EVLA 4MS4A 2NOAA 1D6MA 1I7PA 1KAMA 1KIMA 1IPFA 1JVMA 1P84F 2FEWB 1XQWA 3NBXX 2BEKA 3H01A 4C87A 4HGYA 1ZM3A 1SVUA 2QL7A 3WHIA 4CH5A 4MRMA 4JOBA 2Q5EA 4P3NA 1DCKA 2PUBA 3K35A 4MGHA 3WB2A 1M2NA 2GD1O 3EZ7A 4ML3A 5AJXA 3E61A 1E9VA 5FLXN 5FUBA 5CM2Z 2WB4A 2VUUA 4C2AA 2OYRA 1ODEA 3U3OA 5M04A 1E1QG 4HKTA 2QLNA 3EARA 2L17A 2EBOA 5LLDA 2JLYA 1ZMTA 1WDKA 2IYPA 5I4BA 3BRCA 3AOEA 5L9AA 4JB2A 1WCXA 1PJAA 4HWGA 2C4VA 3N86A 5DECA 5D2CA 2P1DA 3D5QA 3CKLA 2GH1A 1OFTA 1TFRA 2ORED 5LWQA 3VJMA 5A02A 1PD0A 3MN1A 2ZUDA 3BK1A 5EL0A 2QR4A 3OMIB 4BNYA 2CCKA 3CNLA 1B1AA 4XDHA 2IJJA 1T4GA 2GM5A 3TRIA 1V54C 3U11A 2J5KA 4TYYA 3U9LA 1PKEA 3MUEA 3CCQF 3WLIA 1JIKA 1GPH1 4WGFA 3BSFA 4BC1A 1DQZA 2VTDA 4UFPA 3C6BA 2W2LD 1A71A 2FWJA 2GBIA 4HDKA 3GLHA 4B3JA 4KR2A 1RPTA 4ER5A 4TLDA 3UT0A 4Q6GA 1EHCA 3RAGA 4BLQA 3T15A 1VIDA 1GQOA 2JFUA 2G0TA 1TYCA 4FINA 2C0PA 3AZQA 2ZB7A 4MKZA 1VKHA 3STZC 1K2VN 1QQ5A 3EY9A 3CINA 5C93A 4UVCA 1JG7A 1N5LA 2YINC 5A3QA 3AL2A 3BSSA 1NFQA 2H5JA 5DOVA 5T41A 3UNXA 5JALA 1QZTA 1Z6YA 3K06A 4XIGS 1JECA 3SYRA 5DB4A 2J0QA 1I5RA 1KU9A 1VA5A 3L5OA 3SHOA 4OHPA 1EK2A 2B6NA 2I5PO 3PXXA 3T06B 1ONSA 2B2XA 1W4BA 4QBHA 4QGGA 2F93B 4UTZA 3OUFA 1ULZA 1E3TA 4UHKA 4TLCA 4X95A 1Q16A 2Y8EA 3N75A 1K7XB 3RA6A 4R6WA 3VSBA 1QU9A 4X54A 2XBMA 5B36A 2BM9A 1TCBA 4DCTA 3FIJA 2BPOA 3MMPA 2APJA 4QUEA 2OM6A 1TJPB 3FKQA 1OU4A 1MB4A 3O2JA 2YS7A 4R7CA 3DONA 2Q6TA 4OXRA 4A0SA 1P1HA 3AI3A 4G4SO 2BYTA 2DHCA 3AVYA 3FFMA 1G7RA 2UZ4A 3JVHA 3PAFA 3FUWA 1A9SA 4CKBB 2N0SA 4MVJI 2FW0A 1Q95A 1RHMA 1Y89A 4F4DA 1HEYA 5BPFA 3W7UA 1P33A 1PJQA 3I5MA 1GLNA 4HSGA 3K5OA 1UM8A 3B2NA 1M6YA 4HQ6A 1RWMA 1KC3A 1QB7A 1VMIA 4X6YA 5JXIA 5ALDA 4TKUA 1D9ZA 5JD5A 2VQDA 4GF5A 