4B62A

The structure of the cell wall anchor of the t6ss from pseudomonas aeruginosa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
ERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TSSL1
publication title Crystal Structure of the Periplasmic Peptidoglycan Binding Anchor of a T6Ss from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Membrane protein
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b62A00
3TD3A 3S0HA 4PWTA 2ZVZA 4B5CA 3S0WA 2LCAA 4G4YA 4G4WA 2ZF8A 3S03A 3CYQA 2ZVYA 3KHNA 4RHAA 4ZHYB 3OONA 3S02A 5EB1B 3CYPB 4G4XA 4G4VA 4G4ZA 2MQEA 2HQSC 2ZOVA 3IMPA 4ZHVA 5EAZA 2L26A 4ZHWA 2W8BC 1OAPA 4G88A 3LDTA 5EB0A 4B62A 2LBTA 3S06A 3TD5A 3S0YA 1R1MA 2K1SA 3WPXA 2KGWA 4ERHA 2N48A 3WPWA 3TD4A 4R40B 2AIZP
chains in the Genus database with same CATH superfamily
3M84A 1JFFA 3IR9A 2EWCA 4NUTA 2JNBA 2P6YA 3CMEF 4C82A 5HP7A 1YITF 4ZHYB 2BTUA 3WGMA 1SZQA 5MN5A 1J7HA 3RYCB 1VH8A 2AMTA 5BMVA 1JD1A 4HNAA 4X1IB 3F0FA 4O4HB 4ZHVA 3JAKB 1W41A 4IHJA 3CPQA 4C8IA 1M1KH 4B46A 1VQ7F 2AIFA 4TV9B 2BTOA 2ZF8A 3KE1A 3N2KB 3VMFB 1COMA 3I3FA 3CCVF 2PHNA 2Z1EA 3I7TA 5LA6B 3I55F 2HRUA 1IV4A 3RYCA 2FC3A 1QU9A 1W40A 2YXZA 5GINC 3HKEB 4O4HA 1W5EA 5EB0A 3WPXA 1CK2A 1YIJF 5KMGB 3CCSF 2GLZA 3LWQC 3ON1A 1FNJA 1KD1H 3V7EA 1YJNF 4G4YA 4G4WA 5GAPK 4ZK7A 3JALB 1U3PA 2ZVYA 3KIZA 5A2QM 2FGYA 1XHOA 1X7PA 3KJKA 4I4TA 3CCJF 3HAXD 5LA6A 4G4ZA 3WGLA 1OFUA 1ZWZA 3HKEA 2HRYA 2K1SA 5FLXM 1H7MA 3RYHA 3NMUC 4WBNA 5IT9M 1CN7A 3LWOC 3RYFA 2OTLF 3P4EA 2LCAA 1VQMF 1VQVA 2B33A 3CCRF 5ITZB 4O2BB 3CXCF 3J80M 3NK7A 2F9ZC 3JALA 5G4VC 3HWUA 3JCMM 2UYJA 2KTVA 3N2GB 3GYQA 5HY1A 5HP8A 1SDSA 4TV8A 4C8GA 2HP3A 3NVKE 1XV2A 2IQQA 3HTNA 3GHZA 4C8EA 3L7QA 2KGWA 3WPWA 5C8YA 1XRGA 2CHTA 3LWVC 5HXZA 1SA0B 1Q86H 1M90H 3LFOA 5FNVB 3QHDA 5HY2A 5GONB 1QVFF 4EI9A 3OONA 3RYIB 3NK6A 4O2BA 4BVQA 5EB1B 3JASA 4FFBB 4TUYB 1W581 2UYPA 4BVSA 3IEQA 4X3MA 3WJQA 1VQ8F 1VQNF 1W5BA 5EAZA 2CSLA 5IJ0A 2HP0B 3M4SA 2LBTA 5CB4B 5J2UB 5J2TA 5AVMA 4BT5A 5HY0A 3V3TA 2OTJF 1IPAA 3HKBA 2PMPA 1KNJA 3VYTC 4DRXA 4BY9D 3EORA 3S0HA 1GZ0A 5HWEA 2DYYA 2R751 