1M90H

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m90H00
2KTUA 3LWOC 1QVFF 3E20B 3G71F 3CXCF 1YIJF 3LWPC 1PXWA 1T0KB 3RA6A 3JCMM 1NMUB 1KC8H 2VGNA 3CPWF 1VQNF 1IPAA 1M90H 4BW0B 2LBWA 3NVKE 1XBIA 2AIFA 3OBWA 3RA5A 3CCUF 1VQPF 3AGKA 1N8RH 5EWRA 1CN7A 2KTVA 2OZBA 5EO3A 2BO1A 3I55F 1E7KA 1H7MA 3VMFB 3CC7F 4NUTA 1NJIH 2VGMA 3PLAC 1CK2A 2OTLF 2LBXA 1Q86H 1K73H 3JAMM 2OHWA 5DCVA 3CCSF 1VQOF 3SIUA 3G4SF 1W41A 4BY9D 3N4ZA 1X52A 3LWRC 1ZWZA 3NK7A 1S72F 1W3EX 3OBYA 1VQ8F 5G4VC 3N4YA 3MCAB 1VQ4F 1X7PA 1W2BF 1VQ9F 3OW2F 1YHQF 3WXMB 2FC3A 5FJ4C 3V7EA 1YJ9F 1VQMF 3I56F 3CCRF 3LWVC 2ALEA 3CC4F 2JNBA 3NVIB 3FFMA 1KQSF 3VI6A 3CC2F 3LFOA 3NK6A 2CZWA 3CD6F 3J7AR 2OTJF 5GIOC 3CPQA 1JJ2F 1QVGF 1VQKF 1RA4A 1K8AH 3O85A 3E1YA 1YJNF 3IR9A 1KD1H 3HJWC 4TZZA 4X3LA 3ON1A 1Q81H 3CCMF 4X3MA 3CMEF 1YITF 3HAXD 3LWQC 3J80M 1GZ0A 1W42A 5A2QM 3V7QA 3GYQA 1VQ5F 1M1KH 1SDSA 5GAPK 1VQ7F 2KG4A 5G4UC 1YI2F 3CCEF 1W40A 3CG6A 3PAFA 3G6EF 1X7OA 1GO1A 1K9MH 1VQ6F 2QA4F 5GANK 2QEXF 2WALA 5FLXM 3NMUC 3CCVF 1GO0A 5GIPC 2HVYD 3J81M 4LCKA 2I6DA 2QI2A 1Q82H 1YJWF 1VQLF 3CCLF 5GINC 1RLGA 3SIVA 4C4WC 3CCJF 3CCQF 3CMAF 1Q7YH 1DT9A 5IT9M
chains in the Genus database with same CATH superfamily
3LWOC 3F0EA 1QVFF 1VH8A 3LYBA 3C9RA 3CPWF 1VQNF 2ZF8A 3DDNA 3EORA 3CB2A 5CB4B 3NVKE 3CCUF 3RA5A 4ZHVA 3RYIA 2YYEA 3KJJA 3S0HA 4O2BA 4C81A 5HY0A 2OZBA 5KMGB 5EO3A 4C82A 4X20B 1NJIH 4G4WA 2OTLF 2OHWA 1IV2A 1VQOF 1W57A 3SIUA 3M84A 5LXTA 3G4SF 5EZYA 4ZHWA 2Z1TA 4RQOA 3N4ZA 3WJPA 3LWRC 3NK7A 2P6YA 2UYJA 5IJ9A 2RHOA 5G4VC 3N4YA 5J2UB 4X1KB 1X7PA 3C9TA 4IHJB 1YQNA 2PMPA 3WXMB 5JH7B 1QAHA 3JARA 3U0OA 4F6RA 3GTZA 3WJQA 1YGYA 3MQWA 2JNBA 3D01A 3NVIB 4G4XA 3JASA 3JATA 2AMTA 5ITZB 3ESJA 3ERNA 3F0DA 2IQQA 3CD6F 5LOVA 2ZAUA 1SA0A 3P10A 3ZP7A 5BMVB 1W5AA 1TUBA 1RA4A 3WGLA 5LYJA 2BTOA 3GHZA 3K14A 4G4YA 5HXUA 1KD1H 5EYPB 3K12A 1Z5VA 3CCMF 4X3MA 5FNVB 5LA6A 2HS4A 1YITF 4C8IA 3K0TA 1GX1A 1GZ0A 1FSZA 1VHAA 3RYCB 1U40A 4DRXA 1JN1A 2FGYA 5GAPK 3FD5A 2KG4A 3R0PA 4I55A 5MN5A 1TUBB 3CCEF 3CG6A 4B5CA 4WBNA 