4N7MA 1R9NA 3DEYX 3L79A 2P3SA 1JV2B 1NG1A 5K8JB 2A6PA 1PYOA 2JIPA 1P0FA 1NH2B 3JYNA 4OP3A 2VYQA 3WB9A 3AG4C 2NVWA 3FPSA 1XZCA 3FNBA 2UXNA 2D0DA 4JI2O 4EW6A 4U7WA 3RYHA 1ZMOA 4JY7A 5ULLA 4FZ1A 4BFYA 1EA5A 1SQBH 4NTZA 2NU6B 1QCDA 4RA6A 3DHEA 3HMQA 4J16C 4PHGA 2XDAA 4GM0A 2MYNA 4AQ7A 3SJAA 3EJ6A 5E1DA 4I1IA 3ZKWA 3A4IA 2HU5A 2GRAA 4IIXA 3M6MD 3K4QA 1ZL0A 3NBQA 1NXSA 5EI5A 1FTYA 2IQQA 3DZDA 4FDAA 3O83A 4WEOA 4HYQA 2HJFC 5DCVA 4BN5A 2P69A 1ENPA 3UH0A 1JB9A 4WKNA 3ZCSA 2JIZA 5C32A 4LH6A 1NLZA 4L0MA 1O9HA 2ZTUA 3P9YA 1V7PC 4H9GA 2D13A 2IUYA 4XTRA 1ZK0A 1U98A 1CJKC 3AEUA 1Q19A 2PL1A 2P7HA 2YV4A 3DE2X 3DAHA 3FYUC 1JSRA 4DBZA 1YKGA 3NCHA 5C18A 2QLJA 2V0GA 4F11A 4CC6A 1W0JA 4IG4A 2NO7A 2Q5OA 3PK0A 5DGHA 3OCUA 1CLEA 4BNNA 4J9YB 2HOQA 3V4LA 5J9FA 2YCLA 5C3MA 1KK2A 3QXXA 3O8RA 1A27A 1E3MA 2V9YA 1QLJA 5KKNB 1FP6A 3VKWA 4IZOA 2Q5IA 4DIMA 1WU7A 4GXRA 1AHHA 3P9PA 1XHZA 2E49A 3QU9A 3LMKA 3CJHA 5LU9A 5CIYA 3C3DA 1KMCA 1NVKA 3AG3C 4MI9A 4UUBA 2WNIA 3AZPA 3ICOA 2RH5A 5LYYA 5EGSA 2BI4A 1GPMA 1KC8W 3C6YA 1ISIA 2A06H 1BN7A 3ZHYA 2WQZA 1E6KA 3HUTA 3ZE2B 5TMEA 3P5SA 4WZZA 1QGYA 1JH9A 1BA2A 3CCVV 3O8CA 1NJ2A 3N53A 1R6VA 4FGJA 2IELA 3ME5A 1K89A 3VQYA 4DCPA 1XCLA 1M7GA 4FMCB 2UZIR 4ED9A 4UOQA 3KAKA 4B3TB 4JGBA 3IBYA 4IZHA 1U2RA 1X15A 4WFJA 1T2FA 1V16A 4A1OA 1N0NA 1Y8CA 4DOMA 4N3NA 1I1HA 2WG0A 4RK1A 2QD2A 1ABBA 2QKYA 1IIBA 2ZPAA 1C1XA 1DPGA 5JD6A 2BRUA 4MMXB 2HLPA 4B83A 4RKEA 4HX5A 3INNA 3C3WA 2YV2A 3HP7A 3HJRA 1F14A 1W19A 3C9TA 4E2YA 3F6RA 1W9MA 3L1VA 3W78A 4X6UA 3WL4A 4OA8A 2ATKC 1E66A 3QHPA 2ABWA 1WB6A 5E8JA 1VQ4F 1S77D 1JR3D 2RAVA 3B6JA 2H4WA 3LDEA 1MC8A 4K9LA 4XOIA 1MD9A 3UANA 5ALLA 2E4WA 5C1IA 4HXEB 1H93A 3NNDA 4OYHA 3E3LA 