3ZP7A

Arg90cit chorismate mutase of bacillus subtilis in complex with chorismate and prephenate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
116
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 31
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zp7A00
2UYNB 5HP7A 2IG8A 1QU9A 1QAHA 1XRGA 3MQWA 3L7QA 3I3FA 3R0PA 1ONIA 1QD9A 1J7HA 2CSLA 2UYKA 3ZOPA 1PF5A 3K0TA 2B33A 2UYJA 1X25A 1UI9A 3D01A 3I7TA 2CW4A 3ZP7A 3K12A 5HP8A 1FNKA 3V4DA 3KJKA 1XHOA 3LYBA 3ZO8A 1JD1A 4NWOB 2DYYA 3LMEA 4ZK7A 3M1XA 1ODEA 1COMA 2CVLA 1DBFA 2CHSA 3VCZA 1FNJA 3ZP4A 3QUWA 2CHTA 2CWJA 2OTMA 1UFYA 3GTZA 2EWCA 3KJJA 2UYPA 1NQ3A 3M4SA 2UYNA
chains in the Genus database with same CATH superfamily
2Z1EA 2HS4A 3V3TA 3JARB 1KNKA 1CK2A 5EZYB 4O4JB 5EB1B 1QD9A 2CSLA 3HKEA 4ERHA 3GYQA 1M1KH 3D00A 3U0OA 1X25A 3OONA 5JH7A 2LCAA 1YQNA 2ZODA 2G9IA 4RHAA 3CYQA 2H6LA 4ZHQB 2HS0A 5HY4A 5KMGB 3KE1A 1W5FA 2VGMA 2QI2A 2BTOA 3WGLA 2Q1YA 1SZQA 1TUBA 4G4WA 5J2UA 1VQMF 1T0AA 3FD5A 5HP7A 4PWTA 3TD5A 3RYHA 3ZOPA 3C9RA 3C9SA 3ERNA 2P6YA 3VYUC 4ZI7B 4BVRA 5C8YB 5LP6A 3TD4A 2F9ZC 4IHJB 3RYFA 5KX5B 4FFBB 4F6RB 1JFFA 1SA0A 1JY8A 1U3PA 2HQSC 3SIVA 5G4UC 2LBTA 1KC8H 5FNVA 5J2TA 2FGYA 4B46A 5EAZA 2HP0A 3CXCF 1YHQF 2L26A 1W5BA 3HKEB 1Q82H 2ZAUA 4ZHWA 3D01A 2R6R1 5JH7B 3KHNA 5CA0A 4BW0B 1VQ5F 4TV8A 3IKEA 1RQ2A 1RQ7A 3JAWA 3VTIC 1VQ6F 2OTMA 1TUBB 5J2UB 2OTLF 2GVIA 1W5EA 3RYHB 3MQWA 3VOBA 2QA4F 3CCLF 3IEWA 4G4ZA 2HX0A 2I6DA 5GIOC 4KWEA 5LP6B 4X1YA 1K9MH 4I50A 1H48A 1W41A 3RYFB 1YIJF 4BVQA 1JFFB 1SA0B 3WJRA 2HRUA 2KTUA 4O4HA 2OTJF 3VCZA 1GO0A 4LCKA 5FNVB 5EWRA 3S0HA 1T0KB 1XV2A 1NQ3A 5J2TB 3F0GA 3AGKA 1W40A 1Z5WA 1X7PA 2IG8A 1KQSF 1XRGA 2HP0B 4X1IA 2ALEA 5HWEA 4TZZA 4IIJA 3HKCA 5JCOC 2N48A 3C9TA 3DDNA 5CA0B 2GZLA 3MBMA 3VO8A 5EO3A 4TV8B 3CC4F 3JAWB 5HY2A 2CWJA 4I55A 1UFYA 4BY9D 3WJQA 3SIUA 1TVKA 5MN5A 2AMTA 5GAPK 4U3JA 4G4VA 2HP3A 4C8EA 2PMPA 4O4IA 4X1YB 1IV1A 1W42A 1IV2A 4I50B 1IV3A 5B8FA 1VQ4F 2PHNA 4BT7A 3LWPC 3FPIA 2HS3A 3MCAB 4X3MA 3J7AR 5IT9M 4ZHYB 3CCQF 3O85A 3QTYA 1IV4A 4G4YA 2EWCA 3PAFA 4I4TA 4BT6A 1GZ0A 1W3EX 5EIBD 4NUTA 3I3FA 4NQ3A 