4C8IA

Ispf (burkholderia cenocepacia) citrate complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
149
Chain Sequence
b'MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFDSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
molecule tags Lyase
source organism Burkholderia cenocepacia
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
total genus 50
structure length 149
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8iA00
3IKEA 3ESJA 3T80A 3ELCA 1H47A 1KNKA 1IV1A 2AMTA 3JVHA 1IV4A 3Q8HA 1VH8A 5B8FA 1KNJA 1JN1A 1H48A 4C8EA 3F6MA 1YQNA 3ERNA 3FBAA 1U43A 3MBMA 2UZHA 2PMPA 1U40A 1U3LA 1JY8A 3QHDA 4C81A 3EORA 3K14A 1GX1A 2GZLA 3K2XA 3IKFA 3P10A 3RE3A 1IV2A 4C8IA 1W57A 3IEQA 1T0AA 4C82A 3F0GA 3GHZA 1U3PA 3IEWA 3F0DA 3F0EA 3FPIA 3F0FA 3KE1A 3P0ZA 4C8GA 3B6NA 1VHAA 1IV3A 1W55A
chains in the Genus database with same CATH superfamily
3E22A 3JAKA 3FD6A 1Q86H 2ZAUA 2CWJA 5GONB 4ZHQB 1X7OA 1VQMF 4TUYB 5JH7B 4X3LA 4C8EA 2ZVZA 3VYTC 1U43A 1OAPA 2N48A 3NK6A 2H6LA 5IYZB 2UYNB 3R0PA 5LYJA 4DRXB 5EWRA 1FNKA 3MDOA 3P4EA 5BMVB 1VK3A 2RHLA 5EB1B 3LWOC 1Z5VA 1GO1A 5GONA 1FNJA 3RYIA 3KJJA 3U0OA 1TUBA 3RYHB 4O4HA 4EB6B 1GO0A 1CK2A 1X52A 2RHJA 2Z1FA 4TV8A 2AIZP 4ZI7A 5B8FA 1VQ7F 1YITF 3VYSC 2ZODA 1W581 5GANK 4ZHWA 3CC7F 3VIUA 1TUBB 2DT4A 3WJRA 1VQNF 5IJ0A 3J81M 3K12A 2L26A 3JALA 3CCLF 3NMUC 3WGNA 3CC2F 1XHOA 2UYJA 2CHSA 1GZ0A 4X20A 3B6NA 3IR9A 3HKDA 1W5AA 3CCEF 3RYIB 4ZOLA 5HP8A 3RYFA 1VQ6F 5JH7A 2Z01A 5GAPK 2RB9A 2HS3A 2W8BC 3S0WA 3CCRF 2FC3A 1SZQA 2UYNA 4DRXA 3CYQA 5LYJB 4TV9A 1K9MH 4LCKA 4X20B 3K14A 2FGYA 1M1KH 3VCZA 2OTLF 1W42A 4TUYA 4C8IA 1QVGF 3HKEA 3IEWA 3D00A 1H7MA 3F0EA 2HS4A 3WPXA 4O4JA 4U3JB 5IJ0B 4G4YA 4X1KB 4X1IB 5KX5A 2P6YA 3NK7A 2VGMA 5IJ9B 3VTIC 1N8RH 5CA0B 1VQ5F 5KMGA 4TV8B 4ZI7B 5FNVA 4O4LA 3UT5B 5JVDB 1CN7A 3V7QA 4IHJB 1T0KB 4U39A 3MBMA 3N2GA 4O4HB 3RYHA 4EB6A 5IT9M 2CW4A 2RHOA 1JY8A 3C9SA 2BTUA 2CVLA 4C81A 2LBTA 4O4IA 1GX1A 4TZZA 1FFXB 3WGMA 5CB4A 5HXUA 4FFBB 4G4VA 3IEQA 5FNVB 3L7QA 3LWPC 3S03A 3S0YA 3P0ZA 3FBAA 5FJ4C 4X1KA 3JCMM 4LNUB 3TD5A 3CXCF 2HS0A 4U3JA 2IG8A 1VQOF 4BVQA 1IV1A 3JVHA 5EIBD 3WGLA 