1M90H

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m90H00
3LWQC 3G4SF 2FC3A 3CPQA 1W40A 1W41A 3CG6A 5EO3A 1YIJF 1GO0A 3NK6A 3NMUC 1YJNF 1YJ9F 3CMAF 3J7AR 3PAFA 1GO1A 2JNBA 3J80M 3E20B 2CZWA 2OTJF 2OHWA 3CPWF 1W2BF 1X52A 2AIFA 2OZBA 1KQSF 1VQ4F 1Q81H 5A2QM 1K9MH 3ON1A 5GIOC 3SIVA 1X7OA 3JAMM 3CCUF 5FJ4C 1CK2A 3I56F 1H7MA 1Q82H 3CCQF 1NMUB 1M1KH 3LFOA 1E7KA 3CC4F 2LBXA 3IR9A 1VQMF 3NK7A 1NJIH 5GIPC 3LWVC 1W3EX 1VQNF 1K8AH 3OW2F 1PXWA 1VQ5F 1VQ7F 4C4WC 2WALA 1VQOF 1M90H 3CD6F 1K73H 3O85A 3CCLF 3HAXD 3LWRC 3N4YA 3AGKA 2I6DA 2BO1A 2KG4A 1RA4A 3V7QA 5GAPK 1YI2F 2VGMA 3RA5A 3LWPC 1RLGA 3CC7F 3CCMF 3HJWC 3NVKE 2KTUA 2LBWA 1SDSA 5EWRA 3PLAC 1DT9A 2KTVA 3CMEF 1YHQF 3VI6A 5GINC 1KC8H 1KD1H 1VQLF 3CCSF 4X3MA 5DCVA 5IT9M 3MCAB 1X7PA 3VMFB 4BW0B 3OBWA 5FLXM 2QI2A 4BY9D 2HVYD 3LWOC 1VQ9F 3CCRF 3G71F 2OTLF 1GZ0A 2VGNA 3FFMA 3CC2F 1QVFF 1W42A 1VQKF 3NVIB 4NUTA 3WXMB 3SIUA 4LCKA 3GYQA 1VQPF 3N4ZA 1ZWZA 2QEXF 1IPAA 1QVGF 1S72F 3JCMM 5G4VC 1T0KB 5GANK 1YITF 4X3LA 1XBIA 1YJWF 3RA6A 3E1YA 3OBYA 3CCJF 3G6EF 1Q7YH 1JJ2F 3CCVF 2QA4F 1VQ6F 2ALEA 3CCEF 5G4UC 1N8RH 3V7EA 3CXCF 4TZZA 1CN7A 3I55F 1Q86H 1VQ8F 3J81M
chains in the Genus database with same CATH superfamily
4BT5A 1W40A 2GZLA 4ZI7A 3JAKA 4BVSA 1FSZA 3NK6A 1H47A 4O4HB 4U39A 4G4YA 1XRGA 4BT3A 3LDTA 2BTUA 4C8GA 1GO1A 3M84A 2JNBA 2ZVYA 3E20B 1FFXB 3CPWF 3RYIB 4YJ2A 2CW4A 2QTPA 2HP0A 3JALB 2Q1XA 5KMGA 3RE3A 5CA0B 1U43A 3JAMM 1W5EA 3LYBA 2UZHA 3MCQA 2GVIA 5JCOA 3DDNA 5MN5A 1CK2A 1ODEA 1PF5A 3KJJA 5KX5B 3S02A 1Q82H 2VAWA 2RHJA 4HNAA 5HXUA 2G9IA 2CVLA 1VQMF 1X25A 1NJIH 4E6EA 3VO8A 4KWEA 4R40B 1W3EX 3WJRA 5BMVB 3JATA 5JQGA 3KIZA 1JFFB 4XCQA 1VQOF 2LCAA 4X20A 1K73H 3JAWA 2I6DA 4I55B 5JVDA 3TD5A 1W5BA 3C9TA 3L7QA 3HTNA 1YI2F 1Q8RA 3LWPC 2Z1FA 5JH7A 1W5AA 3NVKE 4I50A 2KTUA 3PLAC 1IV4A 4YJ3A 3S0YA 3JARA 1RLUA 3HKDA 4X3MA 4LNUA 3F6MA 4BW0B 2W8BC 5IYZB 2HVYD 4DRXA 3LWOC 3MBMA 3ZOPA 4X1IA 4NQ3A 1XHOA 4EI7A 1XV2A 5EAZA 4NUTA 1COMA 3RYCA 3GYQA 4TUYB 1VQPF 3N4ZA 4G88A 1ZWZA 5J2TA 2QEXF 1QAHA 3JCMM 1T0KB 