3PAFA 1RQ7A 2VXYA 1X7OA 3VYTC 5EAZA 5EYPA 5JCOC 2HRYA 2CHSA 3ZO8A 5FNVA 5LA6B 3HTNA 5FLXM 3HKCB 5GIPC 1FFXB 1Q82H 1YJWF 1W5EA 1VQLF 1T0AA 3HKBA 2CW4A 5GINC 3SIVA 5KMGA 4C4WC 3Q8HA 3CCJF 4WBNB 3CMAF 4EB6A 2BTQB 1PF5A 1Q7YH 5IT9M 2VAWA 2HP0A 1U3LA 3CXCF 1YIJF 1PXWA 3RA6A 4G88A 5AVMA 1NMUB 3TD4A 1KC8H 3HWUA 4KWEA 4U3JA 4EI9A 5GONB 2LBWA 3IEQA 1VK3A 3OBWA 4BVQA 5IJ9B 3AGKA 5EWRA 3M4SA 3QTYA 4BT3A 4BT5A 3I55F 2BTUA 1H7MA 3VMFB 4IIJA 4ZOLB 3JARB 3PLAC 2LBXA 3C8LA 2Z1EA 3JAMM 5HP8A 1X52A 1R1MA 1OAPA 1UI9A 3OBYA 5ITZA 4U39A 2B33A 4YJ2A 1W2BF 2LBTA 4IIJB 3L7QA 2FC3A 2RHLA 2R6R1 2UYPA 2YXZA 5KX5B 5FJ4C 1TVKA 4YJ3A 3JAKA 3D54A 4EI7A 3N2GB 3CCRF 2ALEA 3N2KB 3FFMA 3CYPB 5EB0A 3RYFA 3LFOA 2CVLA 2R751 4ERHA 1FNJA 3VOAA 4BVRA 3RYCA 4X1KA 5GIOC 3CPQA 4YJ2B 3HKEA 2ZOVA 5LP6B 3KIZA 2H8EA 3TD3A 2Z1FA 2OTMA 5IJ0B 4O4JB 3WPWA 3LDTA 4TUYB 4BT4A 1VQVA 1Q8RA 1COMA 1YJNF 3JAWA 5HWEA 1W55A 4XCQA 2DT4A 5JVDB 4O2AB 3ELCA 3HAXD 3LWQC 5EIBC 3V7QA 3GYQA 1M1KH 4R40B 4TV8B 3HKBB 3VCZA 1JY8A 1SA0B 3IKFA 2G9IA 4O4IB 4DXDA 2Q1YA 2ZVZA 3LMEA 4ZK7A 2HQSC 1JFFB 4ZHQB 3K2XA 1K9MH 3WGKA 3ZP4A 1NQ3A 1W581 1U3PA 1VQ6F 5MN4A 5GANK 2QEXF 3MDOA 3RE3A 5JCOA 5CA1A 3CCVF 3VTIC 5C8YA 3ZOPA 2VAMA 2HVYD 3J81M 3JALB 3C9SA 5HP7A 4I4TA 3DC2A 2MQEA 3JVHA 3HJWC 2KTUA 4TV9A 4FFBB 5EIBD 2L26A 4LNUA 3G71F 3QHDA 3LWPC 1T0KB 3JCMM 4X1IA 2GZLA 2VGNA 1IPAA 3BYQA 2RHHA 5B8FA 3VOBA 1XBIA 1VQPF 1N8RH 4G4ZA 2RB9A 1CN7A 2KTVA 4I4TB 4M8IA 3IEWA 2H6LA 3V3TA 4BVSA 4FFBA 1CK2A 4B45A 1TVKB 5DCVA 2CWJA 4BT6A 3CCSF 2AIZP 1W41A 3P0ZA 1J7HA 1S72F 5CB4A 4C8EA 2NMUA 3RYIB 3M1XA 3MCAB 1VQ9F 3HKEB 5LP6A 2Z01A 4I50B 2K1SA 2V9YA 3OW2F 2IAFA 4O4JA 2Z1UA 3P4EA 4BT7A 3FBAA 4TUYA 3F0FA 4C8GA 3KE1A 3JAWB 5EZYB 3LWVC 2QTPA 4B62A 1FNKA 1W59A 2Q1XA 3CC2F 3B6NA 2GLZA 1KNJA 3UT5B 2HS3A 4BT2A 3E22A 1JJ2F 4TV8A 1UFYA 4HNAB 4I50A 5J2TB 5JH7A 4F6RB 5HY4A 4NQ3A 3T80A 3JAKB 1ODEA 3IR9A 3VYSC 3MCQA 4ZI7B 1Q81H 1KNKA 3RYFB 2UYKA 3UT5A 3CMEF 5C8YB 3J80M 1U43A 1FFXA 1SDSA 2ZVYA 3WGMA 5BMVA 5G4UC 3HKDA 4EI8A 1YI2F 1W40A 4X1YB 2PHNA 