4O2BB 1H48A 2KG4A 4B62A 4ERHA 3KHNA 1NJIH 3CYPB 1KD1H 3MQWA 5G4VC 4BT5A 3KJKA 2KTUA 1T0AA 3HKBB 3BYQA 4O4IB 4RQOA 3PLAC 4YJ2B 3KE1A 4BVSA 1RQ2A 5LXTA 5EB0A 3FFMA 3TD3A 3I3FA 1Z5WA 5C8YB 1Q7YH 5CA1A 3JALB 2WALA 5HY4A 5LOVB 3G71F 4YJ3A 2CSLA 2HP3A 3ERNA 2UZHA 3WGJA 1UI9A 3JASA 4BT7A 4C4WC 3F0GA 5LP6C 2K1SA 3WXMB 5ITZA 3CPWF 3LMEA 1YJ9F 3F6MA 1VHAA 2PMPA 3J7AR 3ZO8A 2BTQB 3IMPA 3V7EA 1W41A 3ZOPA 1YIJF 1RA4A 3VO8A 1H47A 3CMEF 5EZYA 4KWEA 4I55A 3CB2A 5HY2A 3N4ZA 4ZOLB 3RYFB 3JATA 1R1MA 4RHAA 2ZOVA 4ZK7A 4BT4A 2Q1XA 2UYPA 2VAPA 1COMA 3PAFA 3LWQC 3NVKE 3RE3A 3VI6A 4C82A 4ZHQA 5JCOA 3F0DA 1UFYA 2ZVYA 2QEXF 3F0FA 3CCUF 3GYQA 1JJ2F 3E22B 3WJPA 4HNAA 2MQEA 3I55F 3I7TA 3LFOA 3AGKA 3J80M 5J2UA 1KNKA 1SA0B 3CMAF 4WBNA 5HY1A 2OHWA 4X1YB 2R6R1 2OZBA 3CG6A 3MCAB 2HRUA 4HNAB 3S06A 3HWUA 3HJWC 2HP0A 3DC2A 1IV2A 5LOVA 5CA1B 3VOAA 2H8CA 4O2AB 2AIFA 3C9UA 3V4DA 3RA6A 5BMVA 4C8GA 1Q81H 3N2KB 2LBWA 2F9ZC 5IYZA 3CCVF 1QU9A 4BW0B 3CCSF 4B5CA 4G4ZA 2B33A 2KTVA 3RYCA 1W5BA 1KNJA 1JN1A 2VAMA 2LBXA 1YQNA 3MCQA 2EWCA 1RLGA 1S72F 1X25A 1U40A 3VYUC 5GIPC 1KQSF 3JARB 4G4XA 4G88A 1KC8H 3CCJF 3C9RA 3CD6F 3RYCB 1YGYA 3WPWA 1K8AH 1W2BF 1TVKB 2LCAA 2OTMA 1CLIA 3FD5A 4LNUA 1IV3A 2YYEA 1W5EA 1XBIA 1YHQF 4ZHYB 1ZWZA 4FFBA 3QUWA 4NWOB 3S02A 4PWTA 3C9TA 1M90H 4EI7A 3C8LA 4EI8A 1TVKA 2GZLA 3P10A 3E20B 1XRGA 5HXZA 4WBNB 5J2UB 5KMGB 2Z1EA 3HKCA 5CA0A 3ZP4A 4EI9A 5FLXM 4BY9D 1Q82H 3GTZA 3M84A 4I50A 4BVTA 3ESJA 2VGNA 2HRYA 3E1YA 2Z1UA 3O85A 3M1XA 2BO1A 2CHTA 1QVFF 4I4TA 3CC4F 3JARA 4TV9B 4I50B 2PHNA 1XV2A 3JATB 1W40A 1VQPF 4I55B 4O2AA 5EYPB 2GLZA 4B45A 2IAFA 3I56F 5JCOC 3N2KA 2Z1TA 4M8IA 3D01A 5AVMA 2CZWA 5JVDA 3NVIB 5GINC 2QA4F 1RQ7A 5LA6B 2HP0B 3N4YA 1RLUA 5JQGB 3WJQA 3QHDA 4NQ3A 3M4SA 1VQVA 4X1YA 2HQSC 4YJ3B 3SIUA 1YJWF 1JFFB 1VQLF 1VQKF 2HX0A 1VQ8F 4NUTA 3CCQF 3FPIA 3K0TA 1QAHA 1FSZA 2Q1YA 4R40B 3OW2F 4X3MA 3LWVC 1OFUA 3G4SF 1ODEA 2IQQA 3HKBA 2G9IA 1W59A 3SIVA 3CPQA 4BT3A 2VAWA 2NMUA 2V9YA 3VMFB 3LWRC 5EIBC 4BT2A 1ONIA 3G6EF 3ON1A 3HKDB 5MN5A 3K2XA 2DYYA 3RA5A 1JFFA 4ZHVA 1U3PA 4B46A 3S0HA 5HY0A 5JQGA 3JAKB 2ZF8A 2RHHA 2R751 3OONA 3HTNA 5LA6A 5ITZB 4BT6A 