4B62A

The structure of the cell wall anchor of the t6ss from pseudomonas aeruginosa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
ERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords TSSL1
publication title Crystal Structure of the Periplasmic Peptidoglycan Binding Anchor of a T6Ss from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b62A00
2ZOVA 3CYPB 5EAZA 2W8BC 3OONA 4G88A 4G4ZA 3CYQA 2L26A 4G4VA 4B5CA 2ZVYA 3TD5A 2LBTA 4ZHWA 3S0WA 2ZVZA 4RHAA 3S03A 4R40B 1OAPA 2LCAA 5EB0A 4G4YA 4G4WA 4G4XA 3TD3A 2K1SA 3S06A 3S0HA 3IMPA 3KHNA 3WPXA 2HQSC 3S0YA 4ZHVA 4B62A 4ERHA 4ZHYB 2ZF8A 1R1MA 5EB1B 4PWTA 3LDTA 2N48A 2MQEA 3S02A 3TD4A 2AIZP 2KGWA 3WPWA
chains in the Genus database with same CATH superfamily
4BW0B 4TV8A 4G4VA 3D00A 3QTYA 4RQOA 4U3JA 5FNVB 3S03A 1U3PA 3CCQF 3HKBA 2UYNA 4X1YA 3SIUA 3WGLA 4TUYB 5JH7A 3KE1A 3JATA 1W40A 5EZYB 3V3TA 2BTQB 3HKCA 3F6MA 4PWTA 4O2AB 3JAWB 4O4IA 3CB2A 3J80M 1VQMF 3BYQA 3VI6A 1KQSF 1VQVA 2Q1YA 2AIFA 1S72F 1DT9A 4YJ3A 2RHOA 5LYJA 3LYBA 4EB6A 1M90H 1RA4A 3ZO8A 1JJ2F 1RLGA 4ZOLB 2ALEA 1GZ0A 4R40B 1UI9A 3P10A 3NK7A 3E22A 3F0EA 4ZI7B 2OTMA 3OW2F 4I4TA 3WJQA 4B46A 1GO0A 3F0FA 3V7QA 3VO8A 3RYCA 2HP0A 3WGMA 1XHOA 3ZP4A 4BVQA 2ZOVA 4TZZA 3OBYA 3F0GA 5LP6C 1VHAA 4IIJA 3QUWA 2PHNA 3HKEB 1CN7A 4BT6A 3C9RA 5LXTA 3S0HA 1QVFF 3C8LA 1H48A 2R6R1 5KMGA 4C82A 3CC7F 3MDOA 1JY8A 5A2QM 2VXYA 2CHTA 2CWJA 5GIOC 2KGWA 1U3LA 4ZK7A 3CYPB 3IR9A 3OONA 4BT7A 3MBMA 2CZWA 3JVHA 3DDNA 3CCSF 1PF5A 3C9SA 1VQKF 3SIVA 1Q82H 2OHWA 4M8IA 3RYIB 4TUYA 3JASB 5IJ0B 4O4HB 3EORA 5EZYA 1VQNF 2QI2A 3IKEA 2I6RA 3T80A 2CW4A 3V7EA 4O2AA 3JAWA 1VQ5F 4BY9D 1YJNF 2I6DA 1VK3A 1OFUA 3WPWA 1SA0B 3CCLF 2ZAUA 4O2BB 2H8CA 5HY0A 3VYTC 3FD5A 4BT5A 3K12A 3C9UA 2ZODA 5EWRA 4ZOLA 2FGYA 1VQOF 2ZVZA 1K9MH 2CVLA 1ODEA 3KIZA 1KD1H 5DCVA 2BTUA 5HXZA 4C8GA 1CK2A 1JFFB 1QU9A 5HY4A 1W42A 5KX5B 3CPWF 4ZI7A 3PLAC 2IQQA 2YXZA 1N8RH 5EB1B 2P6YA 1IV2A 4O4LB 4X3MA 2Q1XA 1W2BF 1KNKA 1W5BA 2RB9A 3M1XA 4G88A 4NQ3A 3PAFA 3CYQA 3F0DA 1IV3A 2HP3A 4DRXB 3C9TA 5JCOA 3HKEA 1RLUA 2OTLF 4YJ2B 1CLIA 1H47A 