1UPGA 3N8DA 2F43G 1M34A 4KPYA 5FJIA 5IMSA 2VQ6A 4F06A 4C5BA 1UPFA 4KK4A 4U7OA 5ITZB 2C4WA 3M33A 2XZDA 2NXWA 2HMAA 4RH1A 2GMWA 2ZM5A 2QTAA 3ZGZA 3KEMA 5JWOA 4R0NA 2WTMA 2Y9PB 1G0NA 2GLTA 4RVFA 3WV4A 3I1JA 2I2BA 2O3UA 4U2BA 4F1JA 2H3EA 3KSDO 1R8SA 2CMGA 4LDQA 2QRQA 2FMIA 3UA3A 3OCVA 4FLMA 3LOPA 1UBFA 1KZ9A 5LQCA 1Q21A 1OFUX 3JQPA 1WXWA 4DPKA 3KG2A 2HN9A 4UE2A 1SUAA 3I83A 5EMMA 1P2FA 4J0EA 2X4DA 1ZLZA 4X3LA 2AUTA 2IYZA 1E1RA 2VH2A 2HK9A 1ZEJA 5JJCA 5EIAA 4FEAA 1QIMA 4L4ZA 1B6RA 2OUIA 4LDRA 1KA9H 1OY1A 4ZOBA 3V7EA 3DOOA 2EU8A 2QJTA 2EG9A 5H6QA 3QEOA 3N6VA 4YJDA 1R4MB 1C3XA 3D8BA 2NO1A 3ZGOA 2ZVJA 3ROPA 1V4BA 4MHOA 2V97A 3WL6A 4N9WA 4E08A 2P40A 5F76A 1JAIA 3OTGA 3ERCA 3SS7X 2PKQP 2JS7A 5JMPA 3P4YA 4ZYYA 4AZ0B 4UZSA 4RAIA 2RGUA 4EY6A 1V4VA 1U1FA 5EP4A 1C0IA 3GYGA 5LMZA 2CMHA 5HQTA 1HFEL 4FFRA 2ITDC 2IPXA 3CZQA 5IXSA 3HCRA 3VMMA 2WWIA 2IV7A 3CC7F 1ZY2A 2BC9A 1GNLA 1EFRA 4D9FA 1S96A 3K0CC 1YGPA 3OIGA 4WT7A 4MV8A 3BWYA 1PK9A 4I50B 1D4AA 1JFVA 4P93A 3B3AA 1L3CA 1M8JA 3VO8A 3OZSA 1KJNA 4IXMA 2RARA 1YZQA 3UPTA 2HD4A 2C59A 1FFEA 4WE3A 4N8EA 1KI4A 2SCUA 5EXSA 4JC4A 2V9CA 4MWDA 5JY6A 1P29A 4BJ1A 3ZJYA 4RTOA 3UYKA 4R6ZA 1DPFA 2GUGA 5HKLA 4CFZA 5ESWA 1UBMS 4YREA 4ZAWA 4KODA 2QVCA 4OI1A 2JGIA 1EG7A 3UT5A 3UJPA 1HOTA 2AHRA 2NV0A 3Q7EA 2B7LA 4KAFA 1XYVA 2XUPA 4XVQA 4L02A 5BUCA 4PG7A 3AF3A 2XNDG 4R9RA 2Q4EA 2AF4C 1CQIB 4GC5A 5DGTA 5CHEA 4O59O 4HPXB 3QY0A 5EBLC 2R1UA 4LVCA 1RTKA 5EE3A 3QVUA 2PO7A 3OBBA 5IBQA 1N5JA 4LF5B 2UUBB 1YJNV 4Z53A 2BR4A 5IWAB 5LL6Y 4CETA 3PC4A 3C6XA 1CPYA 4A8JA 2XMGA 2XUDA 2GCOB 3ABZA 3SYKA 2HJHA 2PR7A 3D6UA 3MTEA 2H8KA 3NORA 1WCIA 2YIMA 1VL5A 3ETCA 4WTOA 1EJ2A 5JROA 4KLRA 4XVHA 3PIDA 3ELWA 2D06A 