4X20A 3LWQC 3ON1A 1QVFF 1J7HA 4X1IB 4O2BB 3G71F 3DC2A 3JCMM 2UYJA 3QHDA 4IIJB 3JATA 2BO1A 3WGKA 3HKCB 2CW4A 4BT4A 1M90H 1W55A 4R40B 3V7QA 3BYQA 2ZOVA 1CN7A 3CCVF 2RB9A 3VMFB 4BT3A 4DRXA 4DXDA 1VQ8F 1XBIA 3B6NA 2VAWA 5JCOA 3RA6A 1Q86H 2BTQB 4I55B 3JALA 2UYPA 1YJWF 1Q8RA 2Z1UA 3HKDA 5LYJA 2YYEA 1W2BF 1K73H 1TVKB 3VYSC 1SDSA 3WXMB 3M84A 4U3JB 5CA1A 2V9YA 5GINC 3K0TA 3N2GA 2VAPA 3JAMM 5EB0A 1VQKF 1OFUA 2RHLA 3I55F 5LXTA 2LBXA 2K1SA 4O4IB 4YJ3A 4BT2A 2ZVZA 5GIPC 1VH8A 4LNUA 4B45A 3KIZA 1ODEA 4EB6A 2CHSA 5LOVA 4C82A 2CHTA 1NMUB 1YJ9F 5GANK 1U40A 2AIZP 4I4TB 3F0EA 1VQNF 1R1MA 3CCEF 1QAHA 4X20B 1K8AH 5EIBC 1VHAA 4G4XA 2HRYA 4BVTA 1KNJA 2KTVA 3JATB 3I7TA 3FFMA 3CC2F 4E6EA 3V7EA 5JVDA 2W8BC 2DT4A 5EYPA 2GLZA 3WPWA 5G4VC 2IQQA 5FLXM 4ZOLA 3M4SA 3WGMA 3Q8HA 3HKDB 1W5AA 3IR9A 4B62A 1U3LA 4O2AA 2UYKA 5CA1B 3UT5A 5MN6A 2ZVYA 1DT9A 3N2GB 5LA6B 3HTNA 3E22A 3ZP7A 5LXTB 3CCSF 4YJ3B 3S0YA 3E20B 2Z1FA 3IKFA 3NK7A 1VQVA 3FD6A 4NWOB 3P0ZA 4LNUB 2JNBA 3RA5A 4B5CA 4C8GA 5A2QM 4EB6B 3PLAC 3IEQA 5LOVB 1VQLF 5BMVA 3HKBA 3VOAA 4WBNA 2YXZA 3J80M 3NVKE 3VI6A 3C8LA 2WALA 3NK6A 1S72F 2RHOA 5ITZA 3CC7F 3P10A 3LDTA 2VGNA 2BTUA 3VYTC 2NMUA 2MQEA 5JVDB 4EI8A 4ZHVA 3S06A 1VQ7F 2OHWA 5CB4A 5EYPB 3N2KA 1DBFA 2VXYA 5MN4A 3CCRF 3JAKA 4O4HB 1JN1A 3D54A 1JJ2F 4ZOLB 1RLUA 3F0FA 3RYIA 3N4ZA 3WJPA 2QTPA 3HWUA 1QU9A 1VK3A 3FBAA 2RHHA 1X7OA 4RQOA 4O2AB 1OAPA 4TUYA 3UT5B 3J81M 3HJWC 5JQGA 3E22B 3V4DA 3WPXA 1IPAA 1XHOA 3CPQA 3K14A 5HXUA 1PXWA 4M8IA 1U43A 3E1YA 4O4LA 1RLGA 1W59A 5BMVB 3HKBB 2KG4A 4WBNB 3C9UA 1W57A 2I6RA 1YJNF 1Q7YH 3CMAF 2RHJA 4TV9A 5ITZB 1H7MA 2B33A 3K12A 5HP8A 3JVHA 2H8CA 4HNAA 5IJ0A 3ZO8A 1FFXA 4C81A 4YJ2A 4BVSA 2DYYA 3LMEA 3LWRC 5CB4B 3M1XA 3N2KB 3RE3A 3CD6F 3JAKB 3MDOA 4C4WC 3QUWA 5IJ9A 2R751 3CG6A 3OBYA 3G4SF 1GO1A 3RYIB 2UYNA 1ZWZA 3K2XA 3LFOA 1VQPF 5AVMA 3RYCA 3R0PA 1VQOF 4TUYB 1PF5A 3ELCA 1YI2F 4EI9A 4X3LA 3F0DA 2CZWA 3LWOC 5JQGB 2HVYD 5IYZA 3IMPA 3CPWF 3OBWA 1KD1H 3LWVC 1FNKA 1E7KA 2VAMA 2Z1TA 1JD1A 3OW2F 2ZF8A 5DCVA 4DRXB 4BT5A 3CB2A 5GONA 4O4LB 3S03A 1FSZA 3S0WA 3JASA 3GTZA 3KJJA 3HAXD 4X1KA 5LA6A 3JALB 3VIUA 2Q1XA 