1SA0A 1KNKA 5FNVA 1YJWF 2CZWA 1FNKA 2LBWA 3CYPB 3RYIA 1KQSF 1YGYA 2RHHA 3D01A 2HS3A 4FFBA 2ZOVA 3IMPA 2GVIA 2I6DA 4BT7A 2BO1A 3VYUC 2OTMA 1IV3A 2QI2A 2CW4A 2HP0A 4O2AB 5J2UA 1T0AA 1W5AA 1S72F 5GIPC 5GANK 3G4SF 3CCMF 3VYSC 3WGNA 3K0TA 4YJ3B 1YI2F 3NVIB 4PWTA 1JJ2F 2ZVZA 3OBYA 4O4IB 5B8FA 5HXUA 4ZOLB 5JCOC 3CCLF 3HKDB 2V9YA 3F6MA 3DC2A 3J7AR 1IV2A 3FFMA 5CA1B 5IJ9B 4X1IA 2CHSA 3RE3A 1Q8RA 3F0DA 3JAKA 4NQ3A 2UYKA 1K9MH 4O2AA 4X3LA 3C9SA 3V7QA 3VO8A 3O85A 2HS0A 3CCEF 1VQPF 3M1XA 3JATB 3TD3A 2UYNB 3N4ZA 4YJ3A 4B5CA 4O4IA 4TV9A 1GX1A 1FSZA 3LWRC 2ZODA 4RHAA 1UFYA 3VTIC 3LYBA 3N2KA 1ODEA 1Q81H 3HKDA 3K2XA 3ESJA 5JVDB 4G4VA 1W2BF 1CLIA 1XBIA 5CA1A 5IJ9A 1JN1A 4M8IA 1KC8H 3C9UA 1TUBB 2N48A 3FD5A 5EZYB 5EWRA 3TD4A 3QTYA 2HVYD 4I55B 5G4UC 5KMGA 4B45A 1W3EX 4F6RB 5LXTB 3JATA 5FJ4C 2UYNA 1NJIH 1GO0A 2VGMA 2VGNA 3ZOPA 5LYJB 3UT5B 3C9RA 5JVDA 3B6NA 4IIJB 4X20B 3IKFA 4I50B 3PAFA 2OZBA 1TUBA 5CA0B 1RA4A 3VIUA 5EZYA 1U40A 2KTUA 3I56F 4ZHQB 4I55A 3CD6F 4NWOB 1QD9A 2CWJA 2DT4A 4O4LB 2HS4A 5LXTA 4BT6A 3C8LA 5LOVB 3WGKA 5ITZA 3UT5A 3VOBA 2MQEA 5EO3A 3QUWA 3N2GA 3T80A 2RHLA 4IIJA 4LNUB 3CPWF 3LDTA 2RHOA 2VAMA 3ZO8A 3E1YA 4I50A 1PF5A 3P0ZA 5CA0A 3MBMA 3SIVA 1JY8A 4ZI7B 4ZHQA 2LBXA 1NQ3A 4O4LA 3WXMB 1Q7YH 3C9TA 2Q1YA 5BMVB 1VQ5F 2QTPA 2Z01A 4HNAB 5GONA 3ZP7A 3LWPC 3U0OA 2YYEA 3AGKA 1X7OA 4TUYA 1FFXB 1RQ2A 5EIBD 2L26A 4U3JB 4G88A 3IEWA 4ERHA 5JCOA 3Q8HA 5CB4A 5LP6B 2Z1UA 1VQLF 1X52A 4R40B 3HKCB 3JAMM 1YJ9F 3CB2A 4BT2A 1U43A 1VQ4F 4ZI7A 3GTZA 2VXYA 3OW2F 1VK3A 4C81A 1W57A 1DT9A 4G4XA 4EB6B 4X1KB 3OBWA 1NMUB 4O4JB 3WJPA 3CC4F 3D00A 4ZHWA 1FFXA 4U3JA 4E6EA 2VAWA 3ZP4A 2RB9A 3KJJA 3PLAC 3E22B 4KWEA 5LP6A 5KX5B 3MCAB 3RA5A 2IAFA 3HKCA 3FBAA 3CYQA 1VQ9F 3KHNA 1DBFA 2GZLA 4ZOLA 1VHAA 4I4TB 4BW0B 1RLGA 3P10A 2WALA 5LP6C 3HJWC 5EYPB 3WJRA 5MN4A 5IYZB 4DXDA 4EB6A 3CG6A 1TVKB 2VAPA 4X1KA 5JQGB 5JH7B 4O4JA 3S06A 3TD5A 3MDOA 3ELCA 3RYHB 4WBNB 4EI7A 3FD6A 4TZZA 3JARB 2QA4F 3RYFB 2G9IA 1U3LA 3DDNA 3E22A 4BT4A 3MCQA 5KX5A 1K8AH 3ERNA 1VQOF 4C4WC 1X25A 1W42A 3JAWB 3LMEA 3CCUF 2UZHA 1RLUA 3K12A 1H48A 1VQKF 4TV8B 5EYPA 