1M90H

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m90H00
2QI2A 1Q81H 3V7QA 3CCLF 1VQPF 1X7OA 1M1KH 3I55F 3G71F 1VQ7F 1X7PA 1N8RH 3J81M 2JNBA 5FLXM 3OBWA 5GIOC 3G4SF 5GANK 3NK6A 1VQ6F 3NVIB 3CPQA 3J80M 3E20B 2KTVA 3OBYA 3VMFB 1YHQF 5FJ4C 3RA5A 3CCJF 3RA6A 2ALEA 2OTLF 3CC2F 1VQ9F 2BO1A 3ON1A 4X3LA 5G4UC 1Q7YH 3AGKA 3CC4F 3E1YA 1DT9A 1ZWZA 2VGMA 3JAMM 1IPAA 1KD1H 3CMAF 3CPWF 2OHWA 2OZBA 4TZZA 3CCMF 2CZWA 2I6DA 3CCUF 3G6EF 1W3EX 2OTJF 1GO1A 1VQ4F 3IR9A 3CCSF 2HVYD 1M90H 3HAXD 3CCEF 3OW2F 1W42A 3VI6A 5G4VC 1VQOF 1W41A 3NK7A 3NVKE 3PLAC 3O85A 4NUTA 1VQMF 2KTUA 4X3MA 3LWPC 3CC7F 2QEXF 2LBWA 1KC8H 4BY9D 1VQNF 1JJ2F 1QVFF 3J7AR 3WXMB 1GO0A 5IT9M 1Q86H 3CXCF 3CG6A 1W2BF 3GYQA 1VQ8F 1H7MA 1YJ9F 1W40A 1K73H 3SIUA 3LFOA 1SDSA 1K9MH 5GIPC 3CCRF 1QVGF 1NJIH 1XBIA 1S72F 3N4YA 3JCMM 1PXWA 2KG4A 2LBXA 3I56F 1CK2A 1GZ0A 3N4ZA 3FFMA 3LWQC 3LWVC 1YIJF 5GINC 1NMUB 3LWRC 4C4WC 1YJWF 1E7KA 1YITF 1YJNF 1VQ5F 1RLGA 1Q82H 5A2QM 3V7EA 4BW0B 2WALA 5DCVA 1K8AH 3CCVF 4LCKA 3MCAB 3CD6F 1VQKF 2QA4F 3PAFA 3CMEF 2VGNA 3CCQF 3HJWC 3LWOC 1KQSF 5GAPK 2FC3A 2AIFA 1T0KB 3NMUC 1CN7A 3SIVA 1X52A 5EWRA 1VQLF 1YI2F 1RA4A 5EO3A
chains in the Genus database with same CATH superfamily
4B46A 1Q81H 3D01A 3C9SA 3FBAA 5JQGA 1X7OA 4EI7A 1J7HA 1VQ7F 3HKDB 4TV8B 4EB6A 5FLXM 3OBWA 4ZOLB 5EYPA 5GIOC 2RHOA 1VQ6F 5HY0A 3TD4A 3CPQA 1W57A 2CVLA 3E20B 1TVKB 1X25A 1OAPA 4TV9B 3CB2A 3HWUA 5C8YA 5CA0B 3HKEA 1VQ9F 1UI9A 2BO1A 5J2UA 3MDOA 3C9UA 1GX1A 1FNKA 3CC4F 2UZHA 2VGMA 2Z1FA 5MN5A 5AVMA 4DXDA 3N2GB 4ZHQA 3CCUF 2CW4A 3M84A 5EB1B 3G6EF 2OTJF 1GO1A 2QTPA 1VQ4F 3HAXD 3CCEF 5LOVB 3UT5B 2UYNA 4FFBA 4BT3A 5GONA 2H8EA 4U39A 5CB4A 1VQOF 1XV2A 3DDNA 4G4YA 3T80A 3JATB 4BT2A 3EORA 3RYCB 3NVKE 3Q8HA 3O85A 4BT4A 5HP7A 1RQ7A 1SZQA 1QAHA 3VOBA 4TUYA 1W55A 1U3PA 2QEXF 4C8IA 2F9ZC 5IT9M 3CXCF 2ZODA 2ZAUA 4YJ3B 4TUYB 3HKBA 4EI9A 1YJ9F 3KIZA 3VYTC 1SDSA 5HP8A 1R1MA 2HQSC 3CCRF 4IHJB 1FFXB 1QVGF 1NJIH 1VK3A 2Q1XA 3DC2A 3V3TA 3JCMM 3UT5A 3M1XA 3F0FA 3ELCA 3ESJA 4C4WC 1YJWF 2RHHA 4C8EA 4RHAA 1RLGA 