1VQ9F 3WGJA 3NVIB 4U39A 3JARA 5LYJB 5EZYA 4O4JA 1ONIA 1RA4A 4TV9B 1GX1A 2IAFA 5FJ4C 1UI9A 3G6EF 4G88A 1Z5VA 1X52A 4HNAB 5IJ0B 1CLIA 1FFXB 4ZHQA 5KMGA 3CCUF 2KGWA 4YJ2B 2QEXF 3CYPB 5HY1A 2CVLA 2FC3A 4C8IA 1N8RH 2H8EA 3CCMF 1FNJA 3MCQA 3F6MA 5IJ9B 3S02A 3CMEF 1YITF 1Q81H 2UZHA 5LP6C 3NMUC 3KJKA 2UYNB 2Z01A 3RYCB 3L7QA 3P4EA 4O2BA 1W581 2OZBA 3ESJA 1QVGF 4ZI7A 1NJIH 5IYZB 5C8YA 3GHZA 3LYBA 3I56F 3T80A 4IHJA 5KX5A 4FFBA 4F6RA 4ZK7A 1H47A 4XCQA 1COMA 3N4YA 5GONB 3TD3A 3CCJF 2LBWA 3ZP4A 5HXZA 2AIFA 4EI7A 3JASB 1YGYA 5HY0A 3WGNA 4X1KB 3EORA
chains in the Genus database with same CATH topology
2UYNB 5HP7A 2IG8A 1QU9A 1QAHA 1XRGA 3MQWA 3L7QA 3I3FA 3R0PA 1ONIA 1QD9A 1J7HA 2CSLA 2UYKA 3ZOPA 1PF5A 3K0TA 2B33A 2UYJA 1X25A 1UI9A 3D01A 3I7TA 2CW4A 3ZP7A 3K12A 5HP8A 1FNKA 3V4DA 3KJKA 1XHOA 3LYBA 3ZO8A 1JD1A 4NWOB 2DYYA 3LMEA 4ZK7A 3M1XA 1ODEA 1COMA 2CVLA 1DBFA 2CHSA 3VCZA 1FNJA 3ZP4A 3QUWA 2CHTA 2CWJA 2OTMA 1UFYA 3GTZA 2EWCA 3KJJA 2UYPA 1NQ3A 3M4SA 2UYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYN B;  5HP7 A;  2IG8 A;  1QU9 A;  1QAH A;  1XRG A;  3MQW A;  3L7Q A;  3I3F A;  3R0P A;  1ONI A;  1QD9 A;  1J7H A;  2CSL A;  2UYK A;  3ZOP A;  1PF5 A;  3K0T A;  2B33 A;  2UYJ A;  1X25 A;  1UI9 A;  3D01 A;  3I7T A;  2CW4 A;  3ZP7 A;  3K12 A;  5HP8 A;  1FNK A;  3V4D A;  3KJK A;  1XHO A;  3LYB A;  3ZO8 A;  1JD1 A;  4NWO B;  2DYY A;  3LME A;  4ZK7 A;  3M1X A;  1ODE A;  1COM A;  2CVL A;  1DBF A;  2CHS A;  3VCZ A;  1FNJ A;  3ZP4 A;  3QUW A;  2CHT A;  2CWJ A;  2OTM A;  1UFY A;  3GTZ A;  2EWC A;  3KJJ A;  2UYP A;  1NQ3 A;  3M4S A;  2UYN A; 
#chains in the Genus database with same CATH topology
 2Z1E A;  2HS4 A;  3V3T A;  3JAR B;  1KNK A;  1CK2 A;  5EZY B;  4O4J B;  5EB1 B;  1QD9 A;  2CSL A;  3HKE A;  4ERH A;  3GYQ A;  1M1K H;  3D00 A;  3U0O A;  1X25 A;  3OON A;  5JH7 A;  2LCA A;  1YQN A;  2ZOD A;  2G9I A;  4RHA A;  3CYQ A;  2H6L A;  4ZHQ B;  2HS0 A;  5HY4 A;  5KMG B;  3KE1 A;  1W5F A;  2VGM A;  2QI2 A;  2BTO A;  3WGL A;  2Q1Y A;  1SZQ A;  1TUB A;  4G4W A;  5J2U A;  1VQM F;  1T0A A;  3FD5 A;  5HP7 A;  4PWT A;  3TD5 