4B62A

The structure of the cell wall anchor of the t6ss from pseudomonas aeruginosa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
ERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TSSL1
publication title Crystal Structure of the Periplasmic Peptidoglycan Binding Anchor of a T6Ss from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Membrane protein
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b62A00
4ZHVA 3WPXA 2N48A 4G4YA 4G4XA 3S02A 2LBTA 2ZOVA 2ZVYA 2MQEA 1OAPA 3S0WA 4ERHA 3TD5A 4R40B 3S06A 4G4WA 4ZHYB 3S03A 3S0HA 4RHAA 4ZHWA 3OONA 2ZVZA 3TD3A 2AIZP 3WPWA 4G88A 4G4ZA 2K1SA 2L26A 3CYQA 4B62A 3S0YA 1R1MA 3CYPB 3TD4A 2LCAA 3LDTA 4G4VA 5EB0A 3IMPA 3KHNA 2W8BC 2ZF8A 4PWTA 2HQSC 5EB1B 4B5CA 2KGWA 5EAZA
chains in the Genus database with same CATH superfamily
3LWPC 1W40A 2HVYD 5HXZA 4I50B 5LYJB 2Z1FA 2BTOA 4ZOLB 2IAFA 2B33A 2HP0A 3WJPA 4C8GA 4ZHWA 3J80M 1KD1H 4HNAA 5ITZB 3I3FA 3WPWA 1KC8H 3JASA 3CYPB 3E20B 1YITF 5FJ4C 5HP7A 1DBFA 4G4VA 2FC3A 3I55F 5IYZB 1DT9A 2UYNB 5HWEA 1JJ2F 3SIVA 4IHJB 4X1KB 5CA0A 4G4YA 4BVTA 3S02A 2HRUA 1OAPA 2V9YA 1JN1A 2UYKA 3WGNA 5HXUA 3LYBA 3VIUA 4O2AB 3HKDA 3OBYA 5LXTA 4BT3A 2RB9A 4BY9D 1SA0A 3FD5A 3MBMA 3OW2F 2LBWA 3D01A 3RYHA 2GLZA 3F6MA 3VOAA 3I56F 5EB1B 4X3MA 1W5AA 3JAKA 1J7HA 2LBXA 2UYPA 2PHNA 4YJ3B 1JFFA 4YJ2A 3VI6A 2H8CA 4F6RA 3ELCA 2OHWA 5CA1A 5LP6B 4O4JA 3OONA 3VOBA 2QA4F 2VXYA 5IJ9A 3LWOC 1FFXA 3TD4A 4C81A 3MCAB 2KG4A 3N2GA 4I55B 3FFMA 3AGKA 3RYIB 3U0OA 3GTZA 5EIBD 4IIJA 1VQ4F 4I4TA 3WJQA 3CC7F 5AVMA 3UT5B 2ZOVA 2ZVYA 5MN4A 3CG6A 3KJKA 1N8RH 3N4YA 4BT7A 4BW0B 3NK6A 4M8IA 2Z1TA 3CPWF 4RHAA 3LMEA 3TD3A 1QD9A 2HX0A 3VTIC 1VQ7F 1E7KA 5JQGB 2W8BC 2HQSC 5J2TA 2DYYA 3CCEF 4C82A 3LFOA 5GINC 3RYFB 2OTMA 2FGYA 2BTQB 2R6R1 2LBTA 1VQKF 2BTUA 2I6DA 1W5EA 4U3JB 1K9MH 2RHHA 3N4ZA 3CXCF 4O4LA 5LA6A 5KX5B 5G4VC 3ZP7A 4BT2A 4TUYA 4TV9B 2CWJA 3ZP4A 5FNVB 3K14A 4X1IA 3LWVC 4O4HB 5EYPB 5IJ0B 5HY0A 3LDTA 5EB0A 3IMPA 2R751 2ZF8A 3HKEB 3K2XA 4BVSA 4E6EA 3P10A 1YJ9F 2BO1A 5KMGB 5GONB 1T0AA 3WXMB 5C8YB 5GIOC 3V3TA 2G9IA 1PXWA 3ESJA 1VH8A 4R40B 