1H47A 5LYJB 3V4DA 1GO1A 5IYZA 3IKEA 4ZI7A 3S03A 2QA4F 4G4VA 1RQ2A 3QUWA 4O2AA 5JVDA 1H48A 4RHAA 1GO0A 2HS0A 1ONIA 4LCKA 2QI2A 1IV3A 4O4IA 1DBFA 5JQGB 1JFFA 4ZHQA 2GVIA 1DT9A 1QU9A 5IYZB 4ZOLA 2UYNA 4B46A 3E20B 4O4LB 5MN6A 3VO8A 5LXTB 3IMPA 5CA1B 1M90H 4NWOB 4BW0B 1QD9A 2EWCA 3JALA 1XV2A 2AIFA 5J2UA 3MBMA 4ZHYB 4IHJA 2BO1A 1E7KA 4EB6B 3CC7F 4NUTA 2KGWA 5KX5A 2VGMA 2VAPA 1Q86H 1K73H 4YJ3B 2HP0B 4O4LA 3S0WA 2H8CA 1X25A 3OONA 3WGJA 1XRGA 4BY9D 3N2KA 3S02A 1IV1A 1ZWZA 1W3EX 5EB1B 5CA0A 1VQ8F 2HRUA 5LP6C 3VYUC 3E22B 5LOVB 3VIUA 1CLIA 1YHQF 1OFUA 2CHTA 3V7EA 3D00A 2ZODA 3TD5A 1YJ9F 1VQMF 2CSLA 1RLUA 2RHJA 3I56F 3I7TA 3CC4F 3KHNA 1W5FA 1KQSF 3VI6A 1W5BA 2CZWA 3NK6A 3S06A 4E6EA 5CA0B 3J7AR 2OTJF 3I3FA 1QVGF 3RYHB 1JD1A 4I55B 1VQKF 2IG8A 4X1YA 2LCAA 4O4HA 4BVTA 1K8AH 3O85A 3E1YA 3FPIA 4PWTA 3CYQA 3F6MA 2N48A 3N2GA 3WJRA 4TZZA 4X3LA 3ON1A 1Z5WA 3JASB 2HP3A 3JATB 2I6RA 3HKCA 5HY2A 1W42A 5A2QM 1VQ5F 3WGNA 2UZHA 3WPXA 4HNAA 5J2TA 3RYHA 1VQ7F 5IJ0A 5JQGA 2W8BC 4O4HB 3G6EF 5HXZA 1SZQA 4TV9B 2UYNB 3S0YA 3F0GA 4LNUB 1XHOA 3C9UA 3FD6A 3KJKA 2WALA 4X1IB 2HX0A 4U3JB 3NMUC 5GONA 2I6DA 4DRXB 3CCLF 1IV4A 2DYYA 1RLGA 3HKDB 4O2BB 5HY1A 2F9ZC 3CCQF 4X20A 1VQ4F
chains in the Genus database with same CATH topology
2KTUA 3LWOC 1QVFF 3E20B 3G71F 3CXCF 1YIJF 3LWPC 1PXWA 1T0KB 3RA6A 3JCMM 1NMUB 1KC8H 2VGNA 3CPWF 1VQNF 1IPAA 1M90H 4EI9A 4BW0B 2LBWA 3NVKE 1XBIA 2AIFA 3OBWA 3RA5A 4BVQA 3CCUF 3AGKA 1VQPF 1N8RH 5EWRA 1CN7A 2KTVA 5HY0A 2OZBA 5EO3A 2BO1A 3I55F 1E7KA 1H7MA 3VMFB 3CC7F 4NUTA 1NJIH 3V3TA 2VGMA 4BVSA 1CK2A 2OTLF 2LBXA 3PLAC 1Q86H 1K73H 3JAMM 2OHWA 5DCVA 3CCSF 1VQOF 3SIUA 3G4SF 1W41A 4BY9D 3N4ZA 1X52A 3LWRC 1ZWZA 3NK7A 1S72F 1W3EX 3OBYA 1VQ8F 5G4VC 3N4YA 3MCAB 1VQ4F 1X7PA 1W2BF 1VQ9F 3OW2F 1YHQF 3WXMB 2FC3A 5FJ4C 3V7EA 3D00A 1YJ9F 1VQMF 4EI7A 3I56F 3CCRF 2ALEA 3LWVC 3CC4F 2JNBA 3NVIB 3FFMA 1KQSF 3VI6A 3CC2F 3LFOA 3NK6A 2CZWA 2GLZA 4BVRA 3CD6F 3J7AR 2OTJF 5GIOC 3CPQA 1JJ2F 1QVGF 1VQKF 1RA4A 4BVTA 1K8AH 3O85A 5HY4A 3E1YA 4NQ3A 1YJNF 5HXUA 3IR9A 1KD1H 3HJWC 