A;  3RYH A;  3ZOP A;  3C9R A;  3C9S A;  3ERN A;  2P6Y A;  3VYU C;  4ZI7 B;  4BVR A;  5C8Y B;  5LP6 A;  3TD4 A;  2F9Z C;  4IHJ B;  3RYF A;  5KX5 B;  4FFB B;  4F6R B;  1JFF A;  1SA0 A;  1JY8 A;  1U3P A;  2HQS C;  3SIV A;  5G4U C;  2LBT A;  1KC8 H;  5FNV A;  5J2T A;  2FGY A;  4B46 A;  5EAZ A;  2HP0 A;  3CXC F;  1YHQ F;  2L26 A;  1W5B A;  3HKE B;  1Q82 H;  2ZAU A;  4ZHW A;  3D01 A;  2R6R 1;  5JH7 B;  3KHN A;  5CA0 A;  4BW0 B;  1VQ5 F;  4TV8 A;  3IKE A;  1RQ2 A;  1RQ7 A;  3JAW A;  3VTI C;  1VQ6 F;  2OTM A;  1TUB B;  5J2U B;  2OTL F;  2GVI A;  1W5E A;  3RYH B;  3MQW A;  3VOB A;  2QA4 F;  3CCL F;  3IEW A;  4G4Z A;  2HX0 A;  2I6D A;  5GIO C;  4KWE A;  5LP6 B;  4X1Y A;  1K9M H;  4I50 A;  1H48 A;  1W41 A;  3RYF B;  1YIJ F;  4BVQ A;  1JFF B;  1SA0 B;  3WJR A;  2HRU A;  2KTU A;  4O4H A;  2OTJ F;  3VCZ A;  1GO0 A;  4LCK A;  5FNV B;  5EWR A;  3S0H A;  1T0K B;  1XV2 A;  1NQ3 A;  5J2T B;  3F0G A;  3AGK A;  1W40 A;  1Z5W A;  1X7P A;  2IG8 A;  1KQS F;  1XRG A;  2HP0 B;  4X1I A;  2ALE A;  5HWE A;  4TZZ A;  4IIJ A;  3HKC A;  5JCO C;  2N48 A;  3C9T A;  3DDN A;  5CA0 B;  2GZL A;  3MBM A;  3VO8 A;  5EO3 A;  4TV8 B;  3CC4 F;  3JAW B;  5HY2 A;  2CWJ A;  4I55 A;  1UFY A;  4BY9 D;  3WJQ A;  3SIU A;  1TVK A;  5MN5 A;  2AMT A;  5GAP K;  4U3J A;  4G4V A;  2HP3 A;  4C8E A;  2PMP A;  4O4I A;  4X1Y B;  1IV1 A;  1W42 A;  1IV2 A;  4I50 B;  1IV3 A;  5B8F A;  1VQ4 F;  2PHN A;  4BT7 A;  3LWP C;  3FPI A;  2HS3 A;  3MCA B;  4X3M A;  3J7A R;  5IT9 M;  4ZHY B;  3CCQ F;  3O85 A;  3QTY A;  1IV4 A;  4G4Y A;  2EWC A;  3PAF A;  4I4T A;  4BT6 A;  1GZ0 A;  1W3E X;  5EIB D;  4NUT A;  3I3F A;  4NQ3 A;  4X20 A;  3LWQ C;  3ON1 A;  1QVF F;  1J7H A;  4X1I B;  4O2B B;  3G71 F;  3DC2 A;  3JCM M;  2UYJ A;  3QHD A;  4IIJ B;  3JAT A;  2BO1 A;  3WGK A;  3HKC B;  2CW4 A;  4BT4 A;  1M90 H;  1W55 A;  4R40 B;  3V7Q A;  3BYQ A;  2ZOV A;  1CN7 A;  3CCV F;  2RB9 A;  3VMF B;  4BT3 A;  4DRX A;  4DXD A;  1VQ8 F;  1XBI A;  3B6N A;  2VAW A;  5JCO A;  3RA6 A;  1Q86 H;  2BTQ B;  4I55 B;  3JAL A;  2UYP A;  1YJW F;  1Q8R A;  2Z1U A;  3HKD A;  5LYJ A;  2YYE A;  1W2B