3F0EA 2I4LA 3S2SA 5A4FS 4UAVA 4B6OA 4FSHA 1EGQA 1L0LH 4OYLA 2XQVA 3NHYA 3DCIA 4UFNA 3FZNA 1H2BA 2CE4A 4FMBB 2P9QA 1G21A 2I65A 5CVJA 1GKKA 4ZK7A 3A6FA 4DDMA 5T5QA 5DLDA 2DEUA 1UJ5A 3U49A 4MDFA 1NHWA 2HPZA 1WHSB 4K2HA 5FFNA 4COOA 3IBSA 1P7ZA 2YV1A 4MV6A 3MW8A 3ZMZA 2YV3A 5L3QA 1UJMA 5CP8A 1KAEA 1QF6A 2X0JA 5K6TA 4Z49A 2P6PA 3BQ9A 4GX5A 2ODTX 3G17A 1A9XB 2PRJA 1OXKB 2FH5B 3GPCA 3JVVA 1G16A 1M74A 3QYFA 1FXSA 3SR2C 4BB0A 1H2RS 3HYRA 2JARA 2RI1A 1A04A 4E0BA 1L4NA 3P9CA 3EH1A 1KZGB 1GO1A 3KP1A 1A4IA 1X1CA 2ZZKA 1RNLA 5E9AA 2UZAA 2F3PA 3MJTA 1T8RA 3INTA 1JKJA 4ZO7A 1JKFA 2EARA 2RH8A 4NTXA 4YJFA 2H1WA 5I7SA 3K0KA 4RQAA 4O4IB 4KGXA 4RIEA 3L07A 5DTEA 2VTBA 5I9LA 3VR0A 4LYDA 4YEDA 4Z3DA 2WSLA 1A76A 4RJIA 3RVDA 5JAHA 2QX4A 2J32A 3K5IA 1V5IA 5EQFA 1RLGA 4NU0A 4QYIB 2P2YA 1GGNA 4QBTA 2F17A 2F1JA 1D5WA 4DJFC 1R0RE 3X2QB 4ZCLA 3PVCA 3BD6A 3IPXA 1FXHA 2V6GA 2FPXA 5J2UA 3AIIA 4GC9A 3SAJA 2WBLC 2GOYA 3QF4A 1XILA 2FUNB 4WOJA 1N25A 1EFPA 4NKRA 5BZBA 3KEQA 2QSUA 5K0CA 1LXCA 2GKOA 3LQFA 2B82A 4DQXA 4N47A 3VNBA 3U9TA 1OXBB 5JEEA 4DR7B 3AILA 4FQ8A 3TI7A 5A03A 3RI3A 4KHZA 5KUKA 2XNKA 3QEMB 3NONA 3ACDA 3WFIA 4Z8XA 2PY5A 4XIJA 1LJLA 1OBVA 3JZAA 4WFFA 1AK1A 4WSOA 4C7OB 4RHEA 1XDSA 2Y1CA 3QE2A 1E1KA 4G4XA 4CF5A 3RO7A 3BGSA 1FEZA 1YOVB 5AOCA 4O2LA 2FN3A 3OZBA 2D0OB 3GN2A 2LW1A 3VNVA 2HS0A 2XWQA 1K3TA 5IJ0B 1TQ2A 4G0YA 1QXSA 3WGMA 1ZPDA 4UUJC 4G88A 3EHBB 1XHLA 2GZ2A 2C20A 3D43A 3S27A 3FVWA 3AB8A 3Q7QA 2QEXF 1ZS9A 5J2UF 1U7ZA 3W1WA 5TLSA 4MJ7A 1L8LA 1OH6A 4OQZA 5AKZA 1XMSA 1WW3A 1UM9B 4XPIB 4NZZA 1VFNA 2IEDA 3CHXA 3BHPA 1WPXA 3HLYA 2OPBA 2DPYA 5K2OA 2CNWD 2J87A 4FVTA 4UTNA 3QKWA 1O8BA 4J29A 2Q3EA 4J1SA 1AJEA 3SEAA 4BAGA 5KJEA 1AJQA 