1OAPA 3K2XA 4G4XA 1FFXB 4C8IA 2HVYD 4EI7A 1Z5VA 2HQSC 4B62A 4ERHA 2G9IA 2WALA 3WXMB 3ZP7A 2HS4A 1VQPF 1VQ8F 2VGNA 3LDTA 2IG8A 1W57A 3P4EA 4FFBB 4X1KB 3D54A 5ITZA 5FJ4C 3CC4F 5LOVB 2OTJF 5J2UB 3RYIA 5EB0A 2KTUA 3JASA 5IJ0A 4O4HA 3J7AR 3G71F 3FPIA 3J81M 3S0YA 1W5EA 1X7PA 3GYQA 5JCOC 4BT4A 3N2GB 3Q8HA 2MQEA 3CCJF 5IYZB 1VQ9F 3UT5B 2AMTA 3VTIC 1SA0A 1W5AA 4U39A 4I55B 4O2BA 1FSZA 3NVIB 4F6RB 1W41A 5CB4B 4G4ZA 2UYPA 4O4JB 4ZHWA 3R0PA 4EI8A 4G4YA 1JFFA 5MN5A 3WGKA 2HRYA 5KX5A 4C4WC 5EYPB 3KJJA 3K14A 5CA0B 3D01A 1YJWF 3JCMM 2QTPA 4O4LA 3WGJA 1X25A 1ONIA 5LA6B 5CA1B 2VGMA 1VQ4F 2KG4A 1K73H 2GLZA 4DRXA 4E6EA 4B5CA 3RYHB 2GVIA 4YJ2A 2Z01A 5FNVA 5IJ9B 3M4SA 3MCQA 1VQ6F 2K1SA 4BVRA 3B6NA 3CG6A 2QEXF 3NVKE 2V9YA 3JATB 5BMVB 5LP6B 2RHHA 3I56F 2LBXA 4BT2A 5G4UC 1UFYA 1H7MA 1W581 2HS3A 2UYKA 3JARB 3LWVC 1J7HA 3WGNA 5GONB 4FFBA 2W8BC 4EI9A 1QD9A 1XBIA 4X1KA 1XV2A 1U40A 4IHJB 2L26A 5C8YB 5LOVA 4TV9B 5J2UA 4LNUB 4ZHQB 5EIBD 1W3EX 3RYFB 3I7TA 3CCRF 3CXCF 3IEQA 1SZQA 2PMPA 1COMA 3N2GA 3RE3A 1W5FA 1NQ3A 5HY2A 2OZBA 5IYZA 3CC2F 2Z1FA 3S02A 3TD4A 2AIZP 3UT5A 2EWCA 2JNBA 1IV1A 3K0TA 4I55A 1T0AA 1K8AH 3CCVF 1DBFA 4F6RA 5CB4A 5J2TB 1TUBB 3LWQC 4XCQA 4O4JA 2F9ZC 4B45A 1YHQF 3JALB 2B33A 3VYSC 3WJPA 2LCAA 2NMUA 5AVMA 3I55F 1X7OA 5JVDB 1PXWA 1IPAA 3GTZA 3WPXA 5EYPA 4LCKA 1JN1A 5CA0A 1YITF 5IT9M 1QAHA 2ZF8A 3WJRA 4X20B 2LBWA 5GANK 1XRGA 1GX1A 2H8EA 3CCMF 5LA6A 3HKDB 1ZWZA 4WBNB 5CA1A 2QA4F 4BVTA 4X3LA 3FBAA 3FFMA 2VAMA 3RA5A 1TVKB 3DC2A 2DT4A 2HX0A 2R751 1YGYA 3HTNA 3OBWA 2HS0A 3U0OA 3RYHA 3TD5A 3JAKB 5IJ9A 5JQGB 5GAPK 3CMAF 3NMUC 1VQLF 4NUTA 3CD6F 4KWEA 3KHNA 3N2KB 2CHSA 4ZHVA 4ZHYB 2FC3A 5BMVA 2DYYA 5LP6A 4HNAB 2IAFA 1KC8H 3JARA 3VMFB 1VQ7F 5FLXM 3CCEF 5GONA 4C81A 4IHJA 5C8YA 5HP8A 4TV9A 2ZVYA 4LNUA 4ZHQA 3M84A 2Z1EA 1KNJA 2UZHA 3P0ZA 3S0WA 1YI2F 3RYFA 4X1IB 1W55A 3ESJA 4NWOB 2CSLA 2RHLA 3CCUF 3VCZA 3MCAB 3NK6A 3FD6A 5HP7A 4C8EA 1RQ2A 3ON1A 4I50B 5GIPC 5GINC 4BVSA 3VIUA 2VAPA 1FNJA 3LWOC 5J2TA 3IKFA 3KJKA 1TUBA 1IV4A 1Q81H 3AGKA 4TV8B 3V4DA 3JALA 3IEWA 2LBTA 4U3JB 1GO1A 2BTOA 2Z1UA 3QHDA 