5HWEA 4TZZA 4X3LA 3ON1A 4XCQA 1Q81H 3CCMF 4X3MA 3CMEF 1YITF 3HAXD 5HY2A 1GZ0A 1W42A 3J80M 5A2QM 3V7QA 3GYQA 3LWQC 1VQ5F 1M1KH 1SDSA 2FGYA 5GAPK 1VQ7F 2KG4A 5G4UC 1YI2F 4EI8A 3CCEF 1W40A 3CG6A 3PAFA 3G6EF 1X7OA 1GO1A 5HXZA 1K9MH 1VQ6F 2QA4F 5GANK 2QEXF 2WALA 5FLXM 3NMUC 3CCVF 1GO0A 5GIPC 2HVYD 3J81M 4LCKA 2I6DA 2QI2A 1Q82H 1YJWF 1VQLF 3CCLF 5GINC 1RLGA 5HY1A 3SIVA 4C4WC 2F9ZC 3CCJF 3CCQF 3CMAF 1Q7YH 1DT9A 5IT9M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KTU A;  3LWO C;  1QVF F;  3E20 B;  3G71 F;  3CXC F;  1YIJ F;  3LWP C;  1PXW A;  1T0K B;  3RA6 A;  3JCM M;  1NMU B;  1KC8 H;  2VGN A;  3CPW F;  1VQN F;  1IPA A;  1M90 H;  4BW0 B;  2LBW A;  3NVK E;  1XBI A;  2AIF A;  3OBW A;  3RA5 A;  3CCU F;  1VQP F;  3AGK A;  1N8R H;  5EWR A;  1CN7 A;  2KTV A;  2OZB A;  5EO3 A;  2BO1 A;  3I55 F;  1E7K A;  1H7M A;  3VMF B;  3CC7 F;  4NUT A;  1NJI H;  2VGM A;  3PLA C;  1CK2 A;  2OTL F;  2LBX A;  1Q86 H;  1K73 H;  3JAM M;  2OHW A;  5DCV A;  3CCS F;  1VQO F;  3SIU A;  3G4S F;  1W41 A;  4BY9 D;  3N4Z A;  1X52 A;  3LWR C;  1ZWZ A;  3NK7 A;  1S72 F;  1W3E X;  3OBY A;  1VQ8 F;  5G4V C;  3N4Y A;  3MCA B;  1VQ4 F;  1X7P A;  1W2B F;  1VQ9 F;  3OW2 F;  1YHQ F;  3WXM B;  2FC3 A;  5FJ4 C;  3V7E A;  1YJ9 F;  1VQM F;  3I56 F;  3CCR F;  3LWV C;  2ALE A;  3CC4 F;  2JNB A;  3NVI B;  3FFM A;  1KQS F;  3VI6 A;  3CC2 F;  3LFO A;  3NK6 A;  2CZW A;  3CD6 F;  3J7A R;  2OTJ F;  5GIO C;  3CPQ A;  1JJ2 F;  1QVG F;  1VQK F;  1RA4 A;  1K8A H;  3O85 A;  3E1Y A;  1YJN F;  3IR9 A;  1KD1 H;  3HJW C;  4TZZ A;  4X3L A;  3ON1 A;  1Q81 H;  3CCM F;  4X3M A;  3CME F;  1YIT F;  3HAX D;  3LWQ C;  3J80 M;  1GZ0 A;  1W42 A;  5A2Q M;  3V7Q A;  3GYQ A;  1VQ5 F;  1M1K H;  1SDS A;  5GAP K;  1VQ7 F;  2KG4 A;  5G4U C;  1YI2 F;  3CCE F;  1W40 A;  3CG6 A;  3PAF A;  3G6E F;  1X7O A;  1GO1 A;  1K9M H;  1VQ6 F;  2QA4 F;  5GAN K;  2QEX F;  2WAL A;  5FLX M;  3NMU C;  3CCV F;  1GO0 A;  5GIP C;  2HVY D;  3J81 M;  4LCK A;  2I6D A;  2QI2 A;  1Q82 H;  1YJW F;  1VQL F;  3CCL F;  5GIN C;  1RLG A;  3SIV A;  4C4W C;  3CCJ F;  3CCQ F;  3CMA F;  1Q7Y H;  1DT9 A;  5IT9 M; 