4CEJB 2W6QA 3KIZA 2I91A 4NX2A 2VQEB 5ECWA 2HWYA 5BNWA 5ILOA 4WXHA 2ZUUA 4M7OA 1IULA 4LH7A 1RJWA 2V54A 5L40A 2X41A 3GQVA 4OGKA 4E1AA 4YCLA 5D3MB 4NBRA 3FFBA 5GZ3A 3PQ4A 3EQ7A 5L4LA 1JSLA 1XNGA 5BXQC 3D8CA 2JLVA 3BTVA 5IE9A 4UEKA 4BGUA 5LXTA 4JTDB 2YNMC 1JU3A 5FI5A 4QATA 2Q3BA 1U2TA 5EUBA 1EJBA 1IOVA 1U04A 1Z47A 4CLOB 1RI4A 4WINA 1BDMA 1Z3IX 3LUHA 2ID9A 1TOAA 1Q82H 3V1UA 5EXDA 2VSOA 2QX7A 2OG1A 3MINB 4W5QA 3SBEA 1H8EG 1B0AA 4A16A 1C41A 2PKQO 3O3MB 5F2VO 1II9A 2PX5A 2PA0A 3ROEA 3BMNB 4HDSA 7ADHA 1OZAA 5KYVA 1C1DB 3A06A 4DABA 2Z08A 4FGWA 3TNDA 1Q8IA 2J9RA 3VVBA 2HHHO 4X3OA 1HE5A 4C0KA 3EGDA 4JI7B 1Z2NX 4LI0A 4EJ0A 1C4KA 5EAIA 4JYAO 1E79G 2WSSG 3B36A 2VJDA 3OLVA 4EEKA 2XMZA 2Q4TA 3ZK7A 2YEVB 1XF1A 2ZSFA 4PSKA 3ASNB 5EZYB 5IBPA 3R76A 2AHZA 1IJKA 1H2MA 4M8SA 1QTIA 2XDQA 1HYEA 1PR3A 2OVBA 3Q2OA 1PBNA 2Q1XA 2J85A 4YJ3B 1E7MA 4M1YA 3QUBA 1E3IA 5LXTF 3O9OA 5DXAA 2GETA 2DAPA 4ZMRA 3AL3A 4FLXA 3HKCA 1JLKA 5GINC 5FQNA 2QE7G 4L57A 1NI3A 1PJCA 3ZW9A 3NDJA 2QIOA 5A9RA 2PBRA 4QPJA 4IQGA 5FPHA 3PPVA 1T4CA 1T3GA 2HFKA 3OJXA 2PSEA 4DR1B 1OGIA 1ZJYA 3FCSB 1UBJS 5KSYA 1S3SA 5HHTA 3JZFA 3QH4A 1SC3A 1XFDA 3PCTA 3JSNA 2KPOA 3VKGA 4MQBA 3AVQA 1JDVA 2GAAA 4CV0A 3ADDA 1Y5IA 4HS4A 1N8RW 1MTOA 3G6KA 4RSGA 2GHYA 3GI1A 2R25B 3OE4A 4HWTA 4P8RA 2DJVA 2OO3A 2VZ8A 4F71A 2K1EA 3ICQB 1H94A 1TJ5A 2WHYA 5KTTA 2EQAA 5C7YA 2NXNA 4XEHA 3N59A 1YHQV 5G1OA 1GL3A 4K87A 1X0XA 2WUDA 1MHTA 3OCZA 3EMVA 4FYHA 5BMVB 1P2VA 4QT4A 4UB8Z 4R40B 4OHXA 5C4IA 1ZKDA 3A4TA 4TSKA 4L5YA 3DP9A 2KLBA 1P7PA 1KO8A 3I2IA 5A1TA 2KBFA 5AI0A 2BZGA 1EFDN 2JDIA 1QVGU 2RHRA 3MA0A 2EIJC 1AQJA 1YZVA 3M1AA 1C7FA 2CK3A 3R7DA 4EO7A 3A70A 4W1RA 2PIAA 1MJNA 4WCDA 3GJ0A 5B8FA 2XGJA 