3WGMA 3JALA 5HWEA 2HX0A 3JARB 3CMEF 2VGNA 3HJWC 1CN7A 2FC3A 3LYBA 5BMVB 3VIUA 1YI2F 4C82A 5EO3A 4X1KB 2QI2A 3IKFA 3V7QA 3RYIB 3QTYA 3RYFB 1VQPF 1COMA 5FNVB 4X1KA 1FNJA 3G4SF 1U3LA 2UYPA 1YHQF 3VMFB 1FSZA 3B6NA 3N2KA 4G4ZA 2HS3A 5LP6C 1H47A 3RA6A 2OTLF 4F6RB 2RHJA 3ON1A 4LNUB 3N2KB 2HRUA 4X3LA 3S0YA 3ZO8A 5LYJA 2NMUA 3JAMM 2R6R1 2CHTA 3CPWF 1JN1A 1H48A 2OHWA 5GONB 1JY8A 3D54A 4I55B 4ERHA 3HKCA 3QHDA 2I6DA 3R0PA 2FGYA 3K2XA 1U40A 2YYEA 3CCSF 5IJ9A 1IV3A 2RB9A 3OW2F 4R40B 2LCAA 5IJ0B 5J2TB 3VI6A 4LNUA 3K0TA 4ZK7A 1QU9A 4WBNB 1U43A 2CSLA 3PLAC 4O4IB 4NUTA 5KX5B 1VQMF 5EIBC 4IIJA 4X3MA 4I4TB 5J2UB 4BT5A 2VAWA 3KE1A 3FPIA 3I7TA 1KC8H 4BY9D 1JJ2F 1QVFF 3OONA 2HP0B 4B45A 4C8GA 1GO0A 1Q86H 1W2BF 4O2BB 1H7MA 2RHLA 3TD5A 1W40A 3MBMA 2GVIA 3VCZA 5LP6B 2CWJA 3S0HA 5HY2A 5JH7B 3F0EA 4E6EA 3IKEA 3IEQA 1S72F 3JASA 3RE3A 5MN6A 5JVDB 3JARA 1Z5WA 1GZ0A 3LWQC 3FFMA 5IYZB 2GLZA 3QUWA 3K12A 1PF5A 4O2AA 1VH8A 2PHNA 1W581 3WGNA 4DRXA 1NMUB 4KWEA 3LMEA 4HNAA 1YITF 2P6YA 1YJNF 2AMTA 3JASB 5A2QM 4M8IA 4BW0B 5DCVA 1K8AH 3CCVF 2Z1TA 3CD6F 2QA4F 3KHNA 4PWTA 4TV9A 4ZHYB 2DYYA 1UFYA 4NQ3A 2UYNB 4FFBB 3NMUC 5GAPK 2AIFA 4O4HB 4ZI7B 5EWRA 1VQLF 4ZOLA 5EYPB 1W5FA 3ZP4A 3BYQA 2AIZP 2IQQA 2BTQB 1RQ2A 4X20A 3CCLF 2IAFA 1M1KH 2BTOA 4O4IA 1X7PA 2Z1EA 4YJ3A 3V4DA 3C8LA 3RYHB 4G4XA 3FD5A 2K1SA 2R751 3NVIB 1NQ3A 1ONIA 3J80M 2KTVA 4RQOA 1DBFA 2Z1UA 3F0DA 3WGJA 5FJ4C 2V9YA 5EZYA 3RA5A 3CCJF 2DT4A 4O4LA 1ODEA 1SA0B 2ZVZA 5CB4B 3L7QA 2HP3A 2PMPA 4O4JB 3VO8A 4X20B 3ERNA 1Q7YH 5LOVA 4BVSA 3AGKA 5LA6A 3GTZA 2UYJA 3VOAA 1DT9A 4EB6B 2ZVYA 4I50A 5KMGA 3CMAF 2YXZA 2OZBA 3M4SA 4BVQA 5JCOC 3E22B 2CZWA 3KJJA 4DRXB 1W3EX 2OTMA 5JCOA 3WJQA 3IR9A 2HVYD 4BT7A 2LBTA 2HS4A 5JVDA 2G9IA 5G4VC 5EB0A 2H8CA 3C9RA 3NK7A 4O2AB 1JFFB 3TD3A 3S06A 5CA0A 2Q1YA 3CYPB 5HXUA 5FNVA 5CA1A 2KTUA 3CC7F 3RYIA 2LBWA 4ZHVA 3RYFA 2N48A 3WXMB 2VXYA 3CG6A 3GYQA 4HNAB 5CA1B 4X1IA 1YQNA 3WJRA 1Z5VA 1K73H 3SIUA 3LFOA 1SA0A 1JFFA 1YGYA 1XBIA 3N4YA 1PXWA 5KX5A 2UYKA 2LBXA 4B5CA 5IJ0A 5J2TA 3I56F 1CK2A 3ZOPA 4I50B 5KMGB 