5LOVB 2VAPA 1FNJA 4BT4A 2CHTA 3GTZA 1YJWF 4G4XA 2ZODA 3CCJF 2KGWA 3ZO8A 5HXZA 5IJ0A 3MDOA 4BT7A 2QA4F 4O4IA 2GLZA 5EIBD 4M8IA 1RQ2A 2BTOA 2UYKA 3E22A 3CXCF 3VTIC 4TV9B 4TZZA 5CA1A 2R751 3WJQA 5J2UA 3G4SF 4X1YB 2FC3A 3CPQA 1W41A 4TV8B 5EO3A 2BTQB 1YIJF 4B45A 1U40A 4O4JB 3HKEA 1YJ9F 2YYEA 3CMAF 3PAFA 3N2GA 3J7AR 4IHJA 5C8YA 2CZWA 2OTJF 3TD4A 1VQVA 2OHWA 2ZF8A 4ZK7A 1JY8A 1X52A 3KHNA 5HWEA 4EI8A 1KQSF 3ERNA 1W57A 1Q81H 1YGYA 5A2QM 5EB1B 1K9MH 5GIOC 5EB0A 3M4SA 3WGLA 2H8CA 5MN6A 5FJ4C 5LYJA 3FD6A 1T0AA 2Z1TA 3LFOA 3S0WA 3CC4F 2HQSC 3EORA 3KJKA 3BYQA 2RB9A 3HKBB 4U3JA 5ITZA 3C9SA 5LP6B 1VQNF 3HKCB 5EIBC 1K8AH 1J7HA 5IJ0B 2Q1YA 1TVKA 5CB4A 3K12A 1M90H 4BT2A 3O85A 5EYPA 4ZHQB 3N4YA 3AGKA 4ZHVA 4B46A 3D54A 5IJ9A 5MN4A 4EB6A 3HWUA 3GHZA 2KG4A 3V7QA 3JASB 2VGMA 3P10A 3RA5A 1RLGA 4O4LA 5LXTB 5HP7A 1DT9A 3RYHA 2KTVA 1YHQF 3ZP7A 5GINC 1TUBB 1KD1H 3WGKA 1VQLF 3WPXA 4ZOLB 3F0GA 3CCSF 4EI9A 5DCVA 3ELCA 3N2KB 1SA0A 2IQQA 3OBWA 3WGMA 2QI2A 2VXYA 4BY9D 1SZQA 3C8LA 3C9UA 1VQ9F 1JD1A 1KNKA 3FFMA 1UI9A 3VYTC 1VQKF 2L26A 4IIJA 5FNVA 1DBFA 4X1KA 4LCKA 4ZI7B 3JAKB 4I4TA 2NMUA 3VIUA 4G4ZA 4FFBA 3V3TA 2ZOVA 5G4VC 4O2BA 3T80A 3VOAA 4F6RA 4WBNA 3RA6A 3CB2A 3E1YA 3OBYA 3G6EF 3WJPA 1Q7YH 3IKEA 3CCVF 2ALEA 3RYFA 5G4UC 2EWCA 4YJ2B 5HP8A 2HP0B 5KMGB 4BVQA 1Q86H 4C82A 4ZHYB 3JVHA 2DT4A 3LWQC 2Z1EA 3I3FA 4O4LB 4DXDA 3VYSC 3K14A 3NMUC 3DC2A 4HNAB 2LBTA 5EZYA 1YJNF 5GONA 1U3LA 3WGNA 1ONIA 3M1XA 3U0OA 1IV2A 5HY2A 3FD5A 3D01A 3JATB 5LA6A 5JQGB 2HP3A 2AIFA 2OZBA 1R1MA 5HY4A 4X20B 3P4EA 3UT5A 3JAWB 3ON1A 1OFUA 1X7OA 5JVDB 2CWJA 3CCUF 2H6LA 5JH7B 3I56F 3D00A 1E7KA 3CCQF 1NMUB 1QU9A 3I7TA 4O4HA 4I50B 1M1KH 2MQEA 3IR9A 1FNKA 3TD3A 4YJ3B 3VOBA 2CHSA 3JARB 4WBNB 3LWVC 5AVMA 1FFXA 2HRYA 2P6YA 3HKDB 3OW2F 1PXWA 3RYIA 3IKFA 1VQ5F 4LNUB 1VQ7F 2WALA 3CD6F 3CCLF 3HAXD 2RHOA 3LWRC 3ESJA 5CA0A 4DRXB 1Z5WA 2AIZP 3F0EA 4X1IB 3S03A 5GAPK 4BT6A 3CCMF 3RYCB 2LBWA 5J2TB 3C9RA 3CMEF 2UYJA 3VI6A 2K1SA 1CLIA 4O2AA 2Z01A 5BMVA 4C81A 1JFFA 1RQ7A 2FGYA 1VHAA 2RHHA 1X7PA 3MCAB 3VMFB 2N48A 4O4IB 