4XCQA 5IYZA 3F0EA 3MQWA 4EI8A 3V4DA 2RHJA 1RQ7A 4LCKA 5DCVA 3RA6A 1TVKA 3N4YA 5C8YB 2OHWA 4YJ2B 5JQGA 1R1MA 5JH7A 5GIOC 2HX0A 4RQOA 2H8CA 4BVTA 3VCZA 4U39A 3WGJA 3JARA 1ONIA 3SIUA 2Q1XA 1W5FA 3F0GA 1Z5WA 3S0WA 1H47A 3BYQA 1QVGF 3S03A 3G6EF 2Z1TA 3JAWA 3JASB 4F6RA 4X1YB 1UI9A 3CC7F 5HY4A 1W59A 1N8RH 1W55A 3IKEA 5LYJA 5MN6A 2KG4A 5IJ0B 2Z1FA 1VQ6F 2HQSC 5J2TB 3CC2F 3VOAA 2W8BC 1OAPA 1QAHA 3HKBB 4X20A 2NMUA 4DRXB 4YJ2A 1K73H 2I6RA 1IV1A 2QEXF 1Z5VA 1JFFB 3VI6A 3JVHA 3G71F 3J81M 2H8EA 3R0PA 1GO1A 3CMAF 1Q82H 3S02A 4X1YA 2R6R1 1YHQF 4BVRA 1PXWA 2ZAUA 5LOVA 3D54A 1T0KB 5EIBC 4IHJB 2H6LA 4B62A 3S0YA 2ALEA 2CVLA 4BT3A 4LNUA 1YQNA 1E7KA 2IG8A 3CCQF 3FPIA 2BTQB 3K14A 3E20B 2AIZP
chains in the Genus database with same CATH topology
3TD3A 3S0HA 4PWTA 2ZVZA 4B5CA 3S0WA 2LCAA 4G4YA 4G4WA 2ZF8A 3S03A 3CYQA 2ZVYA 3KHNA 4RHAA 4ZHYB 3OONA 3S02A 5EB1B 3CYPB 4G4XA 4G4VA 4G4ZA 2MQEA 2HQSC 2ZOVA 3IMPA 4ZHVA 5EAZA 2L26A 4ZHWA 2W8BC 1OAPA 4G88A 3LDTA 5EB0A 4B62A 2LBTA 3S06A 3TD5A 3S0YA 1R1MA 2K1SA 3WPXA 2KGWA 4ERHA 2N48A 3WPWA 3TD4A 4R40B 2AIZP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TD3 A;  3S0H A;  4PWT A;  2ZVZ A;  4B5C A;  3S0W A;  2LCA A;  4G4Y A;  4G4W A;  2ZF8 A;  3S03 A;  3CYQ A;  2ZVY A;  3KHN A;  4RHA A;  4ZHY B;  3OON A;  3S02 A;  5EB1 B;  3CYP B;  4G4X A;  4G4V A;  4G4Z A;  2MQE A;  2HQS C;  2ZOV A;  3IMP A;  4ZHV A;  5EAZ A;  2L26 A;  4ZHW A;  2W8B C;  1OAP A;  4G88 A;  3LDT A;  5EB0 A;  4B62 A;  2LBT A;  3S06 A;  3TD5 A;  3S0Y A;  1R1M A;  2K1S A;  3WPX A;  2KGW A;  4ERH A;  2N48 A;  3WPW A;  3TD4 A;  4R40 B;  2AIZ P; 
#chains in the Genus database with same CATH topology
 3M84 A;  1JFF A;  3IR9 A;  2EWC A;  4NUT A;  2JNB A;  2P6Y A;  3CME F;  4C82 A;  5HP7 A;  1YIT F;  4ZHY B;  2BTU A;  3WGM A;  1SZQ A;  5MN5 A;  1J7H A;  3RYC B;  1VH8 A;  2AMT A;  5BMV A;  1JD1 A;  4HNA A;  4X1I B;  3F0F A;  4O4H B;  4ZHV A;  3JAK B;  1W41 A;  4IHJ A;  3CPQ A;  4C8I A;  1M1K H;  4B46 A;  1VQ7 F;  2AIF A;  4TV9 B;  2BTO A;  2ZF8 A;  3KE1 A;  3N2K B;  3VMF B;  1COM A;  3I3F A;  3CCV