1S72F 4BT6A 3GHZA 3JVHA 2PMPA 4LNUB 4ZHQA 2CHSA 1U3LA 3E22B 3ON1A 3ZOPA 4EI8A 3WJRA 4EI9A 5A2QM 3K0TA 3CCQF 3JCMM 5GAPK 4ZI7B 3CCRF 3QTYA 3F0DA 2QEXF 2Q1XA 1H47A 4I50A 5LYJA 1VQVA 2P6YA 4EI7A 5EO3A 4ZOLA 3CMAF 4WBNB 3WPXA 1H48A 2VGMA 1Z5WA 1FSZA 3JATB 5JCOC 1ONIA 1YQNA 5ITZA 1XBIA 1XV2A 4ERHA 3C9UA 3VYTC 2Z1UA 5CA0B 5G4UC 3I7TA 3N2KB 2HRYA 2H8EA 5IYZA 2YYEA 3F0EA 3G4SF 2UYNA 1NJIH 3CB2A 1U43A 4X1KA 2VAWA 1CK2A 3G6EF 1NMUB 3HKDB 5LXTB 2CVLA 1GZ0A 4X1YB 4FFBB 1IV2A 3CCSF 2ALEA 1RQ7A 1U3PA 2N48A 4O4IB 3KJJA 5CB4B 3C9SA 4O2AA 3F0GA 3OBWA 4O2BB 1YI2F 1NQ3A 2KTUA 3D54A 1ODEA 3NK7A 2OZBA 3JAKB 3CPQA 3NMUC 3JALB 1QVGF 5EIBC 3CYQA 2CSLA 3P0ZA 1R1MA 5JVDB 1RLGA 3V7EA 3J81M 2Z1EA 2LCAA 3RA5A 3IEWA 3L7QA 4YJ3A 4C4WC 3BYQA 4PWTA 2QTPA 2QI2A 3CMEF 2OTLF 3J7AR 5HP8A 5LP6A 4ZHVA 3M4SA 5J2UB 4X20B 5LOVB 5HY2A 5EZYB 4EB6B 3P4EA 3JAWB 4NUTA 3R0PA 2RHOA 2IQQA 4C8IA 4BVQA 3S03A 2UYJA 3RYIA 1ZWZA 1IPAA 4G88A 1FNKA 1UI9A 2JNBA 2DT4A 4U39A 1UFYA 3HKCB 3VCZA 3QUWA 3CCUF 2CW4A 3UT5A 3JARB 1YGYA 3NVKE 1CN7A 3PAFA 5GANK 5EWRA 1W57A 5FLXM 1TUBB 5J2TB 4BT5A 4XCQA 3HKBB 5LP6C 2WALA 5JQGA 3RYCB 4B46A 1JY8A 5BMVA 1YHQF 3SIUA 1TVKB 2L26A 3RYFA 3IEQA 4TV8A 3KE1A 4DRXA 2I6RA 4TUYB 5JCOA 1SDSA 1W42A 4U3JA 1YJWF 1W2BF 3GYQA 1U40A 1XHOA 4B45A 3IR9A 3FBAA 4TV9A 3NVIB 5FNVA 1H7MA 2HP3A 1KNKA 2MQEA 5JH7B 4O4HA 1QU9A 1YJNF 1KQSF 1RA4A 1RQ2A 1X7OA 5EYPA 4ZHYB 5IJ0A 4TZZA 2RHJA 1VQ5F 3PLAC 4G4ZA 4C8EA 4ZK7A 3S0YA 1COMA 1KNJA 2HP0B 5GONA 5C8YA 5KMGA 1FNJA 4HNAB 3RA6A 4NWOB 3JASB 4B5CA 1W3EX 2AMTA 3RE3A 1PF5A 3M1XA 4LNUA 3FPIA 3E22A 2ZODA 1X7PA 4ZI7A 1VQPF 2ZVZA 1VQNF 4WBNA 3KIZA 4IHJA 3JATA 2RHLA 5GIPC 4LCKA 4KWEA 3O85A 2Q1YA 1X52A 5MN5A 2YXZA 3Q8HA 5IT9M 1SA0B 2KGWA 3CCLF 3CD6F 3N2KA 5B8FA 2HS0A 2IG8A 3LWQC 3RYHB 1SZQA 4NQ3A 2HS4A 1VQ8F 3CC2F 3HAXD 3JAMM 3HTNA 3MCQA 3QHDA 3MDOA 3S0HA 1VK3A 5HY1A 2ZAUA 4X1YA 1JFFB 4YJ2B 2F9ZC 4FFBA 2UZHA 4F6RB 4B62A 2K1SA 1VQMF 1VQ6F 1Q86H 2CHTA 1QVFF 5CA1B 4O4IA 4O4JB 2EWCA 5CB4A 4BT4A 3KHNA 1X25A 4BVRA 2VAMA 4O2BA 1XRGA 5DCVA 1JD1A 2VGNA 1VQLF 5IJ9B 1FFXB 2GZLA 3M84A 3N2GB 3V4DA 