3KE1A 2ZAUA 5FLXM 1UFYA 3E22B 4G4WA 3ZP4A 2AMTA 4I55A 5CA1B 3G71F 1GZ0A 2B33A 5J2UB 1W5FA 2ZVZA 3WXMB 5LP6C 4B62A 1VH8A 3WGJA 1IPAA 1S72F 1W581 4X3LA 3HKEB 1XBIA 3FPIA 3N2GB 3K2XA 1JJ2F 4IHJB 5C8YB 4PWTA 1VQ6F 2HRUA 3CCEF 5IYZA 3V7EA 3IEWA 2PMPA 5B8FA 5HY0A 2DYYA 2HS3A 3S0HA 3F0DA 3R0PA 3CG6A 4TUYA 1U3PA 1GO0A 5LYJB 1VQ8F 1YQNA 3CYPB 5LOVA 3F0FA 4O2AB 2UYPA 1JN1A 1QD9A 4U3JB 5ITZB 3J80M 3LMEA 1W2BF 1TVKB 5CB4B 4TV9A 1VQ4F 2HX0A 5EYPB 4BVTA 3K0TA 3SIVA 4X1YA 1IV1A 1NQ3A 4C8EA 4EB6B 5IJ9B 2Z1UA 4TV8A 2UYNA 2R6R1 3WPWA 2PHNA 1H7MA 4O4JA 2LBXA 3IEQA 3RYHB 3NK7A 5GIPC 4BVRA 3P0ZA 3Q8HA 4C4WC 1SA0B 1W59A 1GX1A 3CYQA 5JCOC 3IMPA 3VYUC 2BO1A 3B6NA 1RA4A 4B5CA 3VCZA 4ZHWA 5HY1A 3CC7F 4IIJB 5FNVB 4X1KB 3HJWC 1Z5VA 4I4TB 2OTMA 2VAMA 3OONA 1IV3A 1SDSA 5EWRA 3V4DA 2HS4A 4FFBB 3MQWA 3HKBA 1KC8H 2RHLA 4O2BB 4F6RB 5LP6A 3HKCA 4RHAA 2I6RA 4ERHA 5IT9M 2HS0A 3QHDA 3RYFB 3JALA 4ZHQA 2IAFA 2IG8A 3CCRF 3JASA 2OTLF 3QUWA 2V9YA 2VGNA 3CC2F 3SIUA 2UYNB 1OAPA 1W42A 2F9ZC 5LXTA 1QVFF 3NVIB 3S06A 1KNJA 5KX5A 1QVGF 3QTYA 1W55A 5GANK 1TUBA 4G4VA 1YITF 5EZYB 5GONB 4ZOLA 1VK3A 2CSLA 4RQOA 3N2KA 2H8EA 5LA6B 1N8RH 3FBAA 2YXZA 4NWOB 4C8IA 1CN7A 3I55F 1H48A 3UT5B 3J81M
chains in the Genus database with same CATH topology
3LWQC 3G4SF 2FC3A 3CPQA 1W40A 1W41A 3CG6A 5EO3A 4BVSA 1YIJF 1GO0A 3NK6A 3NMUC 1YJNF 1YJ9F 3CMAF 3J7AR 3PAFA 1GO1A 2JNBA 5HY2A 3E20B 3J80M 2CZWA 2OTJF 2OHWA 3CPWF 1W2BF 1X52A 2AIFA 2OZBA 5HWEA 4EI8A 1KQSF 5HY4A 1VQ4F 1Q81H 5A2QM 1K9MH 4BVTA 3ON1A 5GIOC 3SIVA 1X7OA 3JAMM 3CCUF 5FJ4C 1CK2A 3I56F 1H7MA 3D00A 3CCQF 1NMUB 1Q82H 3LFOA 1M1KH 5HXUA 1E7KA 3CC4F 2LBXA 3IR9A 1VQMF 3NK7A 1NJIH 5GIPC 3LWVC 1W3EX 1VQNF 4BVRA 1K8AH 3OW2F 1PXWA 1VQ5F 1VQ7F 4C4WC 2WALA 4XCQA 1VQOF 1M90H 1K73H 3O85A 3CD6F 3CCLF 3HAXD 3LWRC 3N4YA 3AGKA 2I6DA 2BO1A 2KG4A 1RA4A 3V7QA 5GAPK 1YI2F 2VGMA 3RA5A 3LWPC 1RLGA 5HY1A 3CC7F 3CCMF 3HJWC 3NVKE 2KTUA 2LBWA 1SDSA 5EWRA 3PLAC 1DT9A 2KTVA 3CMEF 1YHQF 3VI6A 5GINC 1KC8H 1KD1H 1VQLF 3CCSF 4EI9A 4X3MA 5DCVA 5IT9M 2FGYA 3MCAB 1X7PA 3VMFB 