1M90H

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m90H00
1VQ8F 3SIUA 3JCMM 3NK6A 4BW0B 3FFMA 2QEXF 3LWOC 3CPQA 1K9MH 5EWRA 3E1YA 1T0KB 3RA6A 1ZWZA 1RLGA 5GIPC 1YJ9F 3CXCF 1X7PA 5DCVA 3PLAC 2AIFA 1M1KH 1VQPF 1X52A 2KTUA 3CMEF 3SIVA 1XBIA 1NJIH 5GAPK 3CPWF 4NUTA 5IT9M 1DT9A 3PAFA 3NK7A 3N4ZA 1W40A 1VQ4F 1GZ0A 3CCJF 1CN7A 2KG4A 5G4UC 3NMUC 1VQ5F 4X3LA 3LWQC 1QVFF 2HVYD 1YI2F 4LCKA 3OBYA 1VQNF 2I6DA 3LFOA 3NVIB 3ON1A 2OHWA 5GANK 1PXWA 3OBWA 1VQMF 3G71F 3RA5A 1YHQF 2VGNA 5GIOC 3E20B 3VI6A 1KD1H 3CCEF 3CCMF 2OZBA 1Q86H 3CCRF 3CC2F 1K73H 3JAMM 1GO0A 3CCVF 3GYQA 3LWPC 3LWVC 1K8AH 3O85A 3CC4F 3N4YA 1VQLF 2VGMA 1M90H 4C4WC 2OTJF 3J81M 1YIJF 3NVKE 3OW2F 3CD6F 3CCUF 2FC3A 4X3MA 3G6EF 1QVGF 5EO3A 1YITF 5FJ4C 1CK2A 2LBWA 1W3EX 3VMFB 1N8RH 1JJ2F 3G4SF 5G4VC 1W41A 1KQSF 1YJWF 1VQ7F 1VQOF 1NMUB 3WXMB 1VQKF 2JNBA 2OTLF 1SDSA 1Q7YH 3J7AR 1H7MA 1E7KA 2BO1A 3CC7F 2CZWA 3CCLF 3J80M 1KC8H 2QA4F 3AGKA 3I56F 1RA4A 1Q82H 1IPAA 3V7QA 5GINC 3CCQF 2LBXA 2WALA 3HAXD 3LWRC 3HJWC 2ALEA 5A2QM 1GO1A 3IR9A 3MCAB 3I55F 1S72F 2KTVA 3CMAF 1Q81H 1W2BF 3CG6A 1VQ9F 3V7EA 4BY9D 4TZZA 2QI2A 1X7OA 1W42A 5FLXM 1YJNF 1VQ6F 3CCSF
chains in the Genus database with same CATH superfamily
4ZI7B 3C9SA 1W581 1VQ8F 3SIUA 2Z01A 3S06A 2QEXF 4G4WA 4I55B 4TV9A 2B33A 5LP6C 3OONA 3ZOPA 2UZHA 1RLGA 5GIPC 2LBTA 3FPIA 4EI7A 5C8YB 3RYHA 1Z5WA 5DCVA 2OTMA 1M1KH 5MN6A 1VQPF 1X52A 2KTUA 3SIVA 5GAPK 1W5FA 3WGMA 1W5BA 4HNAB 3D01A 3IEQA 3RYIB 2Z1UA 3M1XA 3PAFA 1W40A 4I50B 1TUBA 3CCJF 4YJ2B 1VQ5F 4EI8A 4HNAA 4X1KB 4X1IB 4BT6A 1FSZA 3MQWA 4B62A 3HKCB 3OBYA 2I6DA 3LFOA 3NVIB 4O4LA 3FD6A 4G4ZA 5JH7A 3HTNA 4NQ3A 2HP3A 5LOVB 1VQMF 5EYPB 2VGNA 4BVRA 5GIOC 2RHOA 3E20B 3JARB 4TUYB 4PWTA 3VOAA 3CCEF 3CCMF 1H48A 2IG8A 1JFFB 5IJ0A 4IIJA 5JVDB 4RQOA 3LWVC 3ZO8A 3IKEA 2QTPA 2VAMA 3JALB 1GX1A 2DT4A 3UT5B 5HY2A 5J2TB 4C4WC 1YIJF 3VO8A 1FFXA 1OFUA 2HS3A 2RHLA 3JAWA 5EZYB 1W5AA 3VYSC 3NVKE 4B46A 3CCUF 3N2GB 3G6EF 1QAHA 1KNKA 4X1YB 1VQVA 1W3EX 1N8RH 2EWCA 4R40B 3T80A 4O4HA 3G4SF 4O2BB 3TD5A 5LXTB 2ZF8A 