4C8IA

Ispf (burkholderia cenocepacia) citrate complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
149
Chain Sequence
MDVRIGQGYDVHQLVEGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFDSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLGLPLERVNVKAKTNEKLGYLGRGEGIEAQAAALLVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Crystal Structures of Ispf from Plasmodium Falciparum and Burkholderia Cenocepacia: Comparisons Inform Antimicrobial Drug Target Assessment.
pubmed doi rcsb
source organism Burkholderia cenocepacia
total genus 50
structure length 149
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 4c8iA00
3IKEA 1JY8A 2PMPA 4C81A 3GHZA 3MBMA 3T80A 1U40A 3FBAA 3FPIA 1KNJA 1W57A 3F0FA 3ELCA 3F0GA 3F6MA 1H47A 1IV4A 3B6NA 1YQNA 3EORA 2AMTA 1KNKA 1W55A 3F0DA 3IKFA 1U3PA 3K14A 1U43A 3KE1A 5B8FA 3F0EA 3IEQA 1GX1A 3QHDA 1IV2A 3K2XA 2GZLA 3JVHA 3RE3A 3IEWA 3P10A 3Q8HA 1JN1A 4C8EA 4C8IA 1IV3A 1H48A 1T0AA 4C82A 1VHAA 1IV1A 1U3LA 3ERNA 1VH8A 3ESJA 3P0ZA 4C8GA 2UZHA
chains in the Genus database with same CATH superfamily
5BMVB 2RHOA 2BTOA 3F0FA 3CCVF 2VXYA 4TZZA 4X1YA 1Z5WA 2OTLF 5EIBD 1U3PA 4YJ3A 5EYPA 3ZP4A 1U43A 5G4UC 4IHJB 1CLIA 1VQKF 4G88A 1YJNF 5EZYB 5FLXM 1X7PA 1XV2A 4ZK7A 5EO3A 5JQGB 5J2TB 3TD3A 2ZVZA 2CHSA 3C9SA 3S0YA 3U0OA 3C8LA 2QEXF 4O2AA 1FFXA 3S0WA 3FBAA 2K1SA 1M90H 3TD5A 5ITZA 1X7OA 1W2BF 3C9TA 1IV4A 4U3JA 1R1MA 4X1IA 3G71F 2KTUA 3VTIC 4BVRA 3LWRC 2L26A 3S03A 3CC7F 1VQLF 2HVYD 4O2BA 2RHHA 5KX5A 3V3TA 4TV9B 5LOVA 4ZHYB 4O4IB 5CA0A 2BO1A 3HKBA 4NQ3A 3CXCF 4R40B 1CK2A 1W3EX 2R751 4C4WC 2BTUA 2ZAUA 3FPIA 3JAMM 3F0GA 2GLZA 3LYBA 5MN5A 3DDNA 3K14A 4B5CA 3HKEA 5G4VC 1TVKB 3E20B 2AIFA 1RQ7A 3CCQF 1RQ2A 3CC4F 2HRUA 5IJ9B 2CVLA 1VHAA 3GTZA 3JAWB 5LP6A 4EB6A 2IAFA 1KQSF 3JASB 3M4SA 1VH8A 3CPQA 3UT5A 3CCLF 2ALEA 3N4YA 2CWJA 3JALB 1Q8RA 2HX0A 2BTQB 2OTJF 3D01A 1VQMF 3NVKE 2DT4A 1ZWZA 1W41A 3B6NA 5C8YA 3WGJA 5JH7A 1VQVA 2OHWA 3MDOA 2ZF8A 3MCQA 3S02A 2Z1UA 3IKFA 3CPWF 3IR9A 5FNVA 5HY1A 3OBWA 4F6RA 2IG8A 2N48A 3JAKA 3QHDA 5EWRA 5JVDA 1GO1A 3LWQC 4BY9D 3JVHA 2IQQA 4C8IA 1YHQF 3KJJA 1CN7A 2UYKA 3E22A 1YJ9F 5JCOA 5LA6A 1VQPF 4ZHQA 5AVMA 2PHNA 