4BW0B 3OBWA 5FLXM 2QI2A 4BY9D 2HVYD 3LWOC 1VQ9F 3CCRF 4NQ3A 3G71F 2OTLF 1GZ0A 2VGNA 4EI7A 3FFMA 3CC2F 1QVFF 1W42A 1VQKF 2F9ZC 4NUTA 3WXMB 3NVIB 3SIUA 3GYQA 1VQPF 4LCKA 3N4ZA 1ZWZA 2QEXF 1IPAA 1QVGF 1S72F 3JCMM 3V3TA 5G4VC 5GANK 1T0KB 1YITF 4X3LA 1XBIA 1YJWF 3RA6A 3E1YA 3OBYA 3CCJF 3G6EF 1Q7YH 1JJ2F 5HXZA 3CCVF 2QA4F 1VQ6F 2GLZA 2ALEA 3CCEF 5G4UC 1N8RH 3V7EA 3CXCF 5HY0A 4TZZA 1CN7A 4BVQA 3I55F 1Q86H 1VQ8F 3J81M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWQ C;  3G4S F;  2FC3 A;  3CPQ A;  1W40 A;  1W41 A;  3CG6 A;  5EO3 A;  1YIJ F;  1GO0 A;  3NK6 A;  3NMU C;  1YJN F;  1YJ9 F;  3CMA F;  3J7A R;  3PAF A;  1GO1 A;  2JNB A;  3J80 M;  3E20 B;  2CZW A;  2OTJ F;  2OHW A;  3CPW F;  1W2B F;  1X52 A;  2AIF A;  2OZB A;  1KQS F;  1VQ4 F;  1Q81 H;  5A2Q M;  1K9M H;  3ON1 A;  5GIO C;  3SIV A;  1X7O A;  3JAM M;  3CCU F;  5FJ4 C;  1CK2 A;  3I56 F;  1H7M A;  1Q82 H;  3CCQ F;  1NMU B;  1M1K H;  3LFO A;  1E7K A;  3CC4 F;  2LBX A;  3IR9 A;  1VQM F;  3NK7 A;  1NJI H;  5GIP C;  3LWV C;  1W3E X;  1VQN F;  1K8A H;  3OW2 F;  1PXW A;  1VQ5 F;  1VQ7 F;  4C4W C;  2WAL A;  1VQO F;  1M90 H;  3CD6 F;  1K73 H;  3O85 A;  3CCL F;  3HAX D;  3LWR C;  3N4Y A;  3AGK A;  2I6D A;  2BO1 A;  2KG4 A;  1RA4 A;  3V7Q A;  5GAP K;  1YI2 F;  2VGM A;  3RA5 A;  3LWP C;  1RLG A;  3CC7 F;  3CCM F;  3HJW C;  3NVK E;  2KTU A;  2LBW A;  1SDS A;  5EWR A;  3PLA C;  1DT9 A;  2KTV A;  3CME F;  1YHQ F;  3VI6 A;  5GIN C;  1KC8 H;  1KD1 H;  1VQL F;  3CCS F;  4X3M A;  5DCV A;  5IT9 M;  3MCA B;  1X7P A;  3VMF B;  4BW0 B;  3OBW A;  5FLX M;  2QI2 A;  4BY9 D;  2HVY D;  3LWO C;  1VQ9 F;  3CCR F;  3G71 F;  2OTL F;  1GZ0 A;  2VGN A;  3FFM A;  3CC2 F;  1QVF F;  1W42 A;  1VQK F;  3NVI B;  4NUT A;  3WXM B;  3SIU A;  4LCK A;  3GYQ A;  1VQP F;  3N4Z A;  1ZWZ A;  2QEX F;  1IPA A;  1QVG F;  1S72 F;  3JCM M;  5G4V C;  1T0K B;  5GAN K;  1YIT F;  4X3L A;  1XBI A;  1YJW F;  3RA6 A;  3E1Y A;  3OBY A;  3CCJ F;  3G6E F;  1Q7Y H;  1JJ2 F;  3CCV F;  2QA4 F;  1VQ6 F;  2ALE A;  3CCE F;  5G4U C;  1N8R H;  3V7E A;  3CXC F;  4TZZ A;  1CN7 A;  3I55 F;  1Q86 H;  1VQ8 F;  3J81 M; 