2GZLA 5JH7A 1YIJF 2VAMA 3P10A 2CHSA 5LP6A 3HKCB 1TVKA 2Z01A 2BTUA 1Q82H 1W5BA 4O4LB 4LCKA 2EWCA 4IHJA 1TUBB 1IV2A 1VQKF 3KJKA 3HKBB 3LWOC 1KQSF 2I6RA 1VHAA 2HS0A 1T0KB 3SIVA 4C81A 5EAZA 4F6RA 5HY1A 1KNKA 5EZYB 3RYHA 4NWOB 3CYQA 4XCQA 3I55F 2VAPA 3G71F 1W5EA 3C9TA 1N8RH 1QD9A 3J81M 2JNBA 2W8BC 3HKEB 4YJ2A 5C8YB 3JAWA 5GANK 3NK6A 2ZF8A 2MQEA 1IV1A 4I55A 3OBYA 3S03A 5EIBD 3IMPA 3WPXA 5HY4A 3JAKB 2ALEA 5LYJB 4O4HA 4ZI7A 3CC2F 5G4UC 5LXTB 3IEWA 2KGWA 5ITZA 3E1YA 4U3JA 1ZWZA 4X1YB 5IYZA 2B33A 1IPAA 1KD1H 3MCQA 3FD6A 1W59A 4TZZA 3CCMF 4EI8A 3JALB 4BT6A 5ITZB 1W5AA 3S02A 4U3JB 1M90H 3S0WA 3P4EA 1Q8RA 3E22A 1W42A 2H6LA 3VTIC 4ZHWA 3WPWA 1W41A 4B62A 4O2BA 5IJ9B 1FFXA 1CLIA 3WGKA 5MN4A 5LA6B 3JAKA 2HP0A 4TV8A 3HKDA 3LWPC 4O4JA 3JAWB 3MQWA 5JQGB 1VQNF 4YJ2B 3J7AR 5HXZA 2L26A 3WJPA 4I4TA 4IIJB 3U0OA 1VQ8F 4BVRA 1VQVA 3HTNA 3JVHA 3VYUC 1K9MH 5GIPC 1RLUA 4WBNA 1JD1A 4BVTA 3ZP7A 5LXTA 4X1IB 2KG4A 3D00A 1TUBA 1OFUA 3N4ZA 3JATA 3F0GA 3RYCA 5GINC 3LWVC 1T0AA 5B8FA 3WGLA 2HRYA 4G4VA 1XHOA 3LWRC 3N2GA 4ZHQB 3I3FA 2IG8A 1XRGA 3P0ZA 4G88A 1E7KA 1VQ5F 3V7EA 1IV4A 2WALA 3K14A 5BMVA 3F6MA 3MCAB 1KNJA 3PAFA 3CCQF 3VYSC 3LDTA 3GHZA 1X52A 4X1YA 2ZOVA 4G4WA 1RA4A
chains in the Genus database with same CATH topology
2QI2A 1Q81H 3V7QA 3CCLF 1VQPF 1X7OA 4XCQA 4EI7A 1M1KH 3I55F 3G71F 1VQ7F 1X7PA 1N8RH 3J81M 2JNBA 5FLXM 3OBWA 5GIOC 3G4SF 5GANK 3NK6A 5HY0A 1VQ6F 3NVIB 3CPQA 3E20B 2KTVA 3OBYA 3VMFB 3J80M 1YHQF 5FJ4C 5HY4A 3RA5A 3CCJF 3RA6A 2ALEA 2OTLF 3CC2F 1VQ9F 2BO1A 3ON1A 4X3LA 5G4UC 1Q7YH 4BVSA 3AGKA 3CC4F 3E1YA 1DT9A 1ZWZA 2VGMA 3JAMM 1IPAA 1KD1H 3CMAF 3CPWF 2OHWA 2OZBA 4TZZA 4BVQA 3CCMF 2CZWA 2I6DA 4EI8A 3CCUF 2FGYA 3G6EF 1W3EX 2OTJF 1GO1A 1VQ4F 3IR9A 3CCSF 2HVYD 1M90H 3HAXD 3CCEF 3OW2F 1W42A 3VI6A 5G4VC 1VQOF 1W41A 3NK7A 3NVKE 3PLAC 3O85A 5HXUA 4NUTA 1VQMF 2KTUA 4X3MA 3LWPC 3CC7F 2QEXF 2LBWA 1KC8H 4BY9D 2F9ZC 1VQNF 1JJ2F 1QVFF 3J7AR 5HXZA 3WXMB 1GO0A 5IT9M 1Q86H 3CXCF 3CG6A 1W2BF 3GYQA 1VQ8F 4BVRA 4EI9A 1H7MA 1YJ9F 1W40A 1K73H 3SIUA 3LFOA 1SDSA 1K9MH 5GIPC 