F;  2PHN A;  2Z1E A;  3I7T A;  5LA6 B;  3I55 F;  2HRU A;  1IV4 A;  3RYC A;  2FC3 A;  1QU9 A;  1W40 A;  2YXZ A;  5GIN C;  3HKE B;  4O4H A;  1W5E A;  5EB0 A;  3WPX A;  1CK2 A;  1YIJ F;  5KMG B;  3CCS F;  2GLZ A;  3LWQ C;  3ON1 A;  1FNJ A;  1KD1 H;  3V7E A;  1YJN F;  4G4Y A;  4G4W A;  5GAP K;  4ZK7 A;  3JAL B;  1U3P A;  2ZVY A;  3KIZ A;  5A2Q M;  2FGY A;  1XHO A;  1X7P A;  3KJK A;  4I4T A;  3CCJ F;  3HAX D;  5LA6 A;  4G4Z A;  3WGL A;  1OFU A;  1ZWZ A;  3HKE A;  2HRY A;  2K1S A;  5FLX M;  1H7M A;  3RYH A;  3NMU C;  4WBN A;  5IT9 M;  1CN7 A;  3LWO C;  3RYF A;  2OTL F;  3P4E A;  2LCA A;  1VQM F;  1VQV A;  2B33 A;  3CCR F;  5ITZ B;  4O2B B;  3CXC F;  3J80 M;  3NK7 A;  2F9Z C;  3JAL A;  5G4V C;  3HWU A;  3JCM M;  2UYJ A;  2KTV A;  3N2G B;  3GYQ A;  5HY1 A;  5HP8 A;  1SDS A;  4TV8 A;  4C8G A;  2HP3 A;  3NVK E;  1XV2 A;  2IQQ A;  3HTN A;  3GHZ A;  4C8E A;  3L7Q A;  2KGW A;  3WPW A;  5C8Y A;  1XRG A;  2CHT A;  3LWV C;  5HXZ A;  1SA0 B;  1Q86 H;  1M90 H;  3LFO A;  5FNV B;  3QHD A;  5HY2 A;  5GON B;  1QVF F;  4EI9 A;  3OON A;  3RYI B;  3NK6 A;  4O2B A;  4BVQ A;  5EB1 B;  3JAS A;  4FFB B;  4TUY B;  1W58 1;  2UYP A;  4BVS A;  3IEQ A;  4X3M A;  3WJQ A;  1VQ8 F;  1VQN F;  1W5B A;  5EAZ A;  2CSL A;  5IJ0 A;  2HP0 B;  3M4S A;  2LBT A;  5CB4 B;  5J2U B;  5J2T A;  5AVM A;  4BT5 A;  5HY0 A;  3V3T A;  2OTJ F;  1IPA A;  3HKB A;  2PMP A;  1KNJ A;  3VYT C;  4DRX A;  4BY9 D;  3EOR A;  3S0H A;  1GZ0 A;  5HWE A;  2DYY A;  2R75 1;  1SA0 A;  1KNK A;  5FNV A;  1YJW F;  2CZW A;  1FNK A;  2LBW A;  3CYP B;  3RYI A;  1KQS F;  1YGY A;  2RHH A;  3D01 A;  2HS3 A;  4FFB A;  2ZOV A;  3IMP A;  2GVI A;  2I6D A;  4BT7 A;  2BO1 A;  3VYU C;  2OTM A;  1IV3 A;  2QI2 A;  2CW4 A;  2HP0 A;  4O2A B;  5J2U A;  1T0A A;  1W5A A;  1S72 F;  5GIP C;  5GAN K;  3G4S F;  3CCM F;  3VYS C;  3WGN A;  3K0T A;  4YJ3 B;  1YI2 F;  3NVI B;  4PWT A;  1JJ2 F;  2ZVZ A;  3OBY A;  4O4I B;  5B8F A;  5HXU A;  4ZOL B;  5JCO C;  3CCL F;  3HKD B;  2V9Y A;  3F6M A;  3DC2 A;  3J7A R;  1IV2 A;  3FFM A;  5CA1 B;  5IJ9 B;  4X1I A;  2CHS A;  3RE3 A;  1Q8R