1YJWF 1VQ7F 1NMUB 1SA0A 2HX0A 2CWJA 3I7TA 2ZVYA 2Q1XA 4DRXA 3N2KB 1H7MA 2F9ZC 2BO1A 1E7KA 2RHJA 2CZWA 3K2XA 3CCLF 3RYCA 2UYNB 3AGKA 3IMPA 1IPAA 4EB6B 5HP7A 3ELCA 1COMA 3C9UA 4U3JA 5LA6B 5KMGB 3MCAB 3EORA 1OAPA 3FD5A 3F0DA 2HP0B 3CG6A 1U40A 1ODEA 1VQ9F 4ZHYB 3V7EA 2ZODA 4EB6A 1X7OA 3LMEA 5FLXM 1VQ6F 1ONIA 5LA6A 5EIBD 3WPWA 4C8EA 2RB9A 1FNJA 3CPQA 2YYEA 1K9MH 3HKBB 1T0KB 3M84A 1YJ9F 3CXCF 1X7PA 5JQGA 4I4TB 4O4JB 5JCOA 3JATA 2K1SA 2ZVZA 4TV8B 1XBIA 4X20A 4ZHQA 3P4EA 1SZQA 3CB2A 5GONB 4I4TA 3K0TA 1GZ0A 2KG4A 3NMUC 1U3PA 4IHJB 5LYJB 3LWQC 2LCAA 5EB0A 1RQ7A 5KX5B 5GONA 2HVYD 3ERNA 1W57A 2R6R1 1YI2F 1JN1A 4ZHWA 4LCKA 3P0ZA 4BT4A 4ZI7A 1FNKA 4IHJA 3VTIC 3RYFB 3C9TA 3WGLA 3B6NA 4I55A 3VI6A 2I6RA 1KD1H 5C8YA 2OZBA 3CC2F 1GO0A 3KHNA 3GYQA 5LP6B 3LWPC 3O85A 3CC4F 1PF5A 1VQLF 5ITZB 2VGMA 3WJPA 3RYIA 4ZOLB 3K14A 4WBNB 4EI9A 5HWEA 2GZLA 4X3MA 4I50A 3MCQA 1QVGF 3VCZA 5HXUA 3F6MA 4YJ2A 3I3FA 3VYUC 4X1IA 4X1KA 5IYZB 1NQ3A 1W41A 3ESJA 3HKCA 4ZOLA 3CYPB 3JAKB 2N48A 4F6RB 2R751 1U43A 1X25A 2JNBA 2VAPA 2OTLF 3F0EA 3J7AR 5LOVA 5EYPA 3CC7F 3P10A 2BTUA 3J80M 2HS4A 2FGYA 3JARA 4TUYA 1XHOA 2MQEA 2UYKA 3I56F 2PHNA 2QA4F 4C82A 5GINC 1JFFA 2IAFA 4RHAA 3HJWC 5HY4A 5JVDA 1RQ2A 2HQSC 2W8BC 1GO1A 3JALA 3I55F 2BTOA 1UI9A 1JY8A 3UT5A 1W2BF 4B5CA 5J2TA 5EZYA 2L26A 4TZZA 1IV3A 3MDOA 1W42A 2V9YA 2AIZP 1YJNF 4O4IB 1CN7A 3JASB 3N2GA 5J2UB 2CVLA 4X1YA 4BW0B 3IEWA 5HY1A 1VH8A 2CHTA 4O2BA 5LXTA 5EWRA 3E1YA 1ZWZA 1YQNA 2Z1FA 3JASA 5IJ9B 2H6LA 3PLAC 3C8LA 4XCQA 3N2KA 3LYBA 4BT2A 1NJIH 1QD9A 2IQQA 4ZHVA 1JD1A 1CLIA 5BMVB 2UYNA 3HWUA 5CB4B 4G4XA 5KMGA 3HKEB 4O2AB 3Q8HA 3TD4A 5G4UC 1UFYA 5CA1B 5CA0B 4X3LA 3RE3A 2HP0A 4B45A 5BMVA 5FNVB 4C81A 1QVFF 3LDTA 5JCOC 1RLUA 1VQNF 3E22B 3VIUA 4G88A 3IKFA 3ON1A 1H47A 2G9IA 3MBMA 2OHWA 2H8CA 1PXWA 3GTZA 4LNUB 4BVTA 3G71F 3F0FA 3RA5A 2ZAUA 3HKBA 3ZP7A 4YJ3B 4BVQA 2RHHA 3S0YA 2YXZA 1XRGA 3KIZA 4O4JA 1K73H 3JAMM 3CCVF 1Z5VA 2Z1EA 1K8AH 4NWOB 2DYYA 4TV8A 3WGNA 3KE1A 3F0GA 1M90H 4YJ3A 3J81M 5HY0A 3OW2F 3CD6F 3C9RA 2UYPA 5AVMA 4ZK7A 1YITF 5FJ4C 4BVSA 3GHZA 3WGKA 5LYJA 3S0WA 3VMFB 1JJ2F 5KX5A 4TV9B 5G4VC 1KQSF 3BYQA 3ZP4A 2NMUA 3V3TA 3RYHB 1VQKF 4M8IA 1DBFA 1SDSA 4BT7A 1Q7YH 3RYFA 5EB1B 3KJKA 1KC8H 3L7QA 1RA4A 3V4DA 1Q82H 3CCQF 1W5EA 2LBXA 4KWEA 3S02A 2WALA 5LP6A 3LWRC 1TUBB 3FBAA 5ITZA 1Q81H 2BTQB 3QTYA 3K12A 4BY9D 4WBNA 1Q8RA 2HRYA 4O4LB 1IV2A 3JCMM 5MN4A 5JH7B 3NK6A 3FFMA 3LWOC 5IYZA 1IV1A 1J7HA 3JAKA 3RA6A 4F6RA 3JVHA 2Z1TA 5IJ0B 1U3LA 3CYQA 4IIJB 2PMPA 2AIFA 3CMEF 1QU9A 4G4VA 1W59A 1KNJA 3CPWF 3D00A 4NUTA 3D54A 3QHDA 5IT9M 2ZOVA 1FFXB 1DT9A 1VHAA 3JAWB 3NK7A 1TVKB 3N4ZA 4BT3A 3S03A 1VQ4F 5EIBC 5HP8A 4FFBB 4O4HB 4DXDA 3QUWA 1TVKA 4O4IA 4C8IA 1SA0B 5J2UA 5B8FA 4DRXB 5GANK 4FFBA 3OBWA 3S0HA 1YHQF 3RYCB 2VXYA 1W55A 1T0AA 1Q86H 5IJ9A 3VOBA 3CCRF 2GVIA 3TD3A 4U3JB 1XV2A 2H8EA 3N4YA 2AMTA 2VAWA 2OTJF 5HXZA 2GLZA 5CB4A 2FC3A 3WJRA 3HKEA 3VYTC 4O2AA 5EO3A 5MN5A 1CK2A 1R1MA 2KGWA 2CW4A 5CA0A 5CA1A 2LBWA 5FNVA 4ERHA 3U0OA 3E22A 3WJQA 1VQOF 3WXMB 3KJJA 5JQGB 2HRUA 2Q1YA 3JATB 4C8GA 1IV4A 4LNUA 4X20B 3WGJA 4ZHQB 5EAZA 4U39A 2CHSA 1YGYA 3M4SA 4BT5A 1VK3A 3DC2A 3HKDB 3V7QA 2CSLA 3HAXD 2P6YA 2ALEA 5A2QM 3IR9A 3WPXA 4G4YA 1S72F 2KTVA 3CMAF 2UYJA 3DDNA 3HKDA 2QI2A 2HS0A 3R0PA 4E6EA 3CCSF
chains in the Genus database with same CATH topology
1VQ8F 3SIUA 3JCMM 3NK6A 4BW0B 3FFMA 2QEXF 5HY1A 3LWOC 3CPQA 1K9MH 5EWRA 3E1YA 1T0KB 3RA6A 1ZWZA 1RLGA 5GIPC 4EI7A 3CXCF 1X7PA 1YJ9F 5DCVA 3PLAC 2AIFA 1M1KH 4XCQA 1VQPF 1X52A 2KTUA 3CMEF 3SIVA 1XBIA 1NJIH 5GAPK 3CPWF 3D00A 4NUTA 5IT9M 1DT9A 3PAFA 3NK7A 3N4ZA 1W40A 1VQ4F 1GZ0A 3CCJF 1CN7A 2KG4A 5G4UC 3NMUC 1VQ5F 4X3LA 4EI8A 3LWQC 1QVFF 2HVYD 1YI2F 4LCKA 3OBYA 1VQNF 2I6DA 3LFOA 3NVIB 3ON1A 2OHWA 5GANK 1PXWA 4NQ3A 4BVTA 3OBWA 1VQMF 3G71F 3RA5A 1YHQF 2VGNA 4BVRA 5GIOC 3E20B 3VI6A 1KD1H 4BVQA 3CCEF 3CCMF 2OZBA 1Q86H 3CCRF 3CC2F 1K73H 3JAMM 1GO0A 3CCVF 3GYQA 3LWPC 3LWVC 1K8AH 3O85A 3CC4F 3N4YA 1VQLF 2VGMA 1M90H 5HY2A 4C4WC 2OTJF 5HXZA 2GLZA 3J81M 1YIJF 3NVKE 5HY0A 3OW2F 4EI9A 5HWEA 3CCUF 2FC3A 4X3MA 3CD6F 3G6EF 1QVGF 5EO3A 1YITF 5FJ4C 4BVSA 1CK2A 5HXUA 