F;  1K73 H;  1TVK B;  3VYS C;  1SDS A;  3WXM B;  3M84 A;  4U3J B;  5CA1 A;  2V9Y A;  5GIN C;  3K0T A;  3N2G A;  2VAP A;  3JAM M;  5EB0 A;  1VQK F;  1OFU A;  2RHL A;  3I55 F;  5LXT A;  2LBX A;  2K1S A;  4O4I B;  4YJ3 A;  4BT2 A;  2ZVZ A;  5GIP C;  1VH8 A;  4LNU A;  4B45 A;  3KIZ A;  1ODE A;  4EB6 A;  2CHS A;  5LOV A;  4C82 A;  2CHT A;  1NMU B;  1YJ9 F;  5GAN K;  1U40 A;  2AIZ P;  4I4T B;  3F0E A;  1VQN F;  1R1M A;  3CCE F;  1QAH A;  4X20 B;  1K8A H;  5EIB C;  1VHA A;  4G4X A;  2HRY A;  4BVT A;  1KNJ A;  2KTV A;  3JAT B;  3I7T A;  3FFM A;  3CC2 F;  4E6E A;  3V7E A;  5JVD A;  2W8B C;  2DT4 A;  5EYP A;  2GLZ A;  3WPW A;  5G4V C;  2IQQ A;  5FLX M;  4ZOL A;  3M4S A;  3WGM A;  3Q8H A;  3HKD B;  1W5A A;  3IR9 A;  4B62 A;  1U3L A;  4O2A A;  2UYK A;  5CA1 B;  3UT5 A;  5MN6 A;  2ZVY A;  1DT9 A;  3N2G B;  5LA6 B;  3HTN A;  3E22 A;  3ZP7 A;  5LXT B;  3CCS F;  4YJ3 B;  3S0Y A;  3E20 B;  2Z1F A;  3IKF A;  3NK7 A;  1VQV A;  3FD6 A;  4NWO B;  3P0Z A;  4LNU B;  2JNB A;  3RA5 A;  4B5C A;  4C8G A;  5A2Q M;  4EB6 B;  3PLA C;  3IEQ A;  5LOV B;  1VQL F;  5BMV A;  3HKB A;  3VOA A;  4WBN A;  2YXZ A;  3J80 M;  3NVK E;  3VI6 A;  3C8L A;  2WAL A;  3NK6 A;  1S72 F;  2RHO A;  5ITZ A;  3CC7 F;  3P10 A;  3LDT A;  2VGN A;  2BTU A;  3VYT C;  2NMU A;  2MQE A;  5JVD B;  4EI8 A;  4ZHV A;  3S06 A;  1VQ7 F;  2OHW A;  5CB4 A;  5EYP B;  3N2K A;  1DBF A;  2VXY A;  5MN4 A;  3CCR F;  3JAK A;  4O4H B;  1JN1 A;  3D54 A;  1JJ2 F;  4ZOL B;  1RLU A;  3F0F A;  3RYI A;  3N4Z A;  3WJP A;  2QTP A;  3HWU A;  1QU9 A;  1VK3 A;  3FBA A;  2RHH A;  1X7O A;  4RQO A;  4O2A B;  1OAP A;  4TUY A;  3UT5 B;  3J81 M;  3HJW C;  5JQG A;  3E22 B;  3V4D A;  3WPX A;  1IPA A;  1XHO A;  3CPQ A;  3K14 A;  5HXU A;  1PXW A;  4M8I A;  1U43 A;  3E1Y A;  4O4L A;  1RLG A;  1W59 A;  5BMV B;  3HKB B;  2KG4 A;  4WBN B;  3C9U A;  1W57 A;  2I6R A;  1YJN F;  1Q7Y H;  3CMA F;  2RHJ A;  4TV9 A;  5ITZ B;  1H7M A;  2B33 A;  3K12 A;  5HP8 A;  3JVH A;  2H8C A;  4HNA A;  5IJ0 A;  3ZO8 A;  1FFX A;  4C81 A;  4YJ2 A;  4BVS A;  2DYY A;  3LME A;  3LWR C;  5CB4 B;  3M1X A;  3N2K B;  3RE3 