3HAXD 2AMTA 1IV4A 2VXYA 1VQ4F 1W5FA 2OTJF 5MN6A 5HP7A 3TD4A 3VOBA 3EORA 4IIJA 1E7KA 3CCMF 3UT5A 5A2QM 5EYPA 5C8YA 3GHZA 2I6DA 2YXZA 4F6RA 5HWEA 4X1IA 1W55A 2KGWA 4I4TB 4YJ2A 4O4JB 1YJNF 3T80A 2GVIA 3JAWB 2JNBA 1PF5A 3OBYA 3WGKA 5EZYB 4E6EA 1NMUB 2UYKA 1X7PA 3ZP7A 5LP6A 5LP6B 2H8EA 5DCVA 1DBFA 1JD1A 4G4WA 4BVRA 3LYBA 3HKCB 4O2BA 5GIOC 1W57A 1SDSA 1VQ9F 3JASB 3JAWA 2I6RA 2HVYD 4DXDA 3V3TA 5J2TB 2ALEA 3D54A 3IKEA 3N2GB 2BTOA 2QTPA 3ELCA 4F6RB 1QD9A 3KIZA 1NQ3A 3OBWA 3Q8HA 3LDTA 1VH8A 5CB4B 1FFXA 4IIJB 1W3EX 4XCQA 3QTYA 5LXTB 1U3LA 5EAZA 5J2TA 1J7HA 5G4UC 4IHJA 3IKFA 1DT9A 1K73H 1Q8RA 3HKEB 4O4LB 1IPAA 1SA0A 3JAMM 5EO3A 1PXWA 2QI2A 3DDNA 5IJ9A 5KX5B 5MN4A 1YI2F
chains in the Genus database with same CATH topology
3IKEA 3ESJA 3T80A 3ELCA 1H47A 1KNKA 1IV1A 2AMTA 3JVHA 1IV4A 3Q8HA 1VH8A 5B8FA 1KNJA 1JN1A 1H48A 4C8EA 3F6MA 1YQNA 3ERNA 3FBAA 1U43A 3MBMA 2UZHA 2PMPA 1U40A 1U3LA 1JY8A 3QHDA 4C81A 3EORA 3K14A 1GX1A 2GZLA 3K2XA 3IKFA 3P10A 3RE3A 1IV2A 4C8IA 1W57A 3IEQA 1T0AA 4C82A 3F0GA 3GHZA 1U3PA 3IEWA 3F0DA 3F0EA 3FPIA 3F0FA 3KE1A 3P0ZA 4C8GA 3B6NA 1VHAA 1IV3A 1W55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKE A;  3ESJ A;  3T80 A;  3ELC A;  1H47 A;  1KNK A;  1IV1 A;  2AMT A;  3JVH A;  1IV4 A;  3Q8H A;  1VH8 A;  5B8F A;  1KNJ A;  1JN1 A;  1H48 A;  4C8E A;  3F6M A;  1YQN A;  3ERN A;  3FBA A;  1U43 A;  3MBM A;  2UZH A;  2PMP A;  1U40 A;  1U3L A;  1JY8 A;  3QHD A;  4C81 A;  3EOR A;  3K14 A;  1GX1 A;  2GZL A;  3K2X A;  3IKF A;  3P10 A;  3RE3 A;  1IV2 A;  4C8I A;  1W57 A;  3IEQ A;  1T0A A;  4C82 A;  3F0G A;  3GHZ A;  1U3P A;  3IEW A;  3F0D A;  3F0E A;  3FPI A;  3F0F A;  3KE1 A;  3P0Z A;  4C8G A;  3B6N A;  1VHA A;  1IV3 A;  1W55 A; 
#chains in the Genus database with same CATH topology
 3E22 A;  3JAK A;  3FD6 A;  1Q86 H;  2ZAU A;  2CWJ A;  5GON B;  4ZHQ B;  1X7O A;  1VQM F;  4TUY B;  5JH7 B;  4X3L A;  4C8E A;  2ZVZ A;  3VYT C;  1U43 A;  1OAP A;  2N48 A;  3NK6 A;  2H6L A;  5IYZ B;  2UYN B;  3R0P A;  5LYJ A;  4DRX B;  5EWR A;  1FNK A;  3MDO A;  3P4E A;  5BMV B;  1VK3 A;  2RHL A;  5EB1 B;  3LWO C;  1Z5V A;  1GO1 A;  5GON A;  1FNJ A;  3RYI A;  3KJJ A;  3U0O A;  1TUB A;  3RYH B;  4O4H A;  4EB6 B;  1GO0 A;  1CK2 A;  1X52 A;  2RHJ A;  2Z1F A;  4TV8 A;  2AIZ P;  4ZI7 A;  5B8F A;  1VQ7 F;  1YIT F;  3VYS C;  2ZOD A;  1W58 1;  5GAN K;  4ZHW A;  3CC7 F;  3VIU A;  1TUB B;  2DT4 A;  3WJR A;  1VQN F;  5IJ0 A;  3J81 M;  3K12 A;  2L26 A;  3JAL A;  3CCL F;  3NMU C;  3WGN A;  3CC2 F;  1XHO A;  2UYJ A;  2CHS A;  1GZ0 A;  4X20 A;  3B6N A;  3IR9 A;  3HKD A;  1W5A A;  3CCE F;  3RYI B;  4ZOL A;  5HP8 A;  3RYF A;  1VQ6 F;  5JH7 A;  2Z01 A;  5GAP K;  2RB9 A;  2HS3 A;  2W8B C;  3S0W A;  3CCR F;  2FC3 A;  1SZQ A;  2UYN A;  4DRX A;  3CYQ A;  5LYJ B;  4TV9 A;  1K9M H;  4LCK A;  4X20 B;  3K14 A;  2FGY A;  1M1K H;  3VCZ A;  2OTL F;  1W42 A;  4TUY A;  4C8I A;  1QVG F;  3HKE A;  3IEW A;  3D00 A;  1H7M A;  3F0E A;  2HS4 A;  3WPX A;  4O4J A;  4U3J B;  5IJ0 B;  4G4Y A;  4X1K B;  4X1I B;  5KX5 A;  2P6Y A;  3NK7 A;  2VGM A;  5IJ9 B;  3VTI C;  1N8R H;  5CA0 B;  1VQ5 F;  5KMG A;  4TV8 B;  4ZI7 B;  5FNV A;  4O4L A;  3UT5 B;  5JVD B;  1CN7 A;  3V7Q A;  4IHJ B;  1T0K B;  4U39 A;  3MBM A;  3N2G A;  4O4H B;  3RYH A;  4EB6 A;  5IT9 M;  2CW4 A;  2RHO A;  1JY8 A;  3C9S A;  2BTU A;  2CVL A;  4C81 A;  2LBT A;  4O4I A;  1GX1 A;  4TZZ A;  1FFX B;  3WGM A;  5CB4 A;  5HXU A;  4FFB B;  4G4V A;  3IEQ A;  5FNV B;  3L7Q A;  3LWP C;  3S03 A;  3S0Y A;  3P0Z A;  3FBA A;  5FJ4 C;  4X1K A;  3JCM M;  4LNU B;  3TD5 A;  3CXC F;  2HS0 A;  4U3J A;  2IG8 A;  1VQO F;  4BVQ A;  1IV1 A;  3JVH A;  5EIB D;  3WGL A;  4O2B B;  1H48 A;  2KG4 A;  4B62 A;  4ERH A;  3KHN A;  1NJI H;  3CYP B;  1KD1 H;  3MQW A;  5G4V C;  4BT5 A;  3KJK A;  2KTU A;  1T0A A;  3HKB B;  3BYQ A;  4O4I B;  4RQO A;  3PLA C;  4YJ2 B;  3KE1 A;  4BVS A;  1RQ2 A;  5LXT A;  5EB0 A;  3FFM A;  3TD3 A;  3I3F A;  1Z5W A;  5C8Y B;  1Q7Y H;  5CA1 A;  3JAL B;  2WAL A;  5HY4 A;  5LOV B;  3G71 F;  4YJ3 A;  2CSL A;  2HP3 A;  3ERN A;  2UZH A;  3WGJ A;  1UI9 A;  3JAS A;  4BT7 A;  4C4W C;  3F0G A;  5LP6 C;  2K1S A;  3WXM B;  5ITZ A;  3CPW F;  3LME A;  1YJ9 F;  3F6M A;  1VHA A;  2PMP A;  3J7A R;  3ZO8 A;  2BTQ B;  3IMP A;  3V7E A;  1W41 A;  3ZOP A;  1YIJ F;  