#chains in the Genus database with same CATH topology
 4BT5 A;  1W40 A;  2GZL A;  4ZI7 A;  3JAK A;  4BVS A;  1FSZ A;  3NK6 A;  1H47 A;  4O4H B;  4U39 A;  4G4Y A;  1XRG A;  4BT3 A;  3LDT A;  2BTU A;  4C8G A;  1GO1 A;  3M84 A;  2JNB A;  2ZVY A;  3E20 B;  1FFX B;  3CPW F;  3RYI B;  4YJ2 A;  2CW4 A;  2QTP A;  2HP0 A;  3JAL B;  2Q1X A;  5KMG A;  3RE3 A;  5CA0 B;  1U43 A;  3JAM M;  1W5E A;  3LYB A;  2UZH A;  3MCQ A;  2GVI A;  5JCO A;  3DDN A;  5MN5 A;  1CK2 A;  1ODE A;  1PF5 A;  3KJJ A;  5KX5 B;  3S02 A;  1Q82 H;  2VAW A;  2RHJ A;  4HNA A;  5HXU A;  2G9I A;  2CVL A;  1VQM F;  1X25 A;  1NJI H;  4E6E A;  3VO8 A;  4KWE A;  4R40 B;  1W3E X;  3WJR A;  5BMV B;  3JAT A;  5JQG A;  3KIZ A;  1JFF B;  4XCQ A;  1VQO F;  2LCA A;  4X20 A;  1K73 H;  3JAW A;  2I6D A;  4I55 B;  5JVD A;  3TD5 A;  1W5B A;  3C9T A;  3L7Q A;  3HTN A;  1YI2 F;  1Q8R A;  3LWP C;  2Z1F A;  5JH7 A;  1W5A A;  3NVK E;  4I50 A;  2KTU A;  3PLA C;  1IV4 A;  4YJ3 A;  3S0Y A;  3JAR A;  1RLU A;  3HKD A;  4X3M A;  4LNU A;  3F6M A;  4BW0 B;  2W8B C;  5IYZ B;  2HVY D;  4DRX A;  3LWO C;  3MBM A;  3ZOP A;  4X1I A;  4NQ3 A;  1XHO A;  4EI7 A;  1XV2 A;  5EAZ A;  4NUT A;  1COM A;  3RYC A;  3GYQ A;  4TUY B;  1VQP F;  3N4Z A;  4G88 A;  1ZWZ A;  5J2T A;  2QEX F;  1QAH A;  3JCM M;  1T0K B;  5LOV B;  2VAP A;  1FNJ A;  4BT4 A;  2CHT A;  3GTZ A;  1YJW F;  4G4X A;  2ZOD A;  3CCJ F;  2KGW A;  3ZO8 A;  5HXZ A;  5IJ0 A;  3MDO A;  4BT7 A;  2QA4 F;  4O4I A;  2GLZ A;  5EIB D;  4M8I A;  1RQ2 A;  2BTO A;  2UYK A;  3E22 A;  3CXC F;  3VTI C;  4TV9 B;  4TZZ A;  5CA1 A;  2R75 1;  3WJQ A;  5J2U A;  3G4S F;  4X1Y B;  2FC3 A;  3CPQ A;  1W41 A;  4TV8 B;  5EO3 A;  2BTQ B;  1YIJ F;  4B45 A;  1U40 A;  4O4J B;  3HKE A;  1YJ9 F;  2YYE A;  3CMA F;  3PAF A;  3N2G A;  3J7A R;  4IHJ A;  5C8Y A;  2CZW A;  2OTJ F;  3TD4 A;  1VQV A;  2OHW A;  2ZF8 A;  4ZK7 A;  1JY8 A;  1X52 A;  3KHN A;  5HWE A;  4EI8 A;  1KQS F;  3ERN A;  1W57 A;  1Q81 H;  1YGY A;  5A2Q M;  