3FD6A 4G4XA 2VAPA 3JALA 3F0FA 3WGJA 4X3LA 2HS3A 3K12A 5JVDA 3TD5A 3WGKA 3WGMA 1GO1A 4IIJB 4I4TB 2KTVA 4I55A 3C8LA 2AIZP 3C9TA 4RQOA 2AIFA 2H6LA 1Q8RA 3ZO8A 3LWRC 3CCMF 5J2UA 1K8AH 2Z01A 4X20A 5HY4A 5LOVA 1M1KH 3CC4F 3IKEA 5EZYA 3B6NA 3IKFA 3CCVF 4EB6A 1YIJF 3DDNA 3JAWA 1T0KB 1OFUA 3MQWA 1GO0A 3D00A 1RLUA 3E1YA 1IV3A 3C9RA 1Q82H 1Z5VA 3HKCA 1W41A 3V7QA 2OTJF 1W5BA 2CZWA 2NMUA 1IV1A 3JARA 3G71F 3VMFB 3CCJF 3EORA 3ERNA 4O4LB 5LA6B 1K73H 1TUBA 5BMVB 4X1IB 1VQ9F 3VYUC 3DC2A 3HKBA 3VO8A 4TV8B 2GVIA 3T80A 4DRXB 3RYCA 5KX5A 3HJWC 1W581 1TVKA 3S0WA 5MN6A 1CLIA 3VYSC 3S06A 4G4WA 1IV4A 1Q7YH 4DXDA 1QAHA 3WGLA 1W5FA 3HKEA 1W59A 1VHAA 1M90H 3HWUA 1VQOF 1GX1A 4ZHQB 1Q81H 5JH7A 1W55A 5EAZA
chains in the Genus database with same CATH topology
4ZHVA 3WPXA 2N48A 4G4YA 4G4XA 3S02A 2LBTA 2ZOVA 2ZVYA 2MQEA 1OAPA 3S0WA 4ERHA 3TD5A 4R40B 3S06A 4G4WA 4ZHYB 3S03A 3S0HA 4RHAA 4ZHWA 3OONA 2ZVZA 3TD3A 2AIZP 3WPWA 4G88A 4G4ZA 2K1SA 2L26A 3CYQA 4B62A 3S0YA 1R1MA 3CYPB 3TD4A 2LCAA 3LDTA 4G4VA 5EB0A 3IMPA 3KHNA 2W8BC 2ZF8A 4PWTA 2HQSC 5EB1B 4B5CA 2KGWA 5EAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHV A;  3WPX A;  2N48 A;  4G4Y A;  4G4X A;  3S02 A;  2LBT A;  2ZOV A;  2ZVY A;  2MQE A;  1OAP A;  3S0W A;  4ERH A;  3TD5 A;  4R40 B;  3S06 A;  4G4W A;  4ZHY B;  3S03 A;  3S0H A;  4RHA A;  4ZHW A;  3OON A;  2ZVZ A;  3TD3 A;  2AIZ P;  3WPW A;  4G88 A;  4G4Z A;  2K1S A;  2L26 A;  3CYQ A;  4B62 A;  3S0Y A;  1R1M A;  3CYP B;  3TD4 A;  2LCA A;  3LDT A;  4G4V A;  5EB0 A;  3IMP A;  3KHN A;  2W8B C;  2ZF8 A;  4PWT A;  2HQS C;  5EB1 B;  4B5C A;  2KGW A;  5EAZ A; 
#chains in the Genus database with same CATH topology
 3LWP C;  1W40 A;  2HVY D;  5HXZ A;  4I50 B;  5LYJ B;  2Z1F A;  2BTO A;  4ZOL B;  2IAF A;  2B33 A;  2HP0 A;  3WJP A;  4C8G A;  4ZHW A;  3J80 M;  1KD1 H;  4HNA A;  5ITZ B;  3I3F A;  3WPW A;  1KC8 H;  3JAS A;  3CYP B;  3E20 B;  1YIT F;  5FJ4 C;  5HP7 A;  1DBF A;  4G4V A;  2FC3 A;  3I55 F;  5IYZ B;  1DT9 A;  2UYN B;  5HWE A;  1JJ2 F;  3SIV A;  4IHJ B;  4X1K B;  5CA0 A;  4G4Y A;  4BVT A;  3S02 A;  2HRU A;  