2LBWA 1W3EX 3VMFB 1N8RH 1JJ2F 3G4SF 5G4VC 1W41A 1KQSF 1YJWF 1VQ7F 1VQOF 1NMUB 3WXMB 3V3TA 1VQKF 2JNBA 2OTLF 1SDSA 1Q7YH 3J7AR 1H7MA 2F9ZC 2BO1A 1E7KA 3CC7F 2CZWA 3CCLF 3J80M 2FGYA 1KC8H 2QA4F 3AGKA 3I56F 1RA4A 1Q82H 1IPAA 3V7QA 5GINC 3CCQF 2LBXA 2WALA 3HAXD 5HY4A 3LWRC 3HJWC 2ALEA 5A2QM 1GO1A 3IR9A 3MCAB 3I55F 1S72F 2KTVA 3CMAF 1Q81H 1W2BF 3CG6A 1VQ9F 3V7EA 4BY9D 4TZZA 2QI2A 1X7OA 1W42A 5FLXM 1YJNF 1VQ6F 3CCSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 F;  3SIU A;  3JCM M;  3NK6 A;  4BW0 B;  3FFM A;  2QEX F;  3LWO C;  3CPQ A;  1K9M H;  5EWR A;  3E1Y A;  1T0K B;  3RA6 A;  1ZWZ A;  1RLG A;  5GIP C;  1YJ9 F;  3CXC F;  1X7P A;  5DCV A;  3PLA C;  2AIF A;  1M1K H;  1VQP F;  1X52 A;  2KTU A;  3CME F;  3SIV A;  1XBI A;  1NJI H;  5GAP K;  3CPW F;  4NUT A;  5IT9 M;  1DT9 A;  3PAF A;  3NK7 A;  3N4Z A;  1W40 A;  1VQ4 F;  1GZ0 A;  3CCJ F;  1CN7 A;  2KG4 A;  5G4U C;  3NMU C;  1VQ5 F;  4X3L A;  3LWQ C;  1QVF F;  2HVY D;  1YI2 F;  4LCK A;  3OBY A;  1VQN F;  2I6D A;  3LFO A;  3NVI B;  3ON1 A;  2OHW A;  5GAN K;  1PXW A;  3OBW A;  1VQM F;  3G71 F;  3RA5 A;  1YHQ F;  2VGN A;  5GIO C;  3E20 B;  3VI6 A;  1KD1 H;  3CCE F;  3CCM F;  2OZB A;  1Q86 H;  3CCR F;  3CC2 F;  1K73 H;  3JAM M;  1GO0 A;  3CCV F;  3GYQ A;  3LWP C;  3LWV C;  1K8A H;  3O85 A;  3CC4 F;  3N4Y A;  1VQL F;  2VGM A;  1M90 H;  4C4W C;  2OTJ F;  3J81 M;  1YIJ F;  3NVK E;  3OW2 F;  3CD6 F;  3CCU F;  2FC3 A;  4X3M A;  3G6E F;  1QVG F;  5EO3 A;  1YIT F;  5FJ4 C;  1CK2 A;  2LBW A;  1W3E X;  3VMF B;  1N8R H;  1JJ2 F;  3G4S F;  5G4V C;  1W41 A;  1KQS F;  1YJW F;  1VQ7 F;  1VQO F;  1NMU B;  3WXM B;  1VQK F;  2JNB A;  2OTL F;  1SDS A;  1Q7Y H;  3J7A R;  1H7M A;  1E7K A;  2BO1 A;  3CC7 F;  2CZW A;  3CCL F;  3J80 M;  1KC8 H;  2QA4 F;  3AGK A;  3I56 F;  1RA4 A;  1Q82 H;  1IPA A;  3V7Q A;  5GIN C;  3CCQ F;  2LBX A;  2WAL A;  3HAX D;  3LWR C;  3HJW C;  2ALE A;  5A2Q M;  1GO1 A;  3IR9 A;  3MCA B;  3I55 F;  1S72 F;  2KTV A;  3CMA F;  1Q81 H;  1W2B F;  3CG6 A;  1VQ9 F;  3V7E A;  4BY9 D;  4TZZ A;  2QI2 A;  1X7O A;  1W42 A;  5FLX M;  1YJN F;  1VQ6 F;  3CCS F; 