3CCRF 5HY2A 4BVTA 1QVGF 1NJIH 1XBIA 1S72F 3N4YA 3V3TA 3JCMM 1PXWA 1VQLF 2KG4A 3D00A 2LBXA 3I56F 1CK2A 1GZ0A 3N4ZA 3FFMA 3LWQC 2GLZA 3LWVC 1YIJF 5GINC 1NMUB 3LWRC 4C4WC 1YJWF 1E7KA 1YITF 1YJNF 1VQ5F 1RLGA 1Q82H 5A2QM 3V7EA 4BW0B 2WALA 5DCVA 5HWEA 1K8AH 3CCVF 4LCKA 3MCAB 3CD6F 1VQKF 2QA4F 3PAFA 3CMEF 4NQ3A 2VGNA 3CCQF 3HJWC 3LWOC 1KQSF 5GAPK 2FC3A 2AIFA 1T0KB 3NMUC 1CN7A 3SIVA 1X52A 5EWRA 5HY1A 1YI2F 1RA4A 5EO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QI2 A;  1Q81 H;  3V7Q A;  3CCL F;  1VQP F;  1X7O A;  1M1K H;  3I55 F;  3G71 F;  1VQ7 F;  1X7P A;  1N8R H;  3J81 M;  2JNB A;  5FLX M;  3OBW A;  5GIO C;  3G4S F;  5GAN K;  3NK6 A;  1VQ6 F;  3NVI B;  3CPQ A;  3J80 M;  3E20 B;  2KTV A;  3OBY A;  3VMF B;  1YHQ F;  5FJ4 C;  3RA5 A;  3CCJ F;  3RA6 A;  2ALE A;  2OTL F;  3CC2 F;  1VQ9 F;  2BO1 A;  3ON1 A;  4X3L A;  5G4U C;  1Q7Y H;  3AGK A;  3CC4 F;  3E1Y A;  1DT9 A;  1ZWZ A;  2VGM A;  3JAM M;  1IPA A;  1KD1 H;  3CMA F;  3CPW F;  2OHW A;  2OZB A;  4TZZ A;  3CCM F;  2CZW A;  2I6D A;  3CCU F;  3G6E F;  1W3E X;  2OTJ F;  1GO1 A;  1VQ4 F;  3IR9 A;  3CCS F;  2HVY D;  1M90 H;  3HAX D;  3CCE F;  3OW2 F;  1W42 A;  3VI6 A;  5G4V C;  1VQO F;  1W41 A;  3NK7 A;  3NVK E;  3PLA C;  3O85 A;  4NUT A;  1VQM F;  2KTU A;  4X3M A;  3LWP C;  3CC7 F;  2QEX F;  2LBW A;  1KC8 H;  4BY9 D;  1VQN F;  1JJ2 F;  1QVF F;  3J7A R;  3WXM B;  1GO0 A;  5IT9 M;  1Q86 H;  3CXC F;  3CG6 A;  1W2B F;  3GYQ A;  1VQ8 F;  1H7M A;  1YJ9 F;  1W40 A;  1K73 H;  3SIU A;  3LFO A;  1SDS A;  1K9M H;  5GIP C;  3CCR F;  1QVG F;  1NJI H;  1XBI A;  1S72 F;  3N4Y A;  3JCM M;  1PXW A;  2KG4 A;  2LBX A;  3I56 F;  1CK2 A;  1GZ0 A;  3N4Z A;  3FFM A;  3LWQ C;  3LWV C;  1YIJ F;  5GIN C;  1NMU B;  3LWR C;  4C4W C;  1YJW F;  1E7K A;  1YIT F;  1YJN F;  1VQ5 F;  1RLG A;  1Q82 H;  5A2Q M;  3V7E A;  4BW0 B;  2WAL A;  5DCV A;  1K8A H;  3CCV F;  4LCK A;  3MCA B;  3CD6 F;  1VQK F;  2QA4 F;  3PAF A;  3CME F;  2VGN A;  3CCQ F;  3HJW C;  3LWO C;  1KQS F;  5GAP K;  2FC3 A;  2AIF A;  1T0K B;  3NMU C;  1CN7 A;  3SIV A;  1X52 A;  5EWR A;  1VQL F;  1YI2 F;  1RA4 A;  5EO3 A; 