1OAP A;  2V9Y A;  1JN1 A;  2UYK A;  3WGN A;  5HXU A;  3LYB A;  3VIU A;  4O2A B;  3HKD A;  3OBY A;  5LXT A;  4BT3 A;  2RB9 A;  4BY9 D;  1SA0 A;  3FD5 A;  3MBM A;  3OW2 F;  2LBW A;  3D01 A;  3RYH A;  2GLZ A;  3F6M A;  3VOA A;  3I56 F;  5EB1 B;  4X3M A;  1W5A A;  3JAK A;  1J7H A;  2LBX A;  2UYP A;  2PHN A;  4YJ3 B;  1JFF A;  4YJ2 A;  3VI6 A;  2H8C A;  4F6R A;  3ELC A;  2OHW A;  5CA1 A;  5LP6 B;  4O4J A;  3OON A;  3VOB A;  2QA4 F;  2VXY A;  5IJ9 A;  3LWO C;  1FFX A;  3TD4 A;  4C81 A;  3MCA B;  2KG4 A;  3N2G A;  4I55 B;  3FFM A;  3AGK A;  3RYI B;  3U0O A;  3GTZ A;  5EIB D;  4IIJ A;  1VQ4 F;  4I4T A;  3WJQ A;  3CC7 F;  5AVM A;  3UT5 B;  2ZOV A;  2ZVY A;  5MN4 A;  3CG6 A;  3KJK A;  1N8R H;  3N4Y A;  4BT7 A;  4BW0 B;  3NK6 A;  4M8I A;  2Z1T A;  3CPW F;  4RHA A;  3LME A;  3TD3 A;  1QD9 A;  2HX0 A;  3VTI C;  1VQ7 F;  1E7K A;  5JQG B;  2W8B C;  2HQS C;  5J2T A;  2DYY A;  3CCE F;  4C82 A;  3LFO A;  5GIN C;  3RYF B;  2OTM A;  2FGY A;  2BTQ B;  2R6R 1;  2LBT A;  1VQK F;  2BTU A;  2I6D A;  1W5E A;  4U3J B;  1K9M H;  2RHH A;  3N4Z A;  3CXC F;  4O4L A;  5LA6 A;  5KX5 B;  5G4V C;  3ZP7 A;  4BT2 A;  4TUY A;  4TV9 B;  2CWJ A;  3ZP4 A;  5FNV B;  3K14 A;  4X1I A;  3LWV C;  4O4H B;  5EYP B;  5IJ0 B;  5HY0 A;  3LDT A;  5EB0 A;  3IMP A;  2R75 1;  2ZF8 A;  3HKE B;  3K2X A;  4BVS A;  4E6E A;  3P10 A;  1YJ9 F;  2BO1 A;  5KMG B;  5GON B;  1T0A A;  3WXM B;  5C8Y B;  5GIO C;  3V3T A;  2G9I A;  1PXW A;  3ESJ A;  1VH8 A;  4R40 B;  1S72 F;  4BT6 A;  3GHZ A;  3JVH A;  2PMP A;  4LNU B;  4ZHQ A;  2CHS A;  1U3L A;  3E22 B;  3ON1 A;  3ZOP A;  4EI8 A;  3WJR A;  4EI9 A;  5A2Q M;  3K0T A;  3CCQ F;  3JCM M;  5GAP K;  4ZI7 B;  3CCR F;  3QTY A;  3F0D A;  2QEX F;  2Q1X A;  1H47 A;  4I50 A;  5LYJ A;  1VQV A;  2P6Y A;  4EI7 A;  5EO3 A;  4ZOL A;  3CMA F;  4WBN B;  3WPX A;  1H48 A;  2VGM A;  1Z5W A;  1FSZ A;  3JAT B;  5JCO C;  1ONI A;  1YQN A;  5ITZ A;  1XBI A;  1XV2 A;  4ERH A;  3C9U A;  3VYT C;  2Z1U A;  5CA0 B;  5G4U C;  3I7T A;  3N2K B;  2HRY A;  2H8E A;  5IYZ A;  2YYE A;  3F0E A;  3G4S F;  2UYN A;  1NJI H;  3CB2 