5JVDA 3HKBB 2UYJA 5HWEA 3S06A 1FFXA 2UYNB 4X1YB 5HY1A 1E7KA 3RA6A 5JH7B 1Q8RA 2KTVA 1NMUB 4X20A 2VAWA 1T0KB 3HJWC 3N4YA 3HKDA 3HKCB 1X52A 1W59A 4WBNA 1U43A 2Z1TA 4O4IB 3LMEA 3GHZA 3VOAA 1VH8A 1TVKA 3LFOA 4BT3A 1SDSA 2RHJA 4YJ3B 3LWRC 3G4SF 5LYJB 5EIBC 5ITZB 4EB6B 3VYUC 1Q86H 3ZOPA 1RQ7A 3JAKA 5JQGA 1Q7YH 4RHAA 3HWUA 2BO1A 4G4WA 2HRUA 3TD3A 5B8FA 3G6EF 5MN4A 3IMPA 3N2KA 1NJIH 3E22B 1QVGF 3L7QA 4HNAA 3CMEF 1JD1A 5G4VC 3HAXD 5MN6A 1R1MA 4I4TB 2N48A 1FNKA 3RYCB 2HP0B 3CPQA 1YJ9F 5EAZA 4DXDA 4IIJB 3VOBA 3LWPC 3O85A 3I3FA 4X1IA 3E20B 5EO3A 5HXUA 1Z5WA 5LXTB 1YQNA 1YIJF 3ERNA 3ELCA 5KMGB 2H6LA 2YYEA 2GZLA 3JAMM 4I50A 1M1KH 3E1YA 3MQWA 3N4ZA
chains in the Genus database with same CATH topology
2ZOVA 3CYPB 5EAZA 2W8BC 3OONA 4G88A 4G4ZA 3CYQA 2L26A 4G4VA 4B5CA 2ZVYA 3TD5A 2LBTA 4ZHWA 3S0WA 2ZVZA 4RHAA 3S03A 4R40B 1OAPA 2LCAA 5EB0A 4G4YA 4G4WA 4G4XA 3TD3A 2K1SA 3S06A 3S0HA 3IMPA 3KHNA 3WPXA 2HQSC 3S0YA 4ZHVA 4B62A 4ERHA 4ZHYB 2ZF8A 1R1MA 5EB1B 4PWTA 3LDTA 2N48A 2MQEA 3S02A 3TD4A 2AIZP 2KGWA 3WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOV A;  3CYP B;  5EAZ A;  2W8B C;  3OON A;  4G88 A;  4G4Z A;  3CYQ A;  2L26 A;  4G4V A;  4B5C A;  2ZVY A;  3TD5 A;  2LBT A;  4ZHW A;  3S0W A;  2ZVZ A;  4RHA A;  3S03 A;  4R40 B;  1OAP A;  2LCA A;  5EB0 A;  4G4Y A;  4G4W A;  4G4X A;  3TD3 A;  2K1S A;  3S06 A;  3S0H A;  3IMP A;  3KHN A;  3WPX A;  2HQS C;  3S0Y A;  4ZHV A;  4B62 A;  4ERH A;  4ZHY B;  2ZF8 A;  1R1M A;  5EB1 B;  4PWT A;  3LDT A;  2N48 A;  2MQE A;  3S02 A;  3TD4 A;  2AIZ P;  2KGW A;  3WPW A; 
#chains in the Genus database with same CATH topology
 4BW0 B;  4TV8 A;  4G4V A;  3D00 A;  3QTY A;  4RQO A;  4U3J A;  5FNV B;  3S03 A;  1U3P A;  3CCQ F;  3HKB A;  2UYN A;  4X1Y A;  3SIU A;  3WGL A;  4TUY B;  5JH7 A;  3KE1 A;  3JAT A;  1W40 A;  5EZY B;  3V3T A;  2BTQ B;  3HKC A;  3F6M A;  4PWT A;  4O2A B;  3JAW B;  4O4I A;  3CB2 A;  3J80 M;  1VQM F;  3BYQ A;  3VI6 A;  1KQS F;  1VQV A;  2Q1Y A;  2AIF A;  1S72 F;  1DT9 A;  4YJ3 A;  2RHO A;  5LYJ A;  3LYB A;  4EB6 A;  1M90 H;  1RA4 A;  3ZO8 