2OAP1 5I7HA 4XJTA 2BBOA 1AXGA 2PT5A 1SVSA 5A3VA 2GNOA 1IBCA 1X7YB 1RM5A 3KR2A 1O6ZA 1YVPA 2OZEA 2WKSA 4LRSB 2RNBA 1T4BA 2YN4A 4E2LA 3SPJA 4V3BA 1YE5A 5KKCA 3KQOA 2BEVA 4P3KA 3W8NA 1GO2A 3NHMA 3A4LA 4H7FA 1AI6A 3MDSA 1N6OA 3G4SV 2GAFA 2G07A 1PG0A 5HBRA 1XNRB 3OCCA 5IK2A 1USGA 3PJGA 2OMEA 4PSVA 1ZMRA 3JV7A 1VIMA 2QJOA 2QBYA 4JP2A 1NYQA 4DMGA 5JIBA 1D5NA 2J41A 4MK4A 3BULA 3VJKA 1M2VA 3VNUA 1H6DA 5E6UB 1RYMA 4HBZA 2PMCA 5EUMA 4YMHA 2Q1TA 4KVZA 3H1KH 1Y74A 5AW3A 4H3HB 1TEHA 1X7PA 3TOSA 2VXBA 1W2HA 1C30B 1GNPA 2OBYA 1WA8B 1DLIA 4NYKA 3IDZA 5B4VA 3FF4A 4GKBA 5C8VA 4DA6A 3FKSD 1RI3A 2G77B 1FFSA 1PGNA 3I9NA 4HH1A 3BK7A 3E9YA 4OAOA 1AGPA 3VPXA 4AT1A 2HZ7A 3DMHA 2AEEA 1K6JA 1M6EX 2EWVA 4B80A 2WIDA 4UM7A 4C88A 3NKVA 2XKJE 2XAFA 1EQAA 4L9WA 3WKEA 5IG2A 2EZUA 4KB5A 2PEYA 5GW7A 3GQBA 3BL8A 3VYTC 3AK4A 1RQXA 5SYMA 3G8AA 1XZNA 5JTUA 4H1VA 1GN8A 4E94A 4H6XA 1LC3A 5ARBA 3P0JA 1SN7A 4GWKA 1JIUA 4B17A 2EAUA 4AWXA 4LNUA 5JDIA 3QQPA 3UJNA 4PW0A 1QIHA 3PGMA 4WUVA 4A26A 5KREA 2Z0MA 1N78A 3NS7A 2F4NA 4CTOA 4JBYA 1ELOA 3IAHA 3T7DA 4J03A 1J07A 1XLVA 4U8GA 4WXYB 2PZBA 4QSHA 4F56A 1GFWA 2D3OW 1PZNA 2QI9C 1U0EA 3GT7A 3CUUA 1BCSB 3IFSA 2H63A 4NE9A 4EKDA 3CVVA 3GDFA 2IW5A 1IUKA 4RD2A 4MW9A 3REGA 5C5DA 5F21A 3CE9A 3AM5A 3P52A 4C4TA 2EFDB 4H7KA 3TXAA 1NUQA 1I94O 5DJ5A 5KNCD 4CR6A 1YKSA 3RVKA 4M49A 4UHEA 4TTAA 4D9MA 2BKVA 4UEOA 2BKAA 1GOTA 2VBIA 5PNTA 3LLVA 5FWXB 4PQGA 1W35A 1T36A 4NLLA 4G9GA 1MNGA 1G3QA 2H51A 3ASVA 4GKJO 2BEJA 5AK5A 2R6DA 1C0LA 2JIQA 3NO4A 4AN0A 4TS3A 1B0UA 2DBRA 3O3OB 4U3JA 2M6YA 4OSEA 6ADHA 3I64A 2C5LA 3UUWA 5HY2A 3OZEA 1ODLA 4Q82A 2DQKA 1JSCA 4ZVRA 4X90A 1EESA 4M99A 1ZD8A 3H6GA 5I4KA 5CW2A 2D0IA 2X77A 1Z4MA 5AW5A 