A;  1U43 A;  4X1K A;  2VAW A;  1CK2 A;  3G6E F;  1NMU B;  3HKD B;  5LXT B;  2CVL A;  1GZ0 A;  4X1Y B;  4FFB B;  1IV2 A;  3CCS F;  2ALE A;  1RQ7 A;  1U3P A;  2N48 A;  4O4I B;  3KJJ A;  5CB4 B;  3C9S A;  4O2A A;  3F0G A;  3OBW A;  4O2B B;  1YI2 F;  1NQ3 A;  2KTU A;  3D54 A;  1ODE A;  3NK7 A;  2OZB A;  3JAK B;  3CPQ A;  3NMU C;  3JAL B;  1QVG F;  5EIB C;  3CYQ A;  2CSL A;  3P0Z A;  1R1M A;  5JVD B;  1RLG A;  3V7E A;  3J81 M;  2Z1E A;  2LCA A;  3RA5 A;  3IEW A;  3L7Q A;  4YJ3 A;  4C4W C;  3BYQ A;  4PWT A;  2QTP A;  2QI2 A;  3CME F;  2OTL F;  3J7A R;  5HP8 A;  5LP6 A;  4ZHV A;  3M4S A;  5J2U B;  4X20 B;  5LOV B;  5HY2 A;  5EZY B;  4EB6 B;  3P4E A;  3JAW B;  4NUT A;  3R0P A;  2RHO A;  2IQQ A;  4C8I A;  4BVQ A;  3S03 A;  2UYJ A;  3RYI A;  1ZWZ A;  1IPA A;  4G88 A;  1FNK A;  1UI9 A;  2JNB A;  2DT4 A;  4U39 A;  1UFY A;  3HKC B;  3VCZ A;  3QUW A;  3CCU F;  2CW4 A;  3UT5 A;  3JAR B;  1YGY A;  3NVK E;  1CN7 A;  3PAF A;  5GAN K;  5EWR A;  1W57 A;  5FLX M;  1TUB B;  5J2T B;  4BT5 A;  4XCQ A;  3HKB B;  5LP6 C;  2WAL A;  5JQG A;  3RYC B;  4B46 A;  1JY8 A;  5BMV A;  1YHQ F;  3SIU A;  1TVK B;  2L26 A;  3RYF A;  3IEQ A;  4TV8 A;  3KE1 A;  4DRX A;  2I6R A;  4TUY B;  5JCO A;  1SDS A;  1W42 A;  4U3J A;  1YJW F;  1W2B F;  3GYQ A;  1U40 A;  1XHO A;  4B45 A;  3IR9 A;  3FBA A;  4TV9 A;  3NVI B;  5FNV A;  1H7M A;  2HP3 A;  1KNK A;  2MQE A;  5JH7 B;  4O4H A;  1QU9 A;  1YJN F;  1KQS F;  1RA4 A;  1RQ2 A;  1X7O A;  5EYP A;  4ZHY B;  5IJ0 A;  4TZZ A;  2RHJ A;  1VQ5 F;  3PLA C;  4G4Z A;  4C8E A;  4ZK7 A;  3S0Y A;  1COM A;  1KNJ A;  2HP0 B;  5GON A;  5C8Y A;  5KMG A;  1FNJ A;  4HNA B;  3RA6 A;  4NWO B;  3JAS B;  4B5C A;  1W3E X;  2AMT A;  3RE3 A;  1PF5 A;  3M1X A;  4LNU A;  3FPI A;  3E22 A;  2ZOD A;  1X7P A;  4ZI7 A;  1VQP F;  2ZVZ A;  1VQN F;  4WBN A;  3KIZ A;  4IHJ A;  3JAT A;  2RHL A;  5GIP C;  4LCK A;  4KWE A;  3O85 A;  2Q1Y A;  1X52 A;  5MN5 A;  2YXZ A;  3Q8H A;  5IT9 M;  1SA0 B;  2KGW A;  3CCL F;  3CD6 F;  3N2K A;  5B8F A;  2HS0 A;  2IG8 A;  3LWQ C;  3RYH B;  1SZQ A;  4NQ3 A;  2HS4 A;  1VQ8 F;  3CC2 