#chains in the Genus database with same CATH topology
 4ZI7 B;  3C9S A;  1W58 1;  1VQ8 F;  3SIU A;  2Z01 A;  3S06 A;  2QEX F;  4G4W A;  4I55 B;  4TV9 A;  2B33 A;  5LP6 C;  3OON A;  3ZOP A;  2UZH A;  1RLG A;  5GIP C;  2LBT A;  3FPI A;  4EI7 A;  5C8Y B;  3RYH A;  1Z5W A;  5DCV A;  2OTM A;  1M1K H;  5MN6 A;  1VQP F;  1X52 A;  2KTU A;  3SIV A;  5GAP K;  1W5F A;  3WGM A;  1W5B A;  4HNA B;  3D01 A;  3IEQ A;  3RYI B;  2Z1U A;  3M1X A;  3PAF A;  1W40 A;  4I50 B;  1TUB A;  3CCJ F;  4YJ2 B;  1VQ5 F;  4EI8 A;  4HNA A;  4X1K B;  4X1I B;  4BT6 A;  1FSZ A;  3MQW A;  4B62 A;  3HKC B;  3OBY A;  2I6D A;  3LFO A;  3NVI B;  4O4L A;  3FD6 A;  4G4Z A;  5JH7 A;  3HTN A;  4NQ3 A;  2HP3 A;  5LOV B;  1VQM F;  5EYP B;  2VGN A;  4BVR A;  5GIO C;  2RHO A;  3E20 B;  3JAR B;  4TUY B;  4PWT A;  3VOA A;  3CCE F;  3CCM F;  1H48 A;  2IG8 A;  1JFF B;  5IJ0 A;  4IIJ A;  5JVD B;  4RQO A;  3LWV C;  3ZO8 A;  3IKE A;  2QTP A;  2VAM A;  3JAL B;  1GX1 A;  2DT4 A;  3UT5 B;  5HY2 A;  5J2T B;  4C4W C;  1YIJ F;  3VO8 A;  1FFX A;  1OFU A;  2HS3 A;  2RHL A;  3JAW A;  5EZY B;  1W5A A;  3VYS C;  3NVK E;  4B46 A;  3CCU F;  3N2G B;  3G6E F;  1QAH A;  1KNK A;  4X1Y B;  1VQV A;  1W3E X;  1N8R H;  2EWC A;  4R40 B;  3T80 A;  4O4H A;  3G4S F;  4O2B B;  3TD5 A;  5LXT B;  2ZF8 A;  1YJW F;  1VQ7 F;  1NMU B;  1SA0 A;  2HX0 A;  2CWJ A;  3I7T A;  2ZVY A;  2Q1X A;  4DRX A;  3N2K B;  1H7M A;  2F9Z C;  2BO1 A;  1E7K A;  2RHJ A;  2CZW A;  3K2X A;  3CCL F;  3RYC A;  2UYN B;  3AGK A;  3IMP A;  1IPA A;  4EB6 B;  5HP7 A;  3ELC A;  1COM A;  3C9U A;  4U3J A;  5LA6 B;  5KMG B;  3MCA B;  3EOR A;  1OAP A;  3FD5 A;  3F0D A;  2HP0 B;  3CG6 A;  1U40 A;  1ODE A;  1VQ9 F;  4ZHY B;  3V7E A;  2ZOD A;  4EB6 A;  1X7O A;  3LME A;  5FLX M;  1VQ6 F;  1ONI A;  5LA6 A;  5EIB D;  3WPW A;  4C8E A;  2RB9 A;  1FNJ A;  3CPQ A;  2YYE A;  1K9M H;  3HKB B;  1T0K B;  3M84 A;  1YJ9 F;  3CXC F;  1X7P A;  5JQG A;  4I4T B;  4O4J B;  5JCO A;  3JAT A;  2K1S A;  