5EB1 B;  1K9M H;  5GIO C;  5EB0 A;  3M4S A;  3WGL A;  2H8C A;  5MN6 A;  5FJ4 C;  5LYJ A;  3FD6 A;  1T0A A;  2Z1T A;  3LFO A;  3S0W A;  3CC4 F;  2HQS C;  3EOR A;  3KJK A;  3BYQ A;  2RB9 A;  3HKB B;  4U3J A;  5ITZ A;  3C9S A;  5LP6 B;  1VQN F;  3HKC B;  5EIB C;  1K8A H;  1J7H A;  5IJ0 B;  2Q1Y A;  1TVK A;  5CB4 A;  3K12 A;  1M90 H;  4BT2 A;  3O85 A;  5EYP A;  4ZHQ B;  3N4Y A;  3AGK A;  4ZHV A;  4B46 A;  3D54 A;  5IJ9 A;  5MN4 A;  4EB6 A;  3HWU A;  3GHZ A;  2KG4 A;  3V7Q A;  3JAS B;  2VGM A;  3P10 A;  3RA5 A;  1RLG A;  4O4L A;  5LXT B;  5HP7 A;  1DT9 A;  3RYH A;  2KTV A;  1YHQ F;  3ZP7 A;  5GIN C;  1TUB B;  1KD1 H;  3WGK A;  1VQL F;  3WPX A;  4ZOL B;  3F0G A;  3CCS F;  4EI9 A;  5DCV A;  3ELC A;  3N2K B;  1SA0 A;  2IQQ A;  3OBW A;  3WGM A;  2QI2 A;  2VXY A;  4BY9 D;  1SZQ A;  3C8L A;  3C9U A;  1VQ9 F;  1JD1 A;  1KNK A;  3FFM A;  1UI9 A;  3VYT C;  1VQK F;  2L26 A;  4IIJ A;  5FNV A;  1DBF A;  4X1K A;  4LCK A;  4ZI7 B;  3JAK B;  4I4T A;  2NMU A;  3VIU A;  4G4Z A;  4FFB A;  3V3T A;  2ZOV A;  5G4V C;  4O2B A;  3T80 A;  3VOA A;  4F6R A;  4WBN A;  3RA6 A;  3CB2 A;  3E1Y A;  3OBY A;  3G6E F;  3WJP A;  1Q7Y H;  3IKE A;  3CCV F;  2ALE A;  3RYF A;  5G4U C;  2EWC A;  4YJ2 B;  5HP8 A;  2HP0 B;  5KMG B;  4BVQ A;  1Q86 H;  4C82 A;  4ZHY B;  3JVH A;  2DT4 A;  3LWQ C;  2Z1E A;  3I3F A;  4O4L B;  4DXD A;  3VYS C;  3K14 A;  3NMU C;  3DC2 A;  4HNA B;  2LBT A;  5EZY A;  1YJN F;  5GON A;  1U3L A;  3WGN A;  1ONI A;  3M1X A;  3U0O A;  1IV2 A;  5HY2 A;  3FD5 A;  3D01 A;  3JAT B;  5LA6 A;  5JQG B;  2HP3 A;  2AIF A;  2OZB A;  1R1M A;  5HY4 A;  4X20 B;  3P4E A;  3UT5 A;  3JAW B;  3ON1 A;  1OFU A;  1X7O A;  5JVD B;  2CWJ A;  3CCU F;  2H6L A;  5JH7 B;  3I56 F;  3D00 A;  1E7K A;  3CCQ F;  1NMU B;  1QU9 A;  3I7T A;  4O4H A;  4I50 B;  1M1K H;  2MQE A;  3IR9 A;  1FNK A;  3TD3 A;  4YJ3 B;  3VOB A;  2CHS A;  3JAR B;  4WBN B;  3LWV C;  5AVM A;  1FFX A;  2HRY A;  2P6Y A;  3HKD B;  3OW2 F;  1PXW A;  3RYI A;  3IKF A;  1VQ5 F;  4LNU B;  1VQ7 F;  2WAL A;  3CD6 F;  3CCL F;  