A;  1JJ2 F;  1RLG A;  4ZOL B;  2ALE A;  1GZ0 A;  4R40 B;  1UI9 A;  3P10 A;  3NK7 A;  3E22 A;  3F0E A;  4ZI7 B;  2OTM A;  3OW2 F;  4I4T A;  3WJQ A;  4B46 A;  1GO0 A;  3F0F A;  3V7Q A;  3VO8 A;  3RYC A;  2HP0 A;  3WGM A;  1XHO A;  3ZP4 A;  4BVQ A;  2ZOV A;  4TZZ A;  3OBY A;  3F0G A;  5LP6 C;  1VHA A;  4IIJ A;  3QUW A;  2PHN A;  3HKE B;  1CN7 A;  4BT6 A;  3C9R A;  5LXT A;  3S0H A;  1QVF F;  3C8L A;  1H48 A;  2R6R 1;  5KMG A;  4C82 A;  3CC7 F;  3MDO A;  1JY8 A;  5A2Q M;  2VXY A;  2CHT A;  2CWJ A;  5GIO C;  2KGW A;  1U3L A;  4ZK7 A;  3CYP B;  3IR9 A;  3OON A;  4BT7 A;  3MBM A;  2CZW A;  3JVH A;  3DDN A;  3CCS F;  1PF5 A;  3C9S A;  1VQK F;  3SIV A;  1Q82 H;  2OHW A;  4M8I A;  3RYI B;  4TUY A;  3JAS B;  5IJ0 B;  4O4H B;  3EOR A;  5EZY A;  1VQN F;  2QI2 A;  3IKE A;  2I6R A;  3T80 A;  2CW4 A;  3V7E A;  4O2A A;  3JAW A;  1VQ5 F;  4BY9 D;  1YJN F;  2I6D A;  1VK3 A;  1OFU A;  3WPW A;  1SA0 B;  3CCL F;  2ZAU A;  4O2B B;  2H8C A;  5HY0 A;  3VYT C;  3FD5 A;  4BT5 A;  3K12 A;  3C9U A;  2ZOD A;  5EWR A;  4ZOL A;  2FGY A;  1VQO F;  2ZVZ A;  1K9M H;  2CVL A;  1ODE A;  3KIZ A;  1KD1 H;  5DCV A;  2BTU A;  5HXZ A;  4C8G A;  1CK2 A;  1JFF B;  1QU9 A;  5HY4 A;  1W42 A;  5KX5 B;  3CPW F;  4ZI7 A;  3PLA C;  2IQQ A;  2YXZ A;  1N8R H;  5EB1 B;  2P6Y A;  1IV2 A;  4O4L B;  4X3M A;  2Q1X A;  1W2B F;  1KNK A;  1W5B A;  2RB9 A;  3M1X A;  4G88 A;  4NQ3 A;  3PAF A;  3CYQ A;  3F0D A;  1IV3 A;  2HP3 A;  4DRX B;  3C9T A;  5JCO A;  3HKE A;  1RLU A;  2OTL F;  4YJ2 B;  1CLI A;  1H47 A;  1OAP A;  3K2X A;  4G4X A;  1FFX B;  4C8I A;  2HVY D;  4EI7 A;  1Z5V A;  2HQS C;  4B62 A;  4ERH A;  2G9I A;  2WAL A;  3WXM B;  3ZP7 A;  2HS4 A;  1VQP F;  1VQ8 F;  2VGN A;  3LDT A;  2IG8 A;  1W57 A;  3P4E A;  4FFB B;  4X1K B;  3D54 A;  5ITZ A;  5FJ4 C;  3CC4 F;  5LOV B;  2OTJ F;  5J2U B;  3RYI A;  5EB0 A;  2KTU A;  3JAS A;  5IJ0 A;  4O4H A;  3J7A R;  3G71 F;  3FPI A;  3J81 M;  3S0Y A;  1W5E A;  1X7P A;  3GYQ A;  5JCO C;  4BT4 A;  3N2G B;  3Q8H A;  2MQE A;  3CCJ F;  5IYZ B;  1VQ9 F;  3UT5 B;  2AMT A;  3VTI C;  1SA0 A;  