#chains in the Genus database with same CATH topology
 3LWO C;  3F0E A;  1QVF F;  1VH8 A;  3LYB A;  3C9R A;  3CPW F;  1VQN F;  2ZF8 A;  3DDN A;  3EOR A;  3CB2 A;  5CB4 B;  3NVK E;  3CCU F;  3RA5 A;  4ZHV A;  3RYI A;  2YYE A;  3KJJ A;  3S0H A;  4O2B A;  4C81 A;  5HY0 A;  2OZB A;  5KMG B;  5EO3 A;  4C82 A;  4X20 B;  1NJI H;  4G4W A;  2OTL F;  2OHW A;  1IV2 A;  1VQO F;  1W57 A;  3SIU A;  3M84 A;  5LXT A;  3G4S F;  5EZY A;  4ZHW A;  2Z1T A;  4RQO A;  3N4Z A;  3WJP A;  3LWR C;  3NK7 A;  2P6Y A;  2UYJ A;  5IJ9 A;  2RHO A;  5G4V C;  3N4Y A;  5J2U B;  4X1K B;  1X7P A;  3C9T A;  4IHJ B;  1YQN A;  2PMP A;  3WXM B;  5JH7 B;  1QAH A;  3JAR A;  3U0O A;  4F6R A;  3GTZ A;  3WJQ A;  1YGY A;  3MQW A;  2JNB A;  3D01 A;  3NVI B;  4G4X A;  3JAS A;  3JAT A;  2AMT A;  5ITZ B;  3ESJ A;  3ERN A;  3F0D A;  2IQQ A;  3CD6 F;  5LOV A;  2ZAU A;  1SA0 A;  3P10 A;  3ZP7 A;  5BMV B;  1W5A A;  1TUB A;  1RA4 A;  3WGL A;  5LYJ A;  2BTO A;  3GHZ A;  3K14 A;  4G4Y A;  5HXU A;  1KD1 H;  5EYP B;  3K12 A;  1Z5V A;  3CCM F;  4X3M A;  5FNV B;  5LA6 A;  2HS4 A;  1YIT F;  4C8I A;  3K0T A;  1GX1 A;  1GZ0 A;  1FSZ A;  1VHA A;  3RYC B;  1U40 A;  4DRX A;  1JN1 A;  2FGY A;  5GAP K;  3FD5 A;  2KG4 A;  3R0P A;  4I55 A;  5MN5 A;  1TUB B;  3CCE F;  3CG6 A;  4B5C A;  4WBN A;  3PAF A;  1RQ7 A;  2VXY A;  1X7O A;  3VYT C;  5EAZ A;  5EYP A;  5JCO C;  2HRY A;  2CHS A;  3ZO8 A;  5FNV A;  5LA6 B;  3HTN A;  5FLX M;  3HKC B;  5GIP C;  1FFX B;  1Q82 H;  1YJW F;  1W5E A;  1VQL F;  1T0A A;  3HKB A;  2CW4 A;  5GIN C;  3SIV A;  5KMG A;  4C4W C;  3Q8H A;  3CCJ F;  4WBN B;  3CMA F;  4EB6 A;  2BTQ B;  1PF5 A;  1Q7Y H;  5IT9 M;  2VAW A;  2HP0 A;  1U3L A;  3CXC F;  1YIJ F;  1PXW A;  3RA6 A;  4G88 A;  5AVM A;  1NMU B;  3TD4 A;  1KC8 H;  3HWU A;  4KWE A;  4U3J A;  4EI9 A;  5GON B;  2LBW A;  3IEQ A;  1VK3 A;  3OBW A;  4BVQ A;  5IJ9 B;  3AGK A;  5EWR A;  3M4S A;  3QTY A;  4BT3 A;  4BT5 A;  3I55 F;  2BTU A;  1H7M A;  3VMF B;  4IIJ A;  