2ZVZ A;  4TV8 B;  1XBI A;  4X20 A;  4ZHQ A;  3P4E A;  1SZQ A;  3CB2 A;  5GON B;  4I4T A;  3K0T A;  1GZ0 A;  2KG4 A;  3NMU C;  1U3P A;  4IHJ B;  5LYJ B;  3LWQ C;  2LCA A;  5EB0 A;  1RQ7 A;  5KX5 B;  5GON A;  2HVY D;  3ERN A;  1W57 A;  2R6R 1;  1YI2 F;  1JN1 A;  4ZHW A;  4LCK A;  3P0Z A;  4BT4 A;  4ZI7 A;  1FNK A;  4IHJ A;  3VTI C;  3RYF B;  3C9T A;  3WGL A;  3B6N A;  4I55 A;  3VI6 A;  2I6R A;  1KD1 H;  5C8Y A;  2OZB A;  3CC2 F;  1GO0 A;  3KHN A;  3GYQ A;  5LP6 B;  3LWP C;  3O85 A;  3CC4 F;  1PF5 A;  1VQL F;  5ITZ B;  2VGM A;  3WJP A;  3RYI A;  4ZOL B;  3K14 A;  4WBN B;  4EI9 A;  5HWE A;  2GZL A;  4X3M A;  4I50 A;  3MCQ A;  1QVG F;  3VCZ A;  5HXU A;  3F6M A;  4YJ2 A;  3I3F A;  3VYU C;  4X1I A;  4X1K A;  5IYZ B;  1NQ3 A;  1W41 A;  3ESJ A;  3HKC A;  4ZOL A;  3CYP B;  3JAK B;  2N48 A;  4F6R B;  2R75 1;  1U43 A;  1X25 A;  2JNB A;  2VAP A;  2OTL F;  3F0E A;  3J7A R;  5LOV A;  5EYP A;  3CC7 F;  3P10 A;  2BTU A;  3J80 M;  2HS4 A;  2FGY A;  3JAR A;  4TUY A;  1XHO A;  2MQE A;  2UYK A;  3I56 F;  2PHN A;  2QA4 F;  4C82 A;  5GIN C;  1JFF A;  2IAF A;  4RHA A;  3HJW C;  5HY4 A;  5JVD A;  1RQ2 A;  2HQS C;  2W8B C;  1GO1 A;  3JAL A;  3I55 F;  2BTO A;  1UI9 A;  1JY8 A;  3UT5 A;  1W2B F;  4B5C A;  5J2T A;  5EZY A;  2L26 A;  4TZZ A;  1IV3 A;  3MDO A;  1W42 A;  2V9Y A;  2AIZ P;  1YJN F;  4O4I B;  1CN7 A;  3JAS B;  3N2G A;  5J2U B;  2CVL A;  4X1Y A;  4BW0 B;  3IEW A;  5HY1 A;  1VH8 A;  2CHT A;  4O2B A;  5LXT A;  5EWR A;  3E1Y A;  1ZWZ A;  1YQN A;  2Z1F A;  3JAS A;  5IJ9 B;  2H6L A;  3PLA C;  3C8L A;  4XCQ A;  3N2K A;  3LYB A;  4BT2 A;  1NJI H;  1QD9 A;  2IQQ A;  4ZHV A;  1JD1 A;  1CLI A;  5BMV B;  2UYN A;  3HWU A;  5CB4 B;  4G4X A;  5KMG A;  3HKE B;  4O2A B;  3Q8H A;  3TD4 A;  5G4U C;  1UFY A;  5CA1 B;  5CA0 B;  4X3L A;  3RE3 A;  2HP0 A;  4B45 A;  5BMV A;  5FNV B;  4C81 A;  1QVF F;  3LDT A;  5JCO C;  1RLU A;  1VQN F;  3E22 B;  3VIU A;  4G88 A;  3IKF A;  3ON1 A;  1H47 A;  2G9I A;  3MBM A;  2OHW A;  2H8C A;  1PXW A;  3GTZ A;  4LNU B;  4BVT A;  3G71 F;  