3HAX D;  2RHO A;  3LWR C;  3ESJ A;  5CA0 A;  4DRX B;  1Z5W A;  2AIZ P;  3F0E A;  4X1I B;  3S03 A;  5GAP K;  4BT6 A;  3CCM F;  3RYC B;  2LBW A;  5J2T B;  3C9R A;  3CME F;  2UYJ A;  3VI6 A;  2K1S A;  1CLI A;  4O2A A;  2Z01 A;  5BMV A;  4C81 A;  1JFF A;  1RQ7 A;  2FGY A;  1VHA A;  2RHH A;  1X7P A;  3MCA B;  3VMF B;  2N48 A;  4O4I B;  3KE1 A;  2ZAU A;  5FLX M;  1UFY A;  3E22 B;  4G4W A;  3ZP4 A;  2AMT A;  4I55 A;  5CA1 B;  3G71 F;  1GZ0 A;  2B33 A;  5J2U B;  1W5F A;  2ZVZ A;  3WXM B;  5LP6 C;  4B62 A;  1VH8 A;  3WGJ A;  1IPA A;  1S72 F;  1W58 1;  4X3L A;  3HKE B;  1XBI A;  3FPI A;  3N2G B;  3K2X A;  1JJ2 F;  4IHJ B;  5C8Y B;  4PWT A;  1VQ6 F;  2HRU A;  3CCE F;  5IYZ A;  3V7E A;  3IEW A;  2PMP A;  5B8F A;  5HY0 A;  2DYY A;  2HS3 A;  3S0H A;  3F0D A;  3R0P A;  3CG6 A;  4TUY A;  1U3P A;  1GO0 A;  5LYJ B;  1VQ8 F;  1YQN A;  3CYP B;  5LOV A;  3F0F A;  4O2A B;  2UYP A;  1JN1 A;  1QD9 A;  4U3J B;  5ITZ B;  3J80 M;  3LME A;  1W2B F;  1TVK B;  5CB4 B;  4TV9 A;  1VQ4 F;  2HX0 A;  5EYP B;  4BVT A;  3K0T A;  3SIV A;  4X1Y A;  1IV1 A;  1NQ3 A;  4C8E A;  4EB6 B;  5IJ9 B;  2Z1U A;  4TV8 A;  2UYN A;  2R6R 1;  3WPW A;  2PHN A;  1H7M A;  4O4J A;  2LBX A;  3IEQ A;  3RYH B;  3NK7 A;  5GIP C;  4BVR A;  3P0Z A;  3Q8H A;  4C4W C;  1SA0 B;  1W59 A;  1GX1 A;  3CYQ A;  5JCO C;  3IMP A;  3VYU C;  2BO1 A;  3B6N A;  1RA4 A;  4B5C A;  3VCZ A;  4ZHW A;  5HY1 A;  3CC7 F;  4IIJ B;  5FNV B;  4X1K B;  3HJW C;  1Z5V A;  4I4T B;  2OTM A;  2VAM A;  3OON A;  1IV3 A;  1SDS A;  5EWR A;  3V4D A;  2HS4 A;  4FFB B;  3MQW A;  3HKB A;  1KC8 H;  2RHL A;  4O2B B;  4F6R B;  5LP6 A;  3HKC A;  4RHA A;  2I6R A;  4ERH A;  5IT9 M;  2HS0 A;  3QHD A;  3RYF B;  3JAL A;  4ZHQ A;  2IAF A;  2IG8 A;  3CCR F;  3JAS A;  2OTL F;  3QUW A;  2V9Y A;  2VGN A;  3CC2 F;  3SIU A;  2UYN B;  1OAP A;  1W42 A;  2F9Z C;  5LXT A;  1QVF F;  3NVI B;  3S06 A;  1KNJ A;  5KX5 A;  1QVG F;  3QTY A;  1W55 A;  5GAN K;  1TUB A;  4G4V A;  1YIT F;  5EZY B;  5GON B;  4ZOL A;  1VK3 A;  2CSL A;  4RQO A;  3N2K A;  2H8E A;  5LA6 B;  1N8R H;  3FBA A;  2YXZ A;  4NWO B;  4C8I A;  1CN7 A;  3I55 F;  1H48 A;  3UT5 B;  3J81 M; 