4ZOL B;  3JAR B;  3PLA C;  2LBX A;  3C8L A;  2Z1E A;  3JAM M;  5HP8 A;  1X52 A;  1R1M A;  1OAP A;  1UI9 A;  3OBY A;  5ITZ A;  4U39 A;  2B33 A;  4YJ2 A;  1W2B F;  2LBT A;  4IIJ B;  3L7Q A;  2FC3 A;  2RHL A;  2R6R 1;  2UYP A;  2YXZ A;  5KX5 B;  5FJ4 C;  1TVK A;  4YJ3 A;  3JAK A;  3D54 A;  4EI7 A;  3N2G B;  3CCR F;  2ALE A;  3N2K B;  3FFM A;  3CYP B;  5EB0 A;  3RYF A;  3LFO A;  2CVL A;  2R75 1;  4ERH A;  1FNJ A;  3VOA A;  4BVR A;  3RYC A;  4X1K A;  5GIO C;  3CPQ A;  4YJ2 B;  3HKE A;  2ZOV A;  5LP6 B;  3KIZ A;  2H8E A;  3TD3 A;  2Z1F A;  2OTM A;  5IJ0 B;  4O4J B;  3WPW A;  3LDT A;  4TUY B;  4BT4 A;  1VQV A;  1Q8R A;  1COM A;  1YJN F;  3JAW A;  5HWE A;  1W55 A;  4XCQ A;  2DT4 A;  5JVD B;  4O2A B;  3ELC A;  3HAX D;  3LWQ C;  5EIB C;  3V7Q A;  3GYQ A;  1M1K H;  4R40 B;  4TV8 B;  3HKB B;  3VCZ A;  1JY8 A;  1SA0 B;  3IKF A;  2G9I A;  4O4I B;  4DXD A;  2Q1Y A;  2ZVZ A;  3LME A;  4ZK7 A;  2HQS C;  1JFF B;  4ZHQ B;  3K2X A;  1K9M H;  3WGK A;  3ZP4 A;  1NQ3 A;  1W58 1;  1U3P A;  1VQ6 F;  5MN4 A;  5GAN K;  2QEX F;  3MDO A;  3RE3 A;  5JCO A;  5CA1 A;  3CCV F;  3VTI C;  5C8Y A;  3ZOP A;  2VAM A;  2HVY D;  3J81 M;  3JAL B;  3C9S A;  5HP7 A;  4I4T A;  3DC2 A;  2MQE A;  3JVH A;  3HJW C;  2KTU A;  4TV9 A;  4FFB B;  5EIB D;  2L26 A;  4LNU A;  3G71 F;  3QHD A;  3LWP C;  1T0K B;  3JCM M;  4X1I A;  2GZL A;  2VGN A;  1IPA A;  3BYQ A;  2RHH A;  5B8F A;  3VOB A;  1XBI A;  1VQP F;  1N8R H;  4G4Z A;  2RB9 A;  1CN7 A;  2KTV A;  4I4T B;  4M8I A;  3IEW A;  2H6L A;  3V3T A;  4BVS A;  4FFB A;  1CK2 A;  4B45 A;  1TVK B;  5DCV A;  2CWJ A;  4BT6 A;  3CCS F;  2AIZ P;  1W41 A;  3P0Z A;  1J7H A;  1S72 F;  5CB4 A;  4C8E A;  2NMU A;  3RYI B;  3M1X A;  3MCA B;  1VQ9 F;  3HKE B;  5LP6 A;  2Z01 A;  4I50 B;  2K1S A;  2V9Y A;  3OW2 F;  2IAF A;  4O4J A;  2Z1U A;  3P4E A;  4BT7 A;  3FBA A;  4TUY A;  3F0F A;  4C8G A;  3KE1 A;  3JAW B;  5EZY B;  3LWV C;  2QTP A;  4B62 A;  1FNK A;  1W59 A;  2Q1X A;  3CC2 F;  3B6N A;  2GLZ A;  1KNJ A;  3UT5 B;  2HS3 A;  4BT2 A;  3E22 A;  1JJ2 F;  