3F0F A;  3RA5 A;  2ZAU A;  3HKB A;  3ZP7 A;  4YJ3 B;  4BVQ A;  2RHH A;  3S0Y A;  2YXZ A;  1XRG A;  3KIZ A;  4O4J A;  1K73 H;  3JAM M;  3CCV F;  1Z5V A;  2Z1E A;  1K8A H;  4NWO B;  2DYY A;  4TV8 A;  3WGN A;  3KE1 A;  3F0G A;  1M90 H;  4YJ3 A;  3J81 M;  5HY0 A;  3OW2 F;  3CD6 F;  3C9R A;  2UYP A;  5AVM A;  4ZK7 A;  1YIT F;  5FJ4 C;  4BVS A;  3GHZ A;  3WGK A;  5LYJ A;  3S0W A;  3VMF B;  1JJ2 F;  5KX5 A;  4TV9 B;  5G4V C;  1KQS F;  3BYQ A;  3ZP4 A;  2NMU A;  3V3T A;  3RYH B;  1VQK F;  4M8I A;  1DBF A;  1SDS A;  4BT7 A;  1Q7Y H;  3RYF A;  5EB1 B;  3KJK A;  1KC8 H;  3L7Q A;  1RA4 A;  3V4D A;  1Q82 H;  3CCQ F;  1W5E A;  2LBX A;  4KWE A;  3S02 A;  2WAL A;  5LP6 A;  3LWR C;  1TUB B;  3FBA A;  5ITZ A;  1Q81 H;  2BTQ B;  3QTY A;  3K12 A;  4BY9 D;  4WBN A;  1Q8R A;  2HRY A;  4O4L B;  1IV2 A;  3JCM M;  5MN4 A;  5JH7 B;  3NK6 A;  3FFM A;  3LWO C;  5IYZ A;  1IV1 A;  1J7H A;  3JAK A;  3RA6 A;  4F6R A;  3JVH A;  2Z1T A;  5IJ0 B;  1U3L A;  3CYQ A;  4IIJ B;  2PMP A;  2AIF A;  3CME F;  1QU9 A;  4G4V A;  1W59 A;  1KNJ A;  3CPW F;  3D00 A;  4NUT A;  3D54 A;  3QHD A;  5IT9 M;  2ZOV A;  1FFX B;  1DT9 A;  1VHA A;  3JAW B;  3NK7 A;  1TVK B;  3N4Z A;  4BT3 A;  3S03 A;  1VQ4 F;  5EIB C;  5HP8 A;  4FFB B;  4O4H B;  4DXD A;  3QUW A;  1TVK A;  4O4I A;  4C8I A;  1SA0 B;  5J2U A;  5B8F A;  4DRX B;  5GAN K;  4FFB A;  3OBW A;  3S0H A;  1YHQ F;  3RYC B;  2VXY A;  1W55 A;  1T0A A;  1Q86 H;  5IJ9 A;  3VOB A;  3CCR F;  2GVI A;  3TD3 A;  4U3J B;  1XV2 A;  2H8E A;  3N4Y A;  2AMT A;  2VAW A;  2OTJ F;  5HXZ A;  2GLZ A;  5CB4 A;  2FC3 A;  3WJR A;  3HKE A;  3VYT C;  4O2A A;  5EO3 A;  5MN5 A;  1CK2 A;  1R1M A;  2KGW A;  2CW4 A;  5CA0 A;  5CA1 A;  2LBW A;  5FNV A;  4ERH A;  3U0O A;  3E22 A;  3WJQ A;  1VQO F;  3WXM B;  3KJJ A;  5JQG B;  2HRU A;  2Q1Y A;  3JAT B;  4C8G A;  1IV4 A;  4LNU A;  4X20 B;  3WGJ A;  4ZHQ B;  5EAZ A;  4U39 A;  2CHS A;  1YGY A;  3M4S A;  4BT5 A;  1VK3 A;  3DC2 A;  3HKD B;  3V7Q A;  2CSL A;  3HAX D;  2P6Y A;  2ALE A;  5A2Q M;  3IR9 A;  3WPX A;  4G4Y A;  1S72 F;  2KTV A;  3CMA F;  2UYJ A;  3DDN A;  3HKD A;  2QI2 A;  2HS0 A;  3R0P A;  4E6E A;  3CCS F; 