1W5A A;  4U39 A;  4I55 B;  4O2B A;  1FSZ A;  3NVI B;  4F6R B;  1W41 A;  5CB4 B;  4G4Z A;  2UYP A;  4O4J B;  4ZHW A;  3R0P A;  4EI8 A;  4G4Y A;  1JFF A;  5MN5 A;  3WGK A;  2HRY A;  5KX5 A;  4C4W C;  5EYP B;  3KJJ A;  3K14 A;  5CA0 B;  3D01 A;  1YJW F;  3JCM M;  2QTP A;  4O4L A;  3WGJ A;  1X25 A;  1ONI A;  5LA6 B;  5CA1 B;  2VGM A;  1VQ4 F;  2KG4 A;  1K73 H;  2GLZ A;  4DRX A;  4E6E A;  4B5C A;  3RYH B;  2GVI A;  4YJ2 A;  2Z01 A;  5FNV A;  5IJ9 B;  3M4S A;  3MCQ A;  1VQ6 F;  2K1S A;  4BVR A;  3B6N A;  3CG6 A;  2QEX F;  3NVK E;  2V9Y A;  3JAT B;  5BMV B;  5LP6 B;  2RHH A;  3I56 F;  2LBX A;  4BT2 A;  5G4U C;  1UFY A;  1H7M A;  1W58 1;  2HS3 A;  2UYK A;  3JAR B;  3LWV C;  1J7H A;  3WGN A;  5GON B;  4FFB A;  2W8B C;  4EI9 A;  1QD9 A;  1XBI A;  4X1K A;  1XV2 A;  1U40 A;  4IHJ B;  2L26 A;  5C8Y B;  5LOV A;  4TV9 B;  5J2U A;  4LNU B;  4ZHQ B;  5EIB D;  1W3E X;  3RYF B;  3I7T A;  3CCR F;  3CXC F;  3IEQ A;  1SZQ A;  2PMP A;  1COM A;  3N2G A;  3RE3 A;  1W5F A;  1NQ3 A;  5HY2 A;  2OZB A;  5IYZ A;  3CC2 F;  2Z1F A;  3S02 A;  3TD4 A;  2AIZ P;  3UT5 A;  2EWC A;  2JNB A;  1IV1 A;  3K0T A;  4I55 A;  1T0A A;  1K8A H;  3CCV F;  1DBF A;  4F6R A;  5CB4 A;  5J2T B;  1TUB B;  3LWQ C;  4XCQ A;  4O4J A;  2F9Z C;  4B45 A;  1YHQ F;  3JAL B;  2B33 A;  3VYS C;  3WJP A;  2LCA A;  2NMU A;  5AVM A;  3I55 F;  1X7O A;  5JVD B;  1PXW A;  1IPA A;  3GTZ A;  3WPX A;  5EYP A;  4LCK A;  1JN1 A;  5CA0 A;  1YIT F;  5IT9 M;  1QAH A;  2ZF8 A;  3WJR A;  4X20 B;  2LBW A;  5GAN K;  1XRG A;  1GX1 A;  2H8E A;  3CCM F;  5LA6 A;  3HKD B;  1ZWZ A;  4WBN B;  5CA1 A;  2QA4 F;  4BVT A;  4X3L A;  3FBA A;  3FFM A;  2VAM A;  3RA5 A;  1TVK B;  3DC2 A;  2DT4 A;  2HX0 A;  2R75 1;  1YGY A;  3HTN A;  3OBW A;  2HS0 A;  3U0O A;  3RYH A;  3TD5 A;  3JAK B;  5IJ9 A;  5JQG B;  5GAP K;  3CMA F;  3NMU C;  1VQL F;  4NUT A;  3CD6 F;  4KWE A;  3KHN A;  3N2K B;  2CHS A;  4ZHV A;  4ZHY B;  2FC3 A;  5BMV A;  2DYY A;  5LP6 A;  4HNA B;  2IAF A;  1KC8 H;  3JAR A;  3VMF B;  1VQ7 F;  5FLX M;  3CCE F;  5GON A;  4C81 A;  4IHJ A;  5C8Y A;  5HP8 A;  