3J81M 5CA1B 1W5BA 1N8RH 3KHNA 2FC3A 4EI7A 3D54A 3MBMA 4O4HA 3T80A 1VK3A 3CB2A 3LWOC 2DYYA 3M84A 1ODEA 1SA0A 5HY0A 5GONB 2OZBA 3LMEA 4XCQA 1YJWF 4FFBB 1JD1A 4I55B 2UYNB 4IIJA 3ZOPA 3WGLA 3ZO8A 4YJ2A 3S0HA 4HNAB 2QA4F 1RLUA 3QUWA 2G9IA 3WJRA 3LWPC 3CCUF 1U40A 2P6YA 2RHJA 3RYHB 5J2UA 3F6MA 1W59A 4EI9A 5CB4B 4O4JA 1NJIH 1T0KB 3N2GA 4LNUB 4WBNA 4ZI7A 2JNBA 4ZOLB 3JATA 1VQ9F 1W5AA 2ZVYA 5BMVA 5EB0A 2GZLA 3WGNA 3KIZA 1VQNF 3PLAC 4BT2A 3Q8HA 2HS4A 5IJ0A 1KD1H 1J7HA 3I7TA 4X1YB 1U3LA 3HKDA 5EYPB 3VIUA 3ESJA 3VYSC 4TUYA 1K8AH 1JY8A 1TUBB 4IHJA 4X1KA 3G6EF 1DBFA 3G4SF 5EB1B 1XHOA 5EIBC 1Q81H 2EWCA 3HKCA 2Z1TA 3QTYA 5JQGA 2AIZP 5J2TA 4RHAA 2UYPA 1FSZA 2FGYA 4G4VA 3LDTA 3VMFB 5GAPK 4EI8A 3CD6F 1Z5VA 4O2AB 1FFXB 1GO0A 3OONA 1W42A 3VOAA 4DRXB 2HP3A 5ITZB 2HS0A 1JFFB 3P10A 2KTVA 5LYJA 1T0AA 4E6EA 5KMGB 4I4TB 1K73H 1VQ7F 3CC2F 2Z1EA 2H8EA 4KWEA 3NK7A 3RA5A 3VI6A 5LOVB 1JJ2F 5CA0B 3ELCA 4TV9A 3DC2A 3HKBB 2AMTA 4O4LA 2H6LA 3SIUA 3VO8A 5IYZA 1KC8H 3JARB 3RYIB 5FJ4C 4BT6A 3K2XA 1NQ3A 3TD4A 3NVIB 4C8EA 3SIVA 2VAPA 1JN1A 3J80M 1QVFF 3C9RA 1VQOF 4LCKA 2HP0A 1YIJF 5EAZA 2Z01A 3HKEB 3IKEA 1VQ5F 3V7EA 3GHZA 2CZWA 2VAWA 1TVKA 3WJPA 4I50B 2UYJA 1RLGA 3UT5B 5HWEA 2HQSC 4BVQA 3CCEF 2ZOVA 3JAWA 3IMPA 3LWVC 3ZP7A 2I6RA 2ZODA 4TV8A 3JALA 3HWUA 5C8YB 3IEWA 5JH7B 3WGKA 3CMEF 5LXTB 3C9UA 5FNVB 4C8GA 4F6RB 5GIOC 2UZHA 3WPXA 2KG4A 2LBXA 1K9MH 5JVDB 3I55F 1QD9A 2W8BC 3NMUC 1SZQA 4X20A 3V4DA 3N2KA 1QU9A 3E22B 3WJQA 2HRYA 3HTNA 2QI2A 2I6DA 3EORA 3CYPB 4O4HB 3F0EA 1GX1A 3RYCB 1UI9A 3OBYA 4ERHA 5IT9M 2H8CA 1IV3A 1H7MA 1W40A 1SA0B 3ERNA 4ZHVA 5MN6A 3J7AR 3HAXD 3S06A 2B33A 5GONA 3RYFB 4FFBA 3WPWA 2V9YA 3I56F 3AGKA 1QVGF 3N4ZA 1VQ8F 3BYQA 1UFYA 3CYQA 1VQ6F 5MN4A 4NWOB 3CCJF 3FFMA 5HXUA 3M1XA 5J2UB 4ZHWA 3CG6A 4X3MA 4O4JB 5LP6C 1M1KH 4LNUA 3VOBA 4YJ3B 2Q1XA 4B46A 4ZOLA 2CW4A 2KGWA 5IJ0B 2NMUA 1QAHA 3CMAF 4X3LA 5EZYA 3HKDB 2MQEA 1W581 4TUYB 1KNKA 2RB9A 5HXZA 4X1KB 3CCMF 2LCAA 2GVIA 1TUBA 1IPAA 3R0PA 1W5FA 2LBWA 1OAPA 3HKCB 4BT5A 5JCOC 4U3JB 3VYUC 4X1IB 3K0TA 4G4ZA 4RQOA 3VYTC 3WXMB 5HY2A 2F9ZC 1E7KA 5LYJB 4O2BB 5KX5B 4DRXA 4DXDA 1JFFA 3NK6A 1YQNA 4NUTA 4I4TA 4B62A 1PXWA 5KMGA 1SDSA 4O4IA 