1RA4 A;  3VO8 A;  1H47 A;  3CME F;  5EZY A;  4KWE A;  4I55 A;  3CB2 A;  5HY2 A;  3N4Z A;  4ZOL B;  3RYF B;  3JAT A;  1R1M A;  4RHA A;  2ZOV A;  4ZK7 A;  4BT4 A;  2Q1X A;  2UYP A;  2VAP A;  1COM A;  3PAF A;  3LWQ C;  3NVK E;  3RE3 A;  3VI6 A;  4C82 A;  4ZHQ A;  5JCO A;  3F0D A;  1UFY A;  2ZVY A;  2QEX F;  3F0F A;  3CCU F;  3GYQ A;  1JJ2 F;  3E22 B;  3WJP A;  4HNA A;  2MQE A;  3I55 F;  3I7T A;  3LFO A;  3AGK A;  3J80 M;  5J2U A;  1KNK A;  1SA0 B;  3CMA F;  4WBN A;  5HY1 A;  2OHW A;  4X1Y B;  2R6R 1;  2OZB A;  3CG6 A;  3MCA B;  2HRU A;  4HNA B;  3S06 A;  3HWU A;  3HJW C;  2HP0 A;  3DC2 A;  1IV2 A;  5LOV A;  5CA1 B;  3VOA A;  2H8C A;  4O2A B;  2AIF A;  3C9U A;  3V4D A;  3RA6 A;  5BMV A;  4C8G A;  1Q81 H;  3N2K B;  2LBW A;  2F9Z C;  5IYZ A;  3CCV F;  1QU9 A;  4BW0 B;  3CCS F;  4B5C A;  4G4Z A;  2B33 A;  2KTV A;  3RYC A;  1W5B A;  1KNJ A;  1JN1 A;  2VAM A;  2LBX A;  1YQN A;  3MCQ A;  2EWC A;  1RLG A;  1S72 F;  1X25 A;  1U40 A;  3VYU C;  5GIP C;  1KQS F;  3JAR B;  4G4X A;  4G88 A;  1KC8 H;  3CCJ F;  3C9R A;  3CD6 F;  3RYC B;  1YGY A;  3WPW A;  1K8A H;  1W2B F;  1TVK B;  2LCA A;  2OTM A;  1CLI A;  3FD5 A;  4LNU A;  1IV3 A;  2YYE A;  1W5E A;  1XBI A;  1YHQ F;  4ZHY B;  1ZWZ A;  4FFB A;  3QUW A;  4NWO B;  3S02 A;  4PWT A;  3C9T A;  1M90 H;  4EI7 A;  3C8L A;  4EI8 A;  1TVK A;  2GZL A;  3P10 A;  3E20 B;  1XRG A;  5HXZ A;  4WBN B;  5J2U B;  5KMG B;  2Z1E A;  3HKC A;  5CA0 A;  3ZP4 A;  4EI9 A;  5FLX M;  4BY9 D;  1Q82 H;  3GTZ A;  3M84 A;  4I50 A;  4BVT A;  3ESJ A;  2VGN A;  2HRY A;  3E1Y A;  2Z1U A;  3O85 A;  3M1X A;  2BO1 A;  2CHT A;  1QVF F;  4I4T A;  3CC4 F;  3JAR A;  4TV9 B;  4I50 B;  2PHN A;  1XV2 A;  3JAT B;  1W40 A;  1VQP F;  4I55 B;  4O2A A;  5EYP B;  2GLZ A;  4B45 A;  2IAF A;  3I56 F;  5JCO C;  3N2K A;  2Z1T A;  4M8I A;  3D01 A;  5AVM A;  2CZW A;  5JVD A;  3NVI B;  5GIN C;  2QA4 F;  1RQ7 A;  5LA6 B;  2HP0 B;  3N4Y A;  1RLU A;  5JQG B;  3WJQ A;  3QHD A;  4NQ3 A;  3M4S A;  1VQV A;  4X1Y A;  2HQS C;  4YJ3 B;  3SIU A;  1YJW F;  1JFF B;  1VQL F;  1VQK F;  2HX0 A;  1VQ8 F;  4NUT A;  3CCQ F;  3FPI A;  3K0T A;  1QAH A;  1FSZ A;  