A;  3F0D A;  3JAK A;  4NQ3 A;  2UYK A;  1K9M H;  4O2A A;  4X3L A;  3C9S A;  3V7Q A;  3VO8 A;  3O85 A;  2HS0 A;  3CCE F;  1VQP F;  3M1X A;  3JAT B;  3TD3 A;  2UYN B;  3N4Z A;  4YJ3 A;  4B5C A;  4O4I A;  4TV9 A;  1GX1 A;  1FSZ A;  3LWR C;  2ZOD A;  4RHA A;  1UFY A;  3VTI C;  3LYB A;  3N2K A;  1ODE A;  1Q81 H;  3HKD A;  3K2X A;  3ESJ A;  5JVD B;  4G4V A;  1W2B F;  1CLI A;  1XBI A;  5CA1 A;  5IJ9 A;  1JN1 A;  4M8I A;  1KC8 H;  3C9U A;  1TUB B;  2N48 A;  3FD5 A;  5EZY B;  5EWR A;  3TD4 A;  3QTY A;  2HVY D;  4I55 B;  5G4U C;  5KMG A;  4B45 A;  1W3E X;  4F6R B;  5LXT B;  3JAT A;  5FJ4 C;  2UYN A;  1NJI H;  1GO0 A;  2VGM A;  2VGN A;  3ZOP A;  5LYJ B;  3UT5 B;  3C9R A;  5JVD A;  3B6N A;  4IIJ B;  4X20 B;  3IKF A;  4I50 B;  3PAF A;  2OZB A;  1TUB A;  5CA0 B;  1RA4 A;  3VIU A;  5EZY A;  1U40 A;  2KTU A;  3I56 F;  4ZHQ B;  4I55 A;  3CD6 F;  4NWO B;  1QD9 A;  2CWJ A;  2DT4 A;  4O4L B;  2HS4 A;  5LXT A;  4BT6 A;  3C8L A;  5LOV B;  3WGK A;  5ITZ A;  3UT5 A;  3VOB A;  2MQE A;  5EO3 A;  3QUW A;  3N2G A;  3T80 A;  2RHL A;  4IIJ A;  4LNU B;  3CPW F;  3LDT A;  2RHO A;  2VAM A;  3ZO8 A;  3E1Y A;  4I50 A;  1PF5 A;  3P0Z A;  5CA0 A;  3MBM A;  3SIV A;  1JY8 A;  4ZI7 B;  4ZHQ A;  2LBX A;  1NQ3 A;  4O4L A;  3WXM B;  1Q7Y H;  3C9T A;  2Q1Y A;  5BMV B;  1VQ5 F;  2QTP A;  2Z01 A;  4HNA B;  5GON A;  3ZP7 A;  3LWP C;  3U0O A;  2YYE A;  3AGK A;  1X7O A;  4TUY A;  1FFX B;  1RQ2 A;  5EIB D;  2L26 A;  4U3J B;  4G88 A;  3IEW A;  4ERH A;  5JCO A;  3Q8H A;  5CB4 A;  5LP6 B;  2Z1U A;  1VQL F;  1X52 A;  4R40 B;  3HKC B;  3JAM M;  1YJ9 F;  3CB2 A;  4BT2 A;  1U43 A;  1VQ4 F;  4ZI7 A;  3GTZ A;  2VXY A;  3OW2 F;  1VK3 A;  4C81 A;  1W57 A;  1DT9 A;  4G4X A;  4EB6 B;  4X1K B;  3OBW A;  1NMU B;  4O4J B;  3WJP A;  3CC4 F;  3D00 A;  4ZHW A;  1FFX A;  4U3J A;  4E6E A;  2VAW A;  3ZP4 A;  2RB9 A;  3KJJ A;  3PLA C;  3E22 B;  4KWE A;  5LP6 A;  5KX5 B;  3MCA B;  3RA5 A;  2IAF A;  3HKC A;  3FBA A;  3CYQ A;  1VQ9 F;  3KHN A;  1DBF A;  2GZL A;  4ZOL A;  1VHA A;  4I4T B;  4BW0 B;  1RLG A;  3P10 A;  2WAL A;  5LP6 C;  3HJW C;  5EYP