3D00A 3F0DA 3VCZA 4PWTA 3KE1A 5B8FA 4B45A 1IV2A 1PF5A 4O4LB 1X52A 4G4WA 2CSLA 3L7QA 1X25A 5IYZB 1FNJA 5A2QM 3V7QA 3RA6A 4C81A 5HY4A 3JARA 3RYIA 4BVSA 3MCAB 4BT4A 4G4XA 2HP0B 2VAMA 3K12A 1DT9A 5IJ9A 5LP6B 4EB6B 5HP8A 3OW2F 3JASA 3ON1A 3WGMA 3IEQA 4U39A 4BT3A 1NMUB 1YGYA 3RE3A 5GANK 1VQ4F 1FNKA 4I50A 1IV1A 4M8IA 2CHTA 3KJKA 3MQWA 3HJWC 1RA4A 4TV8B 2PMPA 1Q82H 3JAKB 2HS3A 2LBTA 3I3FA 2R6R1 2WALA 3LFOA 1H47A 1YI2F 2OTMA 5LA6B 1Q86H 4ZHQB 1XRGA 2RHLA 5LXTA 3FD5A 1W5EA 2Z1FA 4X20B 5CA1A 5GIPC 3N2KB 3CCSF 1ONIA 3FD6A 3JCMM 3P4EA 3P0ZA 3CCRF 3O85A 1COMA 4IIJB 1XBIA 4I55A 3RYCA 1KNJA 1W57A 2UYNA 4YJ2B 5GINC 4BW0B 3E1YA 1W55A 2VGMA 2VGNA 1OFUA 2QTPA 4G4YA 4HNAA 3RYFA 2Q1YA 1YITF 3PAFA 1GZ0A 1S72F 5DCVA 2YYEA 1H48A 2YXZA 3GYQA 3RYHA 4C82A 3N2GB 5HP7A 1Q7YH 4WBNB 4BVTA 4ZI7B 5CB4A 4BT7A 3JATB
chains in the Genus database with same CATH topology
3IKEA 1JY8A 2PMPA 4C81A 3GHZA 3MBMA 3T80A 1U40A 3FBAA 3FPIA 1KNJA 1W57A 3F0FA 3ELCA 3F0GA 3F6MA 1H47A 1IV4A 3B6NA 1YQNA 3EORA 2AMTA 1KNKA 1W55A 3F0DA 3IKFA 1U3PA 3K14A 1U43A 3KE1A 5B8FA 3F0EA 3IEQA 1GX1A 3QHDA 1IV2A 3K2XA 2GZLA 3JVHA 3RE3A 3IEWA 3P10A 3Q8HA 1JN1A 4C8EA 4C8IA 1IV3A 1H48A 1T0AA 4C82A 1VHAA 1IV1A 1U3LA 3ERNA 1VH8A 3ESJA 3P0ZA 4C8GA 2UZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKE A;  1JY8 A;  2PMP A;  4C81 A;  3GHZ A;  3MBM A;  3T80 A;  1U40 A;  3FBA A;  3FPI A;  1KNJ A;  1W57 A;  3F0F A;  3ELC A;  3F0G A;  3F6M A;  1H47 A;  1IV4 A;  3B6N A;  1YQN A;  3EOR A;  2AMT A;  1KNK A;  1W55 A;  3F0D A;  3IKF A;  1U3P A;  3K14 A;  1U43 A;  3KE1 A;  5B8F A;  3F0E A;  3IEQ A;  1GX1 A;  3QHD A;  1IV2 A;  3K2X A;  2GZL A;  3JVH A;  3RE3 A;  3IEW A;  3P10 A;  3Q8H A;  1JN1 A;  4C8E A;  4C8I A;  1IV3 A;  1H48 A;  1T0A A;  4C82 A;  1VHA A;  1IV1 A;  1U3L A;  3ERN A;  1VH8 A;  3ESJ A;  3P0Z A;  4C8G A;  2UZH A; 
#chains in the Genus database with same CATH topology