3L73H 1KSGA 1H2NA 3AG7A 2DETA 4GT1A 2JW5A 2ZRDA 4B0PA 2IZ7A 1NW7A 3ZW7A 1PE0A 4JYPA 2R4QA 3RWRD 3R3YA 2B21A 4TRMA 1QFZA 3HXLA 3PLRA 4MYSA 2W2KA 5EHGA 4ZVOA 4WFAV 4EZBA 3C8HA 5H3LA 2PUSA 3BGWA 3NOXA 3MNFA 5FP0A 1FDSA 1VCNA 4HNHA 1KZ1A 3GNSA 3QLUC 1ACMA 4R31A 1S01A 3G5UA 3ONVA 3K9HA 5CNMA 1KI3A 2WFZA 5JAQA 4FFPA 4MUNA 3ELBA 3JWEA 2FPRA 3GVPA 2BFWA 1IUPA 4IQ4A 1J1ZA 2BHSA 2D1FA 4UZEA 1DO0A 3EDOA 1QS0A 3KR9A 1ZJ5A 3AHHA 1E5TA 1V1MA 1FXKC 4ZT3A 1AI5A 1YF2A 5EMJA 1KYWA 2CC2A 3DFMA 2R8XA 5C8YB 5K3FB 4OG2A 3SVLA 3OAAA 3PIIA 4MB6A 3T1YB 2I6RA 2BE7A 3DUWA 4I4IA 2XB6A 2EJRA 5CEFA 2AKAB 1BKDR 5DT9A 3D6FA 2W6JG 4C3UA 1LVHA 1ONPA 3CQ9A 3BZUA 1XWIA 1U8FO 5TPZA 4JNCA 4F12A 2IZ1A 1L8OA 1W46A 1GKLA 2Z2XA 3EGCA 4Z7OB 2QP3A 1ZSPA 4Z7NB 2G4LA 2HK7A 1UWKA 1M2OA 3QV1A 3CGGA 2O2DA 3W5IA 4KDCA 3EPPA 1KK3A 1U4SA 4LSWA 1PNOA 4RD1A 1XELA 2IOFA 1LLUA 2R9AA 1U0JA 4PQEA 4X20B 4EEQA 4X66B 4FFMA 4JLPA 4IAOA 1E2MA 1XGKA 4RBNA 3PUKA 3UZUA 1E5LA 3FYDA 2VS0A 3B3FA 4A7PA 1NYRA 3CYQA 1VHDA 3U7QA 1WXDA 2VT6A 4EAAA 2C8LA 1U7DA 2F62A 5ILQA 3RIYA 4K40A 2ZRAA 5DHSA 3N2GA 2DT5A 3L4BC 1YS2X 3COYA 2OENG 2P65A 4LRYA 4G5YA 4X93A 2P0YA 3DE5X 5FTNA 2VG8A 2EFYA 4UHJA 2GJKA 3RWOA 5AMXA 1Z12A 1RE1A 4UATA 2PRIA 5LCXA 2XQFA 1Q43A 4WERA 2P35A 1UK8A 3B9PA 4J3JA 3IDFA 2P78A 3CF2A 3TR0A 1J23A 2ET6A 4IFIA 3KSUA 1FRVA 4NARA 1XXHA 1M1YA 1UBLS 3LT4A 3IEKA 4CKZA 2QXYA 5IYZB 5CNIA 3W04A 3ETNA 2C3PA 3RAEC 3QI2A 2ZJZA 2WSMA 4N39A 2P0EA 5DFAA 1ID1A 4GVXA 5K2MA 1EN6A 1OCEA 4KN5A 3A36A 1E2NA 1Z82A 2DQYA 3VZSA 1RM4A 3A1EA 3S6JA 2ZSUA 3QVGB 1KMIY 3LQ4A 2VYND 5B1IA 3E4CA 5TY0A 1YZFA 2OM2A 1JU4A 3M7IA 3KETA 1O94D 1WP9A 4I8DA 1IRXA 2GBGA 4HNAB 4N3CA 1EIZA 3I6BA 3VHXB 2F3UA