#chains in the Genus database with same CATH topology
 4B46 A;  1Q81 H;  3D01 A;  3C9S A;  3FBA A;  5JQG A;  1X7O A;  4EI7 A;  1J7H A;  1VQ7 F;  3HKD B;  4TV8 B;  4EB6 A;  5FLX M;  3OBW A;  4ZOL B;  5EYP A;  5GIO C;  2RHO A;  1VQ6 F;  5HY0 A;  3TD4 A;  3CPQ A;  1W57 A;  2CVL A;  3E20 B;  1TVK B;  1X25 A;  1OAP A;  4TV9 B;  3CB2 A;  3HWU A;  5C8Y A;  5CA0 B;  3HKE A;  1VQ9 F;  1UI9 A;  2BO1 A;  5J2U A;  3MDO A;  3C9U A;  1GX1 A;  1FNK A;  3CC4 F;  2UZH A;  2VGM A;  2Z1F A;  5MN5 A;  5AVM A;  4DXD A;  3N2G B;  4ZHQ A;  3CCU F;  2CW4 A;  3M84 A;  5EB1 B;  3G6E F;  2OTJ F;  1GO1 A;  2QTP A;  1VQ4 F;  3HAX D;  3CCE F;  5LOV B;  3UT5 B;  2UYN A;  4FFB A;  4BT3 A;  5GON A;  2H8E A;  4U39 A;  5CB4 A;  1VQO F;  1XV2 A;  3DDN A;  4G4Y A;  3T80 A;  3JAT B;  4BT2 A;  3EOR A;  3RYC B;  3NVK E;  3Q8H A;  3O85 A;  4BT4 A;  5HP7 A;  1RQ7 A;  1SZQ A;  1QAH A;  3VOB A;  4TUY A;  1W55 A;  1U3P A;  2QEX F;  4C8I A;  2F9Z C;  5IT9 M;  3CXC F;  2ZOD A;  2ZAU A;  4YJ3 B;  4TUY B;  3HKB A;  4EI9 A;  1YJ9 F;  3KIZ A;  3VYT C;  1SDS A;  5HP8 A;  1R1M A;  2HQS C;  3CCR F;  4IHJ B;  1FFX B;  1QVG F;  1NJI H;  1VK3 A;  2Q1X A;  3DC2 A;  3V3T A;  3JCM M;  3UT5 A;  3M1X A;  3F0F A;  3ELC A;  3ESJ A;  4C4W C;  1YJW F;  2RHH A;  4C8E A;  4RHA A;  1RLG A;  3WGM A;  3JAL A;  5HWE A;  2HX0 A;  3JAR B;  3CME F;  2VGN A;  3HJW C;  1CN7 A;  2FC3 A;  3LYB A;  5BMV B;  3VIU A;  1YI2 F;  4C82 A;  5EO3 A;  4X1K B;  2QI2 A;  3IKF A;  3V7Q A;  3RYI B;  3QTY A;  3RYF B;  1VQP F;  1COM A;  5FNV B;  4X1K A;  1FNJ A;  3G4S F;  1U3L A;  2UYP A;  1YHQ F;  3VMF B;  1FSZ A;  3B6N A;  3N2K A;  4G4Z A;  2HS3 A;  5LP6 C;  1H47 A;  3RA6 A;  2OTL F;  4F6R B;  2RHJ A;  3ON1 A;  4LNU B;  3N2K B;  2HRU A;  4X3L A;  3S0Y A;  3ZO8 A;  5LYJ A;  2NMU A;  3JAM M;  2R6R 1;  2CHT A;  3CPW F;  1JN1 A;  1H48 A;  2OHW A;  5GON B;  1JY8 A;  3D54 A;  4I55 B;  4ERH A;  3HKC A;  3QHD A;  2I6D A;  3R0P A;  2FGY A;  3K2X A;  1U40 A;  