F;  3HAX D;  3JAM M;  3HTN A;  3MCQ A;  3QHD A;  3MDO A;  3S0H A;  1VK3 A;  5HY1 A;  2ZAU A;  4X1Y A;  1JFF B;  4YJ2 B;  2F9Z C;  4FFB A;  2UZH A;  4F6R B;  4B62 A;  2K1S A;  1VQM F;  1VQ6 F;  1Q86 H;  2CHT A;  1QVF F;  5CA1 B;  4O4I A;  4O4J B;  2EWC A;  5CB4 A;  4BT4 A;  3KHN A;  1X25 A;  4BVR A;  2VAM A;  4O2B A;  1XRG A;  5DCV A;  1JD1 A;  2VGN A;  1VQL F;  5IJ9 B;  1FFX B;  2GZL A;  3M84 A;  3N2G B;  3V4D A;  3FD6 A;  4G4X A;  2VAP A;  3JAL A;  3F0F A;  3WGJ A;  4X3L A;  2HS3 A;  3K12 A;  5JVD A;  3TD5 A;  3WGK A;  3WGM A;  1GO1 A;  4IIJ B;  4I4T B;  2KTV A;  4I55 A;  3C8L A;  2AIZ P;  3C9T A;  4RQO A;  2AIF A;  2H6L A;  1Q8R A;  3ZO8 A;  3LWR C;  3CCM F;  5J2U A;  1K8A H;  2Z01 A;  4X20 A;  5HY4 A;  5LOV A;  1M1K H;  3CC4 F;  3IKE A;  5EZY A;  3B6N A;  3IKF A;  3CCV F;  4EB6 A;  1YIJ F;  3DDN A;  3JAW A;  1T0K B;  1OFU A;  3MQW A;  1GO0 A;  3D00 A;  1RLU A;  3E1Y A;  1IV3 A;  3C9R A;  1Q82 H;  1Z5V A;  3HKC A;  1W41 A;  3V7Q A;  2OTJ F;  1W5B A;  2CZW A;  2NMU A;  1IV1 A;  3JAR A;  3G71 F;  3VMF B;  3CCJ F;  3EOR A;  3ERN A;  4O4L B;  5LA6 B;  1K73 H;  1TUB A;  5BMV B;  4X1I B;  1VQ9 F;  3VYU C;  3DC2 A;  3HKB A;  3VO8 A;  4TV8 B;  2GVI A;  3T80 A;  4DRX B;  3RYC A;  5KX5 A;  3HJW C;  1W58 1;  1TVK A;  3S0W A;  5MN6 A;  1CLI A;  3VYS C;  3S06 A;  4G4W A;  1IV4 A;  1Q7Y H;  4DXD A;  1QAH A;  3WGL A;  1W5F A;  3HKE A;  1W59 A;  1VHA A;  1M90 H;  3HWU A;  1VQO F;  1GX1 A;  4ZHQ B;  1Q81 H;  5JH7 A;  1W55 A;  5EAZ A; 
#chains in the Genus database with same CATH homology
 4ZHV A;  3WPX A;  2N48 A;  4G4Y A;  4G4X A;  3S02 A;  2LBT A;  2ZOV A;  2ZVY A;  2MQE A;  1OAP A;  3S0W A;  4ERH A;  3TD5 A;  4R40 B;  3S06 A;  4G4W A;  4ZHY B;  3S03 A;  3S0H A;  4RHA A;  4ZHW A;  3OON A;  2ZVZ A;  3TD3 A;  2AIZ P;  3WPW A;  4G88 A;  4G4Z A;  2K1S A;  2L26 A;  3CYQ A;  4B62 A;  3S0Y A;  1R1M A;  3CYP B;  3TD4 A;  2LCA A;  3LDT A;  4G4V A;  5EB0 A;  3IMP A;  3KHN A;  2W8B C;  2ZF8 A;  4PWT A;  2HQS C;  5EB1 B;  4B5C A;  2KGW A;  5EAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...