#chains in the Genus database with same CATH homology
 1VQ8 F;  3SIU A;  3JCM M;  3NK6 A;  4BW0 B;  3FFM A;  2QEX F;  5HY1 A;  3LWO C;  3CPQ A;  1K9M H;  5EWR A;  3E1Y A;  1T0K B;  3RA6 A;  1ZWZ A;  1RLG A;  5GIP C;  4EI7 A;  3CXC F;  1X7P A;  1YJ9 F;  5DCV A;  3PLA C;  2AIF A;  1M1K H;  4XCQ A;  1VQP F;  1X52 A;  2KTU A;  3CME F;  3SIV A;  1XBI A;  1NJI H;  5GAP K;  3CPW F;  3D00 A;  4NUT A;  5IT9 M;  1DT9 A;  3PAF A;  3NK7 A;  3N4Z A;  1W40 A;  1VQ4 F;  1GZ0 A;  3CCJ F;  1CN7 A;  2KG4 A;  5G4U C;  3NMU C;  1VQ5 F;  4X3L A;  4EI8 A;  3LWQ C;  1QVF F;  2HVY D;  1YI2 F;  4LCK A;  3OBY A;  1VQN F;  2I6D A;  3LFO A;  3NVI B;  3ON1 A;  2OHW A;  5GAN K;  1PXW A;  4NQ3 A;  4BVT A;  3OBW A;  1VQM F;  3G71 F;  3RA5 A;  1YHQ F;  2VGN A;  4BVR A;  5GIO C;  3E20 B;  3VI6 A;  1KD1 H;  4BVQ A;  3CCE F;  3CCM F;  2OZB A;  1Q86 H;  3CCR F;  3CC2 F;  1K73 H;  3JAM M;  1GO0 A;  3CCV F;  3GYQ A;  3LWP C;  3LWV C;  1K8A H;  3O85 A;  3CC4 F;  3N4Y A;  1VQL F;  2VGM A;  1M90 H;  5HY2 A;  4C4W C;  2OTJ F;  5HXZ A;  2GLZ A;  3J81 M;  1YIJ F;  3NVK E;  5HY0 A;  3OW2 F;  4EI9 A;  5HWE A;  3CCU F;  2FC3 A;  4X3M A;  3CD6 F;  3G6E F;  1QVG F;  5EO3 A;  1YIT F;  5FJ4 C;  4BVS A;  1CK2 A;  5HXU A;  2LBW A;  1W3E X;  3VMF B;  1N8R H;  1JJ2 F;  3G4S F;  5G4V C;  1W41 A;  1KQS F;  1YJW F;  1VQ7 F;  1VQO F;  1NMU B;  3WXM B;  3V3T A;  1VQK F;  2JNB A;  2OTL F;  1SDS A;  1Q7Y H;  3J7A R;  1H7M A;  2F9Z C;  2BO1 A;  1E7K A;  3CC7 F;  2CZW A;  3CCL F;  3J80 M;  2FGY A;  1KC8 H;  2QA4 F;  3AGK A;  3I56 F;  1RA4 A;  1Q82 H;  1IPA A;  3V7Q A;  5GIN C;  3CCQ F;  2LBX A;  2WAL A;  3HAX D;  5HY4 A;  3LWR C;  3HJW C;  2ALE A;  5A2Q M;  1GO1 A;  3IR9 A;  3MCA B;  3I55 F;  1S72 F;  2KTV A;  3CMA F;  1Q81 H;  1W2B F;  3CG6 A;  1VQ9 F;  3V7E A;  4BY9 D;  4TZZ A;  2QI2 A;  1X7O A;  1W42 A;  5FLX M;  1YJN F;  1VQ6 F;  3CCS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...