2YYE A;  3CCS F;  5IJ9 A;  1IV3 A;  2RB9 A;  3OW2 F;  4R40 B;  2LCA A;  5IJ0 B;  5J2T B;  3VI6 A;  4LNU A;  3K0T A;  4ZK7 A;  1QU9 A;  4WBN B;  1U43 A;  2CSL A;  3PLA C;  4O4I B;  4NUT A;  5KX5 B;  1VQM F;  5EIB C;  4IIJ A;  4X3M A;  4I4T B;  5J2U B;  4BT5 A;  2VAW A;  3KE1 A;  3FPI A;  3I7T A;  1KC8 H;  4BY9 D;  1JJ2 F;  1QVF F;  3OON A;  2HP0 B;  4B45 A;  4C8G A;  1GO0 A;  1Q86 H;  1W2B F;  4O2B B;  1H7M A;  2RHL A;  3TD5 A;  1W40 A;  3MBM A;  2GVI A;  3VCZ A;  5LP6 B;  2CWJ A;  3S0H A;  5HY2 A;  5JH7 B;  3F0E A;  4E6E A;  3IKE A;  3IEQ A;  1S72 F;  3JAS A;  3RE3 A;  5MN6 A;  5JVD B;  3JAR A;  1Z5W A;  1GZ0 A;  3LWQ C;  3FFM A;  5IYZ B;  2GLZ A;  3QUW A;  3K12 A;  1PF5 A;  4O2A A;  1VH8 A;  2PHN A;  1W58 1;  3WGN A;  4DRX A;  1NMU B;  4KWE A;  3LME A;  4HNA A;  1YIT F;  2P6Y A;  1YJN F;  2AMT A;  3JAS B;  5A2Q M;  4M8I A;  4BW0 B;  5DCV A;  1K8A H;  3CCV F;  2Z1T A;  3CD6 F;  2QA4 F;  3KHN A;  4PWT A;  4TV9 A;  4ZHY B;  2DYY A;  1UFY A;  4NQ3 A;  2UYN B;  4FFB B;  3NMU C;  5GAP K;  2AIF A;  4O4H B;  4ZI7 B;  5EWR A;  1VQL F;  4ZOL A;  5EYP B;  1W5F A;  3ZP4 A;  3BYQ A;  2AIZ P;  2IQQ A;  2BTQ B;  1RQ2 A;  4X20 A;  3CCL F;  2IAF A;  1M1K H;  2BTO A;  4O4I A;  1X7P A;  2Z1E A;  4YJ3 A;  3V4D A;  3C8L A;  3RYH B;  4G4X A;  3FD5 A;  2K1S A;  2R75 1;  3NVI B;  1NQ3 A;  1ONI A;  3J80 M;  2KTV A;  4RQO A;  1DBF A;  2Z1U A;  3F0D A;  3WGJ A;  5FJ4 C;  2V9Y A;  5EZY A;  3RA5 A;  3CCJ F;  2DT4 A;  4O4L A;  1ODE A;  1SA0 B;  2ZVZ A;  5CB4 B;  3L7Q A;  2HP3 A;  2PMP A;  4O4J B;  3VO8 A;  4X20 B;  3ERN A;  1Q7Y H;  5LOV A;  4BVS A;  3AGK A;  5LA6 A;  3GTZ A;  2UYJ A;  3VOA A;  1DT9 A;  4EB6 B;  2ZVY A;  4I50 A;  5KMG A;  3CMA F;  2YXZ A;  2OZB A;  3M4S A;  4BVQ A;  5JCO C;  3E22 B;  2CZW A;  3KJJ A;  4DRX B;  1W3E X;  2OTM A;  5JCO A;  3WJQ A;  3IR9 A;  2HVY D;  4BT7 A;  2LBT A;  2HS4 A;  5JVD A;  2G9I A;  5G4V C;  5EB0 A;  2H8C A;  3C9R A;  3NK7 A;  4O2A B;  1JFF B;  3TD3 A;  3S06 A;  5CA0 A;  2Q1Y A;  3CYP B;  5HXU A;  5FNV A;  5CA1 A;  