4TV8 A;  1UFY A;  4HNA B;  4I50 A;  5J2T B;  5JH7 A;  4F6R B;  5HY4 A;  4NQ3 A;  3T80 A;  3JAK B;  1ODE A;  3IR9 A;  3VYS C;  3MCQ A;  4ZI7 B;  1Q81 H;  1KNK A;  3RYF B;  2UYK A;  3UT5 A;  3CME F;  5C8Y B;  3J80 M;  1U43 A;  1FFX A;  1SDS A;  2ZVY A;  3WGM A;  5BMV A;  5G4U C;  3HKD A;  4EI8 A;  1YI2 F;  1W40 A;  4X1Y B;  2PHN A;  1H47 A;  5LYJ B;  3V4D A;  1GO1 A;  5IYZ A;  3IKE A;  4ZI7 A;  3S03 A;  2QA4 F;  4G4V A;  1RQ2 A;  3QUW A;  4O2A A;  5JVD A;  1H48 A;  4RHA A;  1GO0 A;  2HS0 A;  1ONI A;  4LCK A;  2QI2 A;  1IV3 A;  4O4I A;  1DBF A;  5JQG B;  1JFF A;  4ZHQ A;  2GVI A;  1DT9 A;  1QU9 A;  5IYZ B;  4ZOL A;  2UYN A;  4B46 A;  3E20 B;  4O4L B;  5MN6 A;  3VO8 A;  5LXT B;  3IMP A;  5CA1 B;  1M90 H;  4NWO B;  4BW0 B;  1QD9 A;  2EWC A;  3JAL A;  1XV2 A;  2AIF A;  5J2U A;  3MBM A;  4ZHY B;  4IHJ A;  2BO1 A;  1E7K A;  4EB6 B;  3CC7 F;  4NUT A;  2KGW A;  5KX5 A;  2VGM A;  2VAP A;  1Q86 H;  1K73 H;  4YJ3 B;  2HP0 B;  4O4L A;  3S0W A;  2H8C A;  1X25 A;  3OON A;  3WGJ A;  1XRG A;  4BY9 D;  3N2K A;  3S02 A;  1IV1 A;  1ZWZ A;  1W3E X;  5EB1 B;  5CA0 A;  1VQ8 F;  2HRU A;  5LP6 C;  3VYU C;  3E22 B;  5LOV B;  3VIU A;  1CLI A;  1YHQ F;  1OFU A;  2CHT A;  3V7E A;  3D00 A;  2ZOD A;  3TD5 A;  1YJ9 F;  1VQM F;  2CSL A;  1RLU A;  2RHJ A;  3I56 F;  3I7T A;  3CC4 F;  3KHN A;  1W5F A;  1KQS F;  3VI6 A;  1W5B A;  2CZW A;  3NK6 A;  3S06 A;  4E6E A;  5CA0 B;  3J7A R;  2OTJ F;  3I3F A;  1QVG F;  3RYH B;  1JD1 A;  4I55 B;  1VQK F;  2IG8 A;  4X1Y A;  2LCA A;  4O4H A;  4BVT A;  1K8A H;  3O85 A;  3E1Y A;  3FPI A;  4PWT A;  3CYQ A;  3F6M A;  2N48 A;  3N2G A;  3WJR A;  4TZZ A;  4X3L A;  3ON1 A;  1Z5W A;  3JAS B;  2HP3 A;  3JAT B;  2I6R A;  3HKC A;  5HY2 A;  1W42 A;  5A2Q M;  1VQ5 F;  3WGN A;  2UZH A;  3WPX A;  4HNA A;  5J2T A;  3RYH A;  1VQ7 F;  5IJ0 A;  5JQG A;  2W8B C;  4O4H B;  3G6E F;  5HXZ A;  1SZQ A;  4TV9 B;  2UYN B;  3S0Y A;  3F0G A;  4LNU B;  1XHO A;  3C9U A;  3FD6 A;  3KJK A;  2WAL A;  4X1I B;  2HX0 A;  4U3J B;  3NMU C;  5GON A;  2I6D A;  4DRX B;  3CCL F;  1IV4 A;  2DYY A;  1RLG A;  3HKD B;  4O2B B;  5HY1 A;  2F9Z C;  3CCQ F;  4X20 A;  1VQ4 F; 