 5BMV B;  2RHO A;  2BTO A;  3F0F A;  3CCV F;  2VXY A;  4TZZ A;  4X1Y A;  1Z5W A;  2OTL F;  5EIB D;  1U3P A;  4YJ3 A;  5EYP A;  3ZP4 A;  1U43 A;  5G4U C;  4IHJ B;  1CLI A;  1VQK F;  4G88 A;  1YJN F;  5EZY B;  5FLX M;  1X7P A;  1XV2 A;  4ZK7 A;  5EO3 A;  5JQG B;  5J2T B;  3TD3 A;  2ZVZ A;  2CHS A;  3C9S A;  3S0Y A;  3U0O A;  3C8L A;  2QEX F;  4O2A A;  1FFX A;  3S0W A;  3FBA A;  2K1S A;  1M90 H;  3TD5 A;  5ITZ A;  1X7O A;  1W2B F;  3C9T A;  1IV4 A;  4U3J A;  1R1M A;  4X1I A;  3G71 F;  2KTU A;  3VTI C;  4BVR A;  3LWR C;  2L26 A;  3S03 A;  3CC7 F;  1VQL F;  2HVY D;  4O2B A;  2RHH A;  5KX5 A;  3V3T A;  4TV9 B;  5LOV A;  4ZHY B;  4O4I B;  5CA0 A;  2BO1 A;  3HKB A;  4NQ3 A;  3CXC F;  4R40 B;  1CK2 A;  1W3E X;  2R75 1;  4C4W C;  2BTU A;  2ZAU A;  3FPI A;  3JAM M;  3F0G A;  2GLZ A;  3LYB A;  5MN5 A;  3DDN A;  3K14 A;  4B5C A;  3HKE A;  5G4V C;  1TVK B;  3E20 B;  2AIF A;  1RQ7 A;  3CCQ F;  1RQ2 A;  3CC4 F;  2HRU A;  5IJ9 B;  2CVL A;  1VHA A;  3GTZ A;  3JAW B;  5LP6 A;  4EB6 A;  2IAF A;  1KQS F;  3JAS B;  3M4S A;  1VH8 A;  3CPQ A;  3UT5 A;  3CCL F;  2ALE A;  3N4Y A;  2CWJ A;  3JAL B;  1Q8R A;  2HX0 A;  2BTQ B;  2OTJ F;  3D01 A;  1VQM F;  3NVK E;  2DT4 A;  1ZWZ A;  1W41 A;  3B6N A;  5C8Y A;  3WGJ A;  5JH7 A;  1VQV A;  2OHW A;  3MDO A;  2ZF8 A;  3MCQ A;  3S02 A;  2Z1U A;  3IKF A;  3CPW F;  3IR9 A;  5FNV A;  5HY1 A;  3OBW A;  4F6R A;  2IG8 A;  2N48 A;  3JAK A;  3QHD A;  5EWR A;  5JVD A;  1GO1 A;  3LWQ C;  4BY9 D;  3JVH A;  2IQQ A;  4C8I A;  1YHQ F;  3KJJ A;  1CN7 A;  2UYK A;  3E22 A;  1YJ9 F;  5JCO A;  5LA6 A;  1VQP F;  4ZHQ A;  5AVM A;  2PHN A;  3J81 M;  5CA1 B;  1W5B A;  1N8R H;  3KHN A;  2FC3 A;  4EI7 A;  3D54 A;  3MBM A;  4O4H A;  3T80 A;  1VK3 A;  3CB2 A;  3LWO C;  2DYY A;  3M84 A;  1ODE A;  1SA0 A;  5HY0 A;  5GON B;  2OZB A;  3LME A;  4XCQ A;  1YJW F;  4FFB B;  1JD1 A;  4I55 B;  2UYN B;  4IIJ A;  3ZOP A;  3WGL A;  3ZO8 A;  4YJ2 A;  3S0H A;  4HNA B;  2QA4 F;  1RLU A;  3QUW A;  2G9I A;  3WJR A;  3LWP C;  3CCU F;  1U40 A;  2P6Y A;  2RHJ A;  3RYH B;  5J2U A;  3F6M A;  1W59 A;  4EI9 A;  5CB4 B;  4O4J A;  1NJI H;  1T0K B;  3N2G A;  4LNU B;  4WBN A;  4ZI7 A;  2JNB A;  4ZOL B;  3JAT A;  1VQ9 F;  1W5A A;  2ZVY A;  5BMV A;  5EB0 A;  2GZL A;  3WGN A;  3KIZ A;  1VQN F;  3PLA C;  4BT2 A;  3Q8H A;  2HS4 A;  5IJ0 A;  1KD1 H;  1J7H A;  3I7T A;  4X1Y B;  1U3L A;  3HKD A;  5EYP B;  3VIU A;  3ESJ A;  3VYS C;  4TUY A;  