2KTU A;  3CC7 F;  3RYI A;  2LBW A;  4ZHV A;  3RYF A;  2N48 A;  3WXM B;  2VXY A;  3CG6 A;  3GYQ A;  4HNA B;  5CA1 B;  4X1I A;  1YQN A;  3WJR A;  1Z5V A;  1K73 H;  3SIU A;  3LFO A;  1SA0 A;  1JFF A;  1YGY A;  1XBI A;  3N4Y A;  1PXW A;  5KX5 A;  2UYK A;  2LBX A;  4B5C A;  5IJ0 A;  5J2T A;  3I56 F;  1CK2 A;  3ZOP A;  4I50 B;  5KMG B;  2GZL A;  5JH7 A;  1YIJ F;  2VAM A;  3P10 A;  2CHS A;  5LP6 A;  3HKC B;  1TVK A;  2Z01 A;  2BTU A;  1Q82 H;  1W5B A;  4O4L B;  4LCK A;  2EWC A;  4IHJ A;  1TUB B;  1IV2 A;  1VQK F;  3KJK A;  3HKB B;  3LWO C;  1KQS F;  2I6R A;  1VHA A;  2HS0 A;  1T0K B;  3SIV A;  4C81 A;  5EAZ A;  4F6R A;  5HY1 A;  1KNK A;  5EZY B;  3RYH A;  4NWO B;  3CYQ A;  4XCQ A;  3I55 F;  2VAP A;  3G71 F;  1W5E A;  3C9T A;  1N8R H;  1QD9 A;  3J81 M;  2JNB A;  2W8B C;  3HKE B;  4YJ2 A;  5C8Y B;  3JAW A;  5GAN K;  3NK6 A;  2ZF8 A;  2MQE A;  1IV1 A;  4I55 A;  3OBY A;  3S03 A;  5EIB D;  3IMP A;  3WPX A;  5HY4 A;  3JAK B;  2ALE A;  5LYJ B;  4O4H A;  4ZI7 A;  3CC2 F;  5G4U C;  5LXT B;  3IEW A;  2KGW A;  5ITZ A;  3E1Y A;  4U3J A;  1ZWZ A;  4X1Y B;  5IYZ A;  2B33 A;  1IPA A;  1KD1 H;  3MCQ A;  3FD6 A;  1W59 A;  4TZZ A;  3CCM F;  4EI8 A;  3JAL B;  4BT6 A;  5ITZ B;  1W5A A;  3S02 A;  4U3J B;  1M90 H;  3S0W A;  3P4E A;  1Q8R A;  3E22 A;  1W42 A;  2H6L A;  3VTI C;  4ZHW A;  3WPW A;  1W41 A;  4B62 A;  4O2B A;  5IJ9 B;  1FFX A;  1CLI A;  3WGK A;  5MN4 A;  5LA6 B;  3JAK A;  2HP0 A;  4TV8 A;  3HKD A;  3LWP C;  4O4J A;  3JAW B;  3MQW A;  5JQG B;  1VQN F;  4YJ2 B;  3J7A R;  5HXZ A;  2L26 A;  3WJP A;  4I4T A;  4IIJ B;  3U0O A;  1VQ8 F;  4BVR A;  1VQV A;  3HTN A;  3JVH A;  3VYU C;  1K9M H;  5GIP C;  1RLU A;  4WBN A;  1JD1 A;  4BVT A;  3ZP7 A;  5LXT A;  4X1I B;  2KG4 A;  3D00 A;  1TUB A;  1OFU A;  3N4Z A;  3JAT A;  3F0G A;  3RYC A;  5GIN C;  3LWV C;  1T0A A;  5B8F A;  3WGL A;  2HRY A;  4G4V A;  1XHO A;  3LWR C;  3N2G A;  4ZHQ B;  3I3F A;  2IG8 A;  1XRG A;  3P0Z A;  4G88 A;  1E7K A;  1VQ5 F;  3V7E A;  1IV4 A;  2WAL A;  3K14 A;  5BMV A;  3F6M A;  3MCA B;  1KNJ A;  3PAF A;  3CCQ F;  3VYS C;  3LDT A;  3GHZ A;  1X52 A;  4X1Y A;  2ZOV A;  4G4W A;  1RA4 A; 