B;  3WJR A;  5MN4 A;  5IYZ B;  4DXD A;  4EB6 A;  3CG6 A;  1TVK B;  2VAP A;  4X1K A;  5JQG B;  5JH7 B;  4O4J A;  3S06 A;  3TD5 A;  3MDO A;  3ELC A;  3RYH B;  4WBN B;  4EI7 A;  3FD6 A;  4TZZ A;  3JAR B;  2QA4 F;  3RYF B;  2G9I A;  1U3L A;  3DDN A;  3E22 A;  4BT4 A;  3MCQ A;  5KX5 A;  1K8A H;  3ERN A;  1VQO F;  4C4W C;  1X25 A;  1W42 A;  3JAW B;  3LME A;  3CCU F;  2UZH A;  1RLU A;  3K12 A;  1H48 A;  1VQK F;  4TV8 B;  5EYP A;  4XCQ A;  5IYZ A;  3F0E A;  3MQW A;  4EI8 A;  3V4D A;  2RHJ A;  1RQ7 A;  4LCK A;  5DCV A;  3RA6 A;  1TVK A;  3N4Y A;  5C8Y B;  2OHW A;  4YJ2 B;  5JQG A;  1R1M A;  5JH7 A;  5GIO C;  2HX0 A;  4RQO A;  2H8C A;  4BVT A;  3VCZ A;  4U39 A;  3WGJ A;  3JAR A;  1ONI A;  3SIU A;  2Q1X A;  1W5F A;  3F0G A;  1Z5W A;  3S0W A;  1H47 A;  3BYQ A;  1QVG F;  3S03 A;  3G6E F;  2Z1T A;  3JAW A;  3JAS B;  4F6R A;  4X1Y B;  1UI9 A;  3CC7 F;  5HY4 A;  1W59 A;  1N8R H;  1W55 A;  3IKE A;  5LYJ A;  5MN6 A;  2KG4 A;  5IJ0 B;  2Z1F A;  1VQ6 F;  2HQS C;  5J2T B;  3CC2 F;  3VOA A;  2W8B C;  1OAP A;  1QAH A;  3HKB B;  4X20 A;  2NMU A;  4DRX B;  4YJ2 A;  1K73 H;  2I6R A;  1IV1 A;  2QEX F;  1Z5V A;  1JFF B;  3VI6 A;  3JVH A;  3G71 F;  3J81 M;  2H8E A;  3R0P A;  1GO1 A;  3CMA F;  1Q82 H;  3S02 A;  4X1Y A;  2R6R 1;  1YHQ F;  4BVR A;  1PXW A;  2ZAU A;  5LOV A;  3D54 A;  1T0K B;  5EIB C;  4IHJ B;  2H6L A;  4B62 A;  3S0Y A;  2ALE A;  2CVL A;  4BT3 A;  4LNU A;  1YQN A;  1E7K A;  2IG8 A;  3CCQ F;  3FPI A;  2BTQ B;  3K14 A;  3E20 B;  2AIZ P; 
#chains in the Genus database with same CATH homology
 3TD3 A;  3S0H A;  4PWT A;  2ZVZ A;  4B5C A;  3S0W A;  2LCA A;  4G4Y A;  4G4W A;  2ZF8 A;  3S03 A;  3CYQ A;  2ZVY A;  3KHN A;  4RHA A;  4ZHY B;  3OON A;  3S02 A;  5EB1 B;  3CYP B;  4G4X A;  4G4V A;  4G4Z A;  2MQE A;  2HQS C;  2ZOV A;  3IMP A;  4ZHV A;  5EAZ A;  2L26 A;  4ZHW A;  2W8B C;  1OAP A;  4G88 A;  3LDT A;  5EB0 A;  4B62 A;  2LBT A;  3S06 A;  3TD5 A;  3S0Y A;  1R1M A;  2K1S A;  3WPX A;  2KGW A;  4ERH A;  2N48 A;  3WPW A;  3TD4 A;  4R40 B;  2AIZ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...