1K8A H;  1JY8 A;  1TUB B;  4IHJ A;  4X1K A;  3G6E F;  1DBF A;  3G4S F;  5EB1 B;  1XHO A;  5EIB C;  1Q81 H;  2EWC A;  3HKC A;  2Z1T A;  3QTY A;  5JQG A;  2AIZ P;  5J2T A;  4RHA A;  2UYP A;  1FSZ A;  2FGY A;  4G4V A;  3LDT A;  3VMF B;  5GAP K;  4EI8 A;  3CD6 F;  1Z5V A;  4O2A B;  1FFX B;  1GO0 A;  3OON A;  1W42 A;  3VOA A;  4DRX B;  2HP3 A;  5ITZ B;  2HS0 A;  1JFF B;  3P10 A;  2KTV A;  5LYJ A;  1T0A A;  4E6E A;  5KMG B;  4I4T B;  1K73 H;  1VQ7 F;  3CC2 F;  2Z1E A;  2H8E A;  4KWE A;  3NK7 A;  3RA5 A;  3VI6 A;  5LOV B;  1JJ2 F;  5CA0 B;  3ELC A;  4TV9 A;  3DC2 A;  3HKB B;  2AMT A;  4O4L A;  2H6L A;  3SIU A;  3VO8 A;  5IYZ A;  1KC8 H;  3JAR B;  3RYI B;  5FJ4 C;  4BT6 A;  3K2X A;  1NQ3 A;  3TD4 A;  3NVI B;  4C8E A;  3SIV A;  2VAP A;  1JN1 A;  3J80 M;  1QVF F;  3C9R A;  1VQO F;  4LCK A;  2HP0 A;  1YIJ F;  5EAZ A;  2Z01 A;  3HKE B;  3IKE A;  1VQ5 F;  3V7E A;  3GHZ A;  2CZW A;  2VAW A;  1TVK A;  3WJP A;  4I50 B;  2UYJ A;  1RLG A;  3UT5 B;  5HWE A;  2HQS C;  4BVQ A;  3CCE F;  2ZOV A;  3JAW A;  3IMP A;  3LWV C;  3ZP7 A;  2I6R A;  2ZOD A;  4TV8 A;  3JAL A;  3HWU A;  5C8Y B;  3IEW A;  5JH7 B;  3WGK A;  3CME F;  5LXT B;  3C9U A;  5FNV B;  4C8G A;  4F6R B;  5GIO C;  2UZH A;  3WPX A;  2KG4 A;  2LBX A;  1K9M H;  5JVD B;  3I55 F;  1QD9 A;  2W8B C;  3NMU C;  1SZQ A;  4X20 A;  3V4D A;  3N2K A;  1QU9 A;  3E22 B;  3WJQ A;  2HRY A;  3HTN A;  2QI2 A;  2I6D A;  3EOR A;  3CYP B;  4O4H B;  3F0E A;  1GX1 A;  3RYC B;  1UI9 A;  3OBY A;  4ERH A;  5IT9 M;  2H8C A;  1IV3 A;  1H7M A;  1W40 A;  1SA0 B;  3ERN A;  4ZHV A;  5MN6 A;  3J7A R;  3HAX D;  3S06 A;  2B33 A;  5GON A;  3RYF B;  4FFB A;  3WPW A;  2V9Y A;  3I56 F;  3AGK A;  1QVG F;  3N4Z A;  1VQ8 F;  3BYQ A;  1UFY A;  3CYQ A;  1VQ6 F;  5MN4 A;  4NWO B;  3CCJ F;  3FFM A;  5HXU A;  3M1X A;  5J2U B;  4ZHW A;  3CG6 A;  4X3M A;  4O4J B;  5LP6 C;  1M1K H;  4LNU A;  3VOB A;  4YJ3 B;  2Q1X A;  4B46 A;  4ZOL A;  2CW4 A;  2KGW A;  5IJ0 B;  2NMU A;  1QAH A;  3CMA F;  4X3L A;  5EZY A;  3HKD B;  2MQE A;  1W58 1;  4TUY B;  1KNK A;  2RB9 A;  5HXZ A;  4X1K B;  3CCM F;  2LCA A;  2GVI A;  1TUB A;  1IPA A;  3R0P A;  1W5F A;  2LBW A;  1OAP A;  3HKC