2Q1Y A;  4R40 B;  3OW2 F;  4X3M A;  3LWV C;  1OFU A;  3G4S F;  1ODE A;  2IQQ A;  3HKB A;  2G9I A;  1W59 A;  3SIV A;  3CPQ A;  4BT3 A;  2VAW A;  2NMU A;  2V9Y A;  3VMF B;  3LWR C;  5EIB C;  4BT2 A;  1ONI A;  3G6E F;  3ON1 A;  3HKD B;  5MN5 A;  3K2X A;  2DYY A;  3RA5 A;  1JFF A;  4ZHV A;  1U3P A;  4B46 A;  3S0H A;  5HY0 A;  5JQG A;  3JAK B;  2ZF8 A;  2RHH A;  2R75 1;  3OON A;  3HTN A;  5LA6 A;  5ITZ B;  4BT6 A;  3HAX D;  2AMT A;  1IV4 A;  2VXY A;  1VQ4 F;  1W5F A;  2OTJ F;  5MN6 A;  5HP7 A;  3TD4 A;  3VOB A;  3EOR A;  4IIJ A;  1E7K A;  3CCM F;  3UT5 A;  5A2Q M;  5EYP A;  5C8Y A;  3GHZ A;  2I6D A;  2YXZ A;  4F6R A;  5HWE A;  4X1I A;  1W55 A;  2KGW A;  4I4T B;  4YJ2 A;  4O4J B;  1YJN F;  3T80 A;  2GVI A;  3JAW B;  2JNB A;  1PF5 A;  3OBY A;  3WGK A;  5EZY B;  4E6E A;  1NMU B;  2UYK A;  1X7P A;  3ZP7 A;  5LP6 A;  5LP6 B;  2H8E A;  5DCV A;  1DBF A;  1JD1 A;  4G4W A;  4BVR A;  3LYB A;  3HKC B;  4O2B A;  5GIO C;  1W57 A;  1SDS A;  1VQ9 F;  3JAS B;  3JAW A;  2I6R A;  2HVY D;  4DXD A;  3V3T A;  5J2T B;  2ALE A;  3D54 A;  3IKE A;  3N2G B;  2BTO A;  2QTP A;  3ELC A;  4F6R B;  1QD9 A;  3KIZ A;  1NQ3 A;  3OBW A;  3Q8H A;  3LDT A;  1VH8 A;  5CB4 B;  1FFX A;  4IIJ B;  1W3E X;  4XCQ A;  3QTY A;  5LXT B;  1U3L A;  5EAZ A;  5J2T A;  1J7H A;  5G4U C;  4IHJ A;  3IKF A;  1DT9 A;  1K73 H;  1Q8R A;  3HKE B;  4O4L B;  1IPA A;  1SA0 A;  3JAM M;  5EO3 A;  1PXW A;  2QI2 A;  3DDN A;  5IJ9 A;  5KX5 B;  5MN4 A;  1YI2 F; 
#chains in the Genus database with same CATH homology
 3IKE A;  3ESJ A;  3T80 A;  3ELC A;  1H47 A;  1KNK A;  1IV1 A;  2AMT A;  3JVH A;  1IV4 A;  3Q8H A;  1VH8 A;  5B8F A;  1KNJ A;  1JN1 A;  1H48 A;  4C8E A;  3F6M A;  1YQN A;  3ERN A;  3FBA A;  1U43 A;  3MBM A;  2UZH A;  2PMP A;  1U40 A;  1U3L A;  1JY8 A;  3QHD A;  4C81 A;  3EOR A;  3K14 A;  1GX1 A;  2GZL A;  3K2X A;  3IKF A;  3P10 A;  3RE3 A;  1IV2 A;  4C8I A;  1W57 A;  3IEQ A;  1T0A A;  4C82 A;  3F0G A;  3GHZ A;  1U3P A;  3IEW A;  3F0D A;  3F0E A;  3FPI A;  3F0F A;  3KE1 A;  3P0Z A;  4C8G A;  3B6N A;  1VHA A;  1IV3 A;  1W55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...