#chains in the Genus database with same CATH homology
 3LWQ C;  3G4S F;  2FC3 A;  3CPQ A;  1W40 A;  1W41 A;  3CG6 A;  5EO3 A;  4BVS A;  1YIJ F;  1GO0 A;  3NK6 A;  3NMU C;  1YJN F;  1YJ9 F;  3CMA F;  3J7A R;  3PAF A;  1GO1 A;  2JNB A;  5HY2 A;  3E20 B;  3J80 M;  2CZW A;  2OTJ F;  2OHW A;  3CPW F;  1W2B F;  1X52 A;  2AIF A;  2OZB A;  5HWE A;  4EI8 A;  1KQS F;  5HY4 A;  1VQ4 F;  1Q81 H;  5A2Q M;  1K9M H;  4BVT A;  3ON1 A;  5GIO C;  3SIV A;  1X7O A;  3JAM M;  3CCU F;  5FJ4 C;  1CK2 A;  3I56 F;  1H7M A;  3D00 A;  3CCQ F;  1NMU B;  1Q82 H;  3LFO A;  1M1K H;  5HXU A;  1E7K A;  3CC4 F;  2LBX A;  3IR9 A;  1VQM F;  3NK7 A;  1NJI H;  5GIP C;  3LWV C;  1W3E X;  1VQN F;  4BVR A;  1K8A H;  3OW2 F;  1PXW A;  1VQ5 F;  1VQ7 F;  4C4W C;  2WAL A;  4XCQ A;  1VQO F;  1M90 H;  1K73 H;  3O85 A;  3CD6 F;  3CCL F;  3HAX D;  3LWR C;  3N4Y A;  3AGK A;  2I6D A;  2BO1 A;  2KG4 A;  1RA4 A;  3V7Q A;  5GAP K;  1YI2 F;  2VGM A;  3RA5 A;  3LWP C;  1RLG A;  5HY1 A;  3CC7 F;  3CCM F;  3HJW C;  3NVK E;  2KTU A;  2LBW A;  1SDS A;  5EWR A;  3PLA C;  1DT9 A;  2KTV A;  3CME F;  1YHQ F;  3VI6 A;  5GIN C;  1KC8 H;  1KD1 H;  1VQL F;  3CCS F;  4EI9 A;  4X3M A;  5DCV A;  5IT9 M;  2FGY A;  3MCA B;  1X7P A;  3VMF B;  4BW0 B;  3OBW A;  5FLX M;  2QI2 A;  4BY9 D;  2HVY D;  3LWO C;  1VQ9 F;  3CCR F;  4NQ3 A;  3G71 F;  2OTL F;  1GZ0 A;  2VGN A;  4EI7 A;  3FFM A;  3CC2 F;  1QVF F;  1W42 A;  1VQK F;  2F9Z C;  4NUT A;  3WXM B;  3NVI B;  3SIU A;  3GYQ A;  1VQP F;  4LCK A;  3N4Z A;  1ZWZ A;  2QEX F;  1IPA A;  1QVG F;  1S72 F;  3JCM M;  3V3T A;  5G4V C;  5GAN K;  1T0K B;  1YIT F;  4X3L A;  1XBI A;  1YJW F;  3RA6 A;  3E1Y A;  3OBY A;  3CCJ F;  3G6E F;  1Q7Y H;  1JJ2 F;  5HXZ A;  3CCV F;  2QA4 F;  1VQ6 F;  2GLZ A;  2ALE A;  3CCE F;  5G4U C;  1N8R H;  3V7E A;  3CXC F;  5HY0 A;  4TZZ A;  1CN7 A;  4BVQ A;  3I55 F;  1Q86 H;  1VQ8 F;  3J81 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...