B;  4BT5 A;  5JCO C;  4U3J B;  3VYU C;  4X1I B;  3K0T A;  4G4Z A;  4RQO A;  3VYT C;  3WXM B;  5HY2 A;  2F9Z C;  1E7K A;  5LYJ B;  4O2B B;  5KX5 B;  4DRX A;  4DXD A;  1JFF A;  3NK6 A;  1YQN A;  4NUT A;  4I4T A;  4B62 A;  1PXW A;  5KMG A;  1SDS A;  4O4I A;  3D00 A;  3F0D A;  3VCZ A;  4PWT A;  3KE1 A;  5B8F A;  4B45 A;  1IV2 A;  1PF5 A;  4O4L B;  1X52 A;  4G4W A;  2CSL A;  3L7Q A;  1X25 A;  5IYZ B;  1FNJ A;  5A2Q M;  3V7Q A;  3RA6 A;  4C81 A;  5HY4 A;  3JAR A;  3RYI A;  4BVS A;  3MCA B;  4BT4 A;  4G4X A;  2HP0 B;  2VAM A;  3K12 A;  1DT9 A;  5IJ9 A;  5LP6 B;  4EB6 B;  5HP8 A;  3OW2 F;  3JAS A;  3ON1 A;  3WGM A;  3IEQ A;  4U39 A;  4BT3 A;  1NMU B;  1YGY A;  3RE3 A;  5GAN K;  1VQ4 F;  1FNK A;  4I50 A;  1IV1 A;  4M8I A;  2CHT A;  3KJK A;  3MQW A;  3HJW C;  1RA4 A;  4TV8 B;  2PMP A;  1Q82 H;  3JAK B;  2HS3 A;  2LBT A;  3I3F A;  2R6R 1;  2WAL A;  3LFO A;  1H47 A;  1YI2 F;  2OTM A;  5LA6 B;  1Q86 H;  4ZHQ B;  1XRG A;  2RHL A;  5LXT A;  3FD5 A;  1W5E A;  2Z1F A;  4X20 B;  5CA1 A;  5GIP C;  3N2K B;  3CCS F;  1ONI A;  3FD6 A;  3JCM M;  3P4E A;  3P0Z A;  3CCR F;  3O85 A;  1COM A;  4IIJ B;  1XBI A;  4I55 A;  3RYC A;  1KNJ A;  1W57 A;  2UYN A;  4YJ2 B;  5GIN C;  4BW0 B;  3E1Y A;  1W55 A;  2VGM A;  2VGN A;  1OFU A;  2QTP A;  4G4Y A;  4HNA A;  3RYF A;  2Q1Y A;  1YIT F;  3PAF A;  1GZ0 A;  1S72 F;  5DCV A;  2YYE A;  1H48 A;  2YXZ A;  3GYQ A;  3RYH A;  4C82 A;  3N2G B;  5HP7 A;  1Q7Y H;  4WBN B;  4BVT A;  4ZI7 B;  5CB4 A;  4BT7 A;  3JAT B; 
#chains in the Genus database with same CATH homology
 3IKE A;  1JY8 A;  2PMP A;  4C81 A;  3GHZ A;  3MBM A;  3T80 A;  1U40 A;  3FBA A;  3FPI A;  1KNJ A;  1W57 A;  3F0F A;  3ELC A;  3F0G A;  3F6M A;  1H47 A;  1IV4 A;  3B6N A;  1YQN A;  3EOR A;  2AMT A;  1KNK A;  1W55 A;  3F0D A;  3IKF A;  1U3P A;  3K14 A;  1U43 A;  3KE1 A;  5B8F A;  3F0E A;  3IEQ A;  1GX1 A;  3QHD A;  1IV2 A;  3K2X A;  2GZL A;  3JVH A;  3RE3 A;  3IEW A;  3P10 A;  3Q8H A;  1JN1 A;  4C8E A;  4C8I A;  1IV3 A;  1H48 A;  1T0A A;  4C82 A;  1VHA A;  1IV1 A;  1U3L A;  3ERN A;  1VH8 A;  3ESJ A;  3P0Z A;  4C8G A;  2UZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...