4TV9 A;  2ZVY A;  4LNU A;  4ZHQ A;  3M84 A;  2Z1E A;  1KNJ A;  2UZH A;  3P0Z A;  3S0W A;  1YI2 F;  3RYF A;  4X1I B;  1W55 A;  3ESJ A;  4NWO B;  2CSL A;  2RHL A;  3CCU F;  3VCZ A;  3MCA B;  3NK6 A;  3FD6 A;  5HP7 A;  4C8E A;  1RQ2 A;  3ON1 A;  4I50 B;  5GIP C;  5GIN C;  4BVS A;  3VIU A;  2VAP A;  1FNJ A;  3LWO C;  5J2T A;  3IKF A;  3KJK A;  1TUB A;  1IV4 A;  1Q81 H;  3AGK A;  4TV8 B;  3V4D A;  3JAL A;  3IEW A;  2LBT A;  4U3J B;  1GO1 A;  2BTO A;  2Z1U A;  3QHD A;  5JVD A;  3HKB B;  2UYJ A;  5HWE A;  3S06 A;  1FFX A;  2UYN B;  4X1Y B;  5HY1 A;  1E7K A;  3RA6 A;  5JH7 B;  1Q8R A;  2KTV A;  1NMU B;  4X20 A;  2VAW A;  1T0K B;  3HJW C;  3N4Y A;  3HKD A;  3HKC B;  1X52 A;  1W59 A;  4WBN A;  1U43 A;  2Z1T A;  4O4I B;  3LME A;  3GHZ A;  3VOA A;  1VH8 A;  1TVK A;  3LFO A;  4BT3 A;  1SDS A;  2RHJ A;  4YJ3 B;  3LWR C;  3G4S F;  5LYJ B;  5EIB C;  5ITZ B;  4EB6 B;  3VYU C;  1Q86 H;  3ZOP A;  1RQ7 A;  3JAK A;  5JQG A;  1Q7Y H;  4RHA A;  3HWU A;  2BO1 A;  4G4W A;  2HRU A;  3TD3 A;  5B8F A;  3G6E F;  5MN4 A;  3IMP A;  3N2K A;  1NJI H;  3E22 B;  1QVG F;  3L7Q A;  4HNA A;  3CME F;  1JD1 A;  5G4V C;  3HAX D;  5MN6 A;  1R1M A;  4I4T B;  2N48 A;  1FNK A;  3RYC B;  2HP0 B;  3CPQ A;  1YJ9 F;  5EAZ A;  4DXD A;  4IIJ B;  3VOB A;  3LWP C;  3O85 A;  3I3F A;  4X1I A;  3E20 B;  5EO3 A;  5HXU A;  1Z5W A;  5LXT B;  1YQN A;  1YIJ F;  3ERN A;  3ELC A;  5KMG B;  2H6L A;  2YYE A;  2GZL A;  3JAM M;  4I50 A;  1M1K H;  3E1Y A;  3MQW A;  3N4Z A; 
#chains in the Genus database with same CATH homology
 2ZOV A;  3CYP B;  5EAZ A;  2W8B C;  3OON A;  4G88 A;  4G4Z A;  3CYQ A;  2L26 A;  4G4V A;  4B5C A;  2ZVY A;  3TD5 A;  2LBT A;  4ZHW A;  3S0W A;  2ZVZ A;  4RHA A;  3S03 A;  4R40 B;  1OAP A;  2LCA A;  5EB0 A;  4G4Y A;  4G4W A;  4G4X A;  3TD3 A;  2K1S A;  3S06 A;  3S0H A;  3IMP A;  3KHN A;  3WPX A;  2HQS C;  3S0Y A;  4ZHV A;  4B62 A;  4ERH A;  4ZHY B;  2ZF8 A;  1R1M A;  5EB1 B;  4PWT A;  3LDT A;  2N48 A;  2MQE A;  3S02 A;  3TD4 A;  2AIZ P;  2KGW A;  3WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...