A;  3CD6 F;  3JAK B;  3MDO A;  4C4W C;  3QUW A;  5IJ9 A;  2R75 1;  3CG6 A;  3OBY A;  3G4S F;  1GO1 A;  3RYI B;  2UYN A;  1ZWZ A;  3K2X A;  3LFO A;  1VQP F;  5AVM A;  3RYC A;  3R0P A;  1VQO F;  4TUY B;  1PF5 A;  3ELC A;  1YI2 F;  4EI9 A;  4X3L A;  3F0D A;  2CZW A;  3LWO C;  5JQG B;  2HVY D;  5IYZ A;  3IMP A;  3CPW F;  3OBW A;  1KD1 H;  3LWV C;  1FNK A;  1E7K A;  2VAM A;  2Z1T A;  1JD1 A;  3OW2 F;  2ZF8 A;  5DCV A;  4DRX B;  4BT5 A;  3CB2 A;  5GON A;  4O4L B;  3S03 A;  1FSZ A;  3S0W A;  3JAS A;  3GTZ A;  3KJJ A;  3HAX D;  4X1K A;  5LA6 A;  3JAL B;  3VIU A;  2Q1X A;  1VQ9 F;  3WGJ A;  3NVI B;  4U39 A;  3JAR A;  5LYJ B;  5EZY A;  4O4J A;  1ONI A;  1RA4 A;  4TV9 B;  1GX1 A;  2IAF A;  5FJ4 C;  1UI9 A;  3G6E F;  4G88 A;  1Z5V A;  1X52 A;  4HNA B;  5IJ0 B;  1CLI A;  1FFX B;  4ZHQ A;  5KMG A;  3CCU F;  2KGW A;  4YJ2 B;  2QEX F;  3CYP B;  5HY1 A;  2CVL A;  2FC3 A;  4C8I A;  1N8R H;  2H8E A;  3CCM F;  1FNJ A;  3MCQ A;  3F6M A;  5IJ9 B;  3S02 A;  3CME F;  1YIT F;  1Q81 H;  2UZH A;  5LP6 C;  3NMU C;  3KJK A;  2UYN B;  2Z01 A;  3RYC B;  3L7Q A;  3P4E A;  4O2B A;  1W58 1;  2OZB A;  3ESJ A;  1QVG F;  4ZI7 A;  1NJI H;  5IYZ B;  5C8Y A;  3GHZ A;  3LYB A;  3I56 F;  3T80 A;  4IHJ A;  5KX5 A;  4FFB A;  4F6R A;  4ZK7 A;  1H47 A;  4XCQ A;  1COM A;  3N4Y A;  5GON B;  3TD3 A;  3CCJ F;  2LBW A;  3ZP4 A;  5HXZ A;  2AIF A;  4EI7 A;  3JAS B;  1YGY A;  5HY0 A;  3WGN A;  4X1K B;  3EOR A; 
#chains in the Genus database with same CATH homology
 2UYN B;  5HP7 A;  2IG8 A;  1QU9 A;  1QAH A;  1XRG A;  3MQW A;  3L7Q A;  3I3F A;  3R0P A;  1ONI A;  1QD9 A;  1J7H A;  2CSL A;  2UYK A;  3ZOP A;  1PF5 A;  3K0T A;  2B33 A;  2UYJ A;  1X25 A;  1UI9 A;  3D01 A;  3I7T A;  2CW4 A;  3ZP7 A;  3K12 A;  5HP8 A;  1FNK A;  3V4D A;  3KJK A;  1XHO A;  3LYB A;  3ZO8 A;  1JD1 A;  4NWO B;  2DYY A;  3LME A;  4ZK7 A;  3M1X A;  1ODE A;  1COM A;  2CVL A;  1DBF A;  2CHS A;  3VCZ A;  1FNJ A;  3ZP4 A;  3QUW A;  2CHT A;  2CWJ A;  2OTM A;  1UFY A;  3GTZ A;  2EWC A;  3KJJ A;  2UYP A;  1NQ3 A;  3M4S A;  2UYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...