#chains in the Genus database with same CATH homology
 2KTU A;  3LWO C;  1QVF F;  3E20 B;  3G71 F;  3CXC F;  1YIJ F;  3LWP C;  1PXW A;  1T0K B;  3RA6 A;  3JCM M;  1NMU B;  1KC8 H;  2VGN A;  3CPW F;  1VQN F;  1IPA A;  1M90 H;  4EI9 A;  4BW0 B;  2LBW A;  3NVK E;  1XBI A;  2AIF A;  3OBW A;  3RA5 A;  4BVQ A;  3CCU F;  3AGK A;  1VQP F;  1N8R H;  5EWR A;  1CN7 A;  2KTV A;  5HY0 A;  2OZB A;  5EO3 A;  2BO1 A;  3I55 F;  1E7K A;  1H7M A;  3VMF B;  3CC7 F;  4NUT A;  1NJI H;  3V3T A;  2VGM A;  4BVS A;  1CK2 A;  2OTL F;  2LBX A;  3PLA C;  1Q86 H;  1K73 H;  3JAM M;  2OHW A;  5DCV A;  3CCS F;  1VQO F;  3SIU A;  3G4S F;  1W41 A;  4BY9 D;  3N4Z A;  1X52 A;  3LWR C;  1ZWZ A;  3NK7 A;  1S72 F;  1W3E X;  3OBY A;  1VQ8 F;  5G4V C;  3N4Y A;  3MCA B;  1VQ4 F;  1X7P A;  1W2B F;  1VQ9 F;  3OW2 F;  1YHQ F;  3WXM B;  2FC3 A;  5FJ4 C;  3V7E A;  3D00 A;  1YJ9 F;  1VQM F;  4EI7 A;  3I56 F;  3CCR F;  2ALE A;  3LWV C;  3CC4 F;  2JNB A;  3NVI B;  3FFM A;  1KQS F;  3VI6 A;  3CC2 F;  3LFO A;  3NK6 A;  2CZW A;  2GLZ A;  4BVR A;  3CD6 F;  3J7A R;  2OTJ F;  5GIO C;  3CPQ A;  1JJ2 F;  1QVG F;  1VQK F;  1RA4 A;  4BVT A;  1K8A H;  3O85 A;  5HY4 A;  3E1Y A;  4NQ3 A;  1YJN F;  5HXU A;  3IR9 A;  1KD1 H;  3HJW C;  5HWE A;  4TZZ A;  4X3L A;  3ON1 A;  4XCQ A;  1Q81 H;  3CCM F;  4X3M A;  3CME F;  1YIT F;  3HAX D;  5HY2 A;  1GZ0 A;  1W42 A;  3J80 M;  5A2Q M;  3V7Q A;  3GYQ A;  3LWQ C;  1VQ5 F;  1M1K H;  1SDS A;  2FGY A;  5GAP K;  1VQ7 F;  2KG4 A;  5G4U C;  1YI2 F;  4EI8 A;  3CCE F;  1W40 A;  3CG6 A;  3PAF A;  3G6E F;  1X7O A;  1GO1 A;  5HXZ A;  1K9M H;  1VQ6 F;  2QA4 F;  5GAN K;  2QEX F;  2WAL A;  5FLX M;  3NMU C;  3CCV F;  1GO0 A;  5GIP C;  2HVY D;  3J81 M;  4LCK A;  2I6D A;  2QI2 A;  1Q82 H;  1YJW F;  1VQL F;  3CCL F;  5GIN C;  1RLG A;  5HY1 A;  3SIV A;  4C4W C;  2F9Z C;  3CCJ F;  3CCQ F;  3CMA F;  1Q7Y H;  1DT9 A;  5IT9 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...