#chains in the Genus database with same CATH homology
 2QI2 A;  1Q81 H;  3V7Q A;  3CCL F;  1VQP F;  1X7O A;  4XCQ A;  4EI7 A;  1M1K H;  3I55 F;  3G71 F;  1VQ7 F;  1X7P A;  1N8R H;  3J81 M;  2JNB A;  5FLX M;  3OBW A;  5GIO C;  3G4S F;  5GAN K;  3NK6 A;  5HY0 A;  1VQ6 F;  3NVI B;  3CPQ A;  3E20 B;  2KTV A;  3OBY A;  3VMF B;  3J80 M;  1YHQ F;  5FJ4 C;  5HY4 A;  3RA5 A;  3CCJ F;  3RA6 A;  2ALE A;  2OTL F;  3CC2 F;  1VQ9 F;  2BO1 A;  3ON1 A;  4X3L A;  5G4U C;  1Q7Y H;  4BVS A;  3AGK A;  3CC4 F;  3E1Y A;  1DT9 A;  1ZWZ A;  2VGM A;  3JAM M;  1IPA A;  1KD1 H;  3CMA F;  3CPW F;  2OHW A;  2OZB A;  4TZZ A;  4BVQ A;  3CCM F;  2CZW A;  2I6D A;  4EI8 A;  3CCU F;  2FGY A;  3G6E F;  1W3E X;  2OTJ F;  1GO1 A;  1VQ4 F;  3IR9 A;  3CCS F;  2HVY D;  1M90 H;  3HAX D;  3CCE F;  3OW2 F;  1W42 A;  3VI6 A;  5G4V C;  1VQO F;  1W41 A;  3NK7 A;  3NVK E;  3PLA C;  3O85 A;  5HXU A;  4NUT A;  1VQM F;  2KTU A;  4X3M A;  3LWP C;  3CC7 F;  2QEX F;  2LBW A;  1KC8 H;  4BY9 D;  2F9Z C;  1VQN F;  1JJ2 F;  1QVF F;  3J7A R;  5HXZ A;  3WXM B;  1GO0 A;  5IT9 M;  1Q86 H;  3CXC F;  3CG6 A;  1W2B F;  3GYQ A;  1VQ8 F;  4BVR A;  4EI9 A;  1H7M A;  1YJ9 F;  1W40 A;  1K73 H;  3SIU A;  3LFO A;  1SDS A;  1K9M H;  5GIP C;  3CCR F;  5HY2 A;  4BVT A;  1QVG F;  1NJI H;  1XBI A;  1S72 F;  3N4Y A;  3V3T A;  3JCM M;  1PXW A;  1VQL F;  2KG4 A;  3D00 A;  2LBX A;  3I56 F;  1CK2 A;  1GZ0 A;  3N4Z A;  3FFM A;  3LWQ C;  2GLZ A;  3LWV C;  1YIJ F;  5GIN C;  1NMU B;  3LWR C;  4C4W C;  1YJW F;  1E7K A;  1YIT F;  1YJN F;  1VQ5 F;  1RLG A;  1Q82 H;  5A2Q M;  3V7E A;  4BW0 B;  2WAL A;  5DCV A;  5HWE A;  1K8A H;  3CCV F;  4LCK A;  3MCA B;  3CD6 F;  1VQK F;  2QA4 F;  3PAF A;  3CME F;  4NQ3 A;  2VGN A;  3CCQ F;  3HJW C;  3LWO C;  1KQS F;  5GAP K;  2FC3 A;  2AIF A;  1T0K B;  3NMU C;  1CN7 A;  3SIV A;  1X52 A;  5EWR A;  5HY1 A;  1YI2 F;  1RA4 A;  5EO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...