3ZP7A

Arg90cit chorismate mutase of bacillus subtilis in complex with chorismate and prephenate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
116
Chain Sequence
b'MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
molecule tags Isomerase
source organism Bacillus subtilis
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
total genus 31
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zp7A00
3ZOPA 4NWOB 3GTZA 3K0TA 2CHTA 3QUWA 3ZO8A 1COMA 2UYKA 5HP8A 2EWCA 3I3FA 2CHSA 1QD9A 3LYBA 2DYYA 3K12A 2IG8A 1QU9A 1FNKA 1UFYA 1X25A 1ODEA 3L7QA 2CW4A 1ONIA 1DBFA 3KJKA 2CVLA 1XHOA 2CSLA 3KJJA 5HP7A 3MQWA 2UYNB 1XRGA 1NQ3A 3ZP7A 1FNJA 1J7HA 3VCZA 2UYNA 1UI9A 1QAHA 2UYJA 2UYPA 3M4SA 4ZK7A 2OTMA 2CWJA 3V4DA 2B33A 3D01A 1JD1A 3LMEA 3ZP4A 3M1XA 1PF5A 3R0PA 3I7TA
chains in the Genus database with same CATH superfamily
3T80A 3K0TA 1K73H 1N8RH 3HKBB 3WGLA 1U3PA 2IQQA 3LWQC 5JQGB 4B62A 1OFUA 5HY4A 3BYQA 3F0GA 3CB2A 2Q1XA 3WXMB 3JATA 3IEQA 3CXCF 5J2TA 3EORA 2DT4A 3CMAF 2UYJA 4TV9B 1W5BA 4X1IB 5DCVA 3D01A 2I6RA 3HKEB 4BT5A 5HXZA 4ZOLA 4YJ3A 2CHTA 5IJ0A 3MCAB 2LBTA 1VHAA 5IJ0B 3LWRC 1Z5VA 1W42A 2BTOA 3JASB 3CG6A 3B6NA 4RHAA 3WGKA 4X3MA 3CPQA 1QD9A 3HKEA 3KIZA 3LYBA 4LNUA 4BT2A 3ESJA 1QU9A 3S0WA 4LCKA 4ZHYB 2CW4A 2QI2A 1SA0B 5HP7A 4XCQA 2H8EA 5IJ9B 5MN5A 2H8CA 1K9MH 1W5AA 5CA1B 3S0HA 3UT5B 5FNVA 1RQ2A 1TVKA 4X20A 5JH7A 3CCMF 3OBYA 4G4XA 5HWEA 2FGYA 1FFXB 4B5CA 5GINC 1JN1A 1RLGA 3C9RA 5GAPK 3G4SF 4C8IA 1COMA 2LBXA 5JVDA 5C8YA 3NMUC 1YGYA 3D54A 2VGNA 5JCOA 3LDTA 1ONIA 2UZHA 3CCSF 4IIJA 3JAMM 2IAFA 2ZOVA 4C82A 1VQNF 3RYHB 3CC4F 3CCLF 2R6R1 3FD6A 1CK2A 3CMEF 1Q86H 2KG4A 2RHOA 2HQSC 4ZHQB 1YJ9F 1CN7A 3QTYA 1KNKA 5EYPA 4FFBB 1TUBA 4NWOB 3SIVA 4C8EA 2L26A 4M8IA 4R40B 2N48A 4ZI7B 3JALB 1U40A 3CYPB 4WBNB 3E1YA 3CC2F 2BO1A 2JNBA 5CA0A 5LP6B 3VOAA 1XV2A 1T0AA 2AMTA 4HNAB 4U3JB 5CB4A 3JATB 1XBIA 3JAKA 3C8LA 3CD6F 1UI9A 1GX1A 3HAXD 1X52A 2ZF8A 2B33A 3CCRF 1KNJA 1JFFA 5JQGA 4IHJA 3K2XA 5EIBC 3ZOPA 3S02A 3HTNA 1RA4A 3JASA 1GO0A 1QVGF 4I55A 2PMPA 3C9SA 2QEXF 5LOVA 2ZVZA 4TUYA 1TVKB 1YI2F 3L7QA 1W41A 3F0FA 5IYZA 5JCOC 4X1IA 4BVQA 4BT3A 5EWRA 3IKEA 3RA6A 3VYUC 5GIOC 2KTUA 2UYNB 2ALEA 1VQ9F 1Q7YH 3VO8A 4TV8A 1OAPA 3RYIA 3FD5A 2UYPA 3V7EA 3DC2A 4WBNA 1H47A 4EB6B 4ZHWA 3V4DA 4BT4A 5J2UA 2AIZP 2R751 1PF5A 3RYCA 1VQPF 1S72F 1KC8H 2NMUA 5ITZA 4ZOLB 3E22A 1TUBB 2PHNA 5J2UB 4I4TA 1JFFB 5HY0A 4F6RB 5LA6B 4O4JA 4X20B 5HY2A 5JH7B 3MBMA 3P10A 1YJNF 2VAWA 3RYHA 1XRGA 2G9IA 5IJ9A 4BY9D 4U3JA 3O85A 5IT9M 3IR9A 2CWJA 4O4JB 5MN6A 4BVRA 1K8AH 5BMVB 2BTQB 3FPIA 3I55F 1W40A 5EZYA 2GVIA 3E20B 2CHSA 4YJ3B 5LYJB 1KD1H 3OONA 2V9YA 5FNVB 2CZWA 2RHLA 4ERHA 5EAZA 3CPWF 1W2BF 1J7HA 1W59A 3LFOA 4O2AA 4TZZA 1SA0A 5CA0B 5LP6A 1ZWZA 2YXZA 4BT6A 1Q8RA 3ZP4A 1IPAA 4TUYB 1Q82H 2HRUA 3F0DA 3N2GA 3VIUA 4YJ2A 3N2GB 3HWUA 3CCEF 2QA4F 1JY8A 3MDOA 2DYYA 2GZLA 1IV1A 2IG8A 2Z1EA 4G88A 4DXDA 5GONA 1FSZA 1YJWF 2HS3A 5EB1B 2WALA 3J80M 3IMPA 1KQSF 1SZQA 1QAHA 4EI8A 2ZODA 5B8FA 1RLUA 5A2QM 5KX5A 2KGWA 3KHNA 3P4EA 1GZ0A 2HS0A 3LMEA 5LA6A 4I4TB 4I50A 3VMFB 1VQ8F 5HP8A 4BVSA 3TD4A 4O4IB 2EWCA 2Z01A 4BVTA 3ELCA 4B45A 3S03A 2VAMA 2OHWA 1UFYA 3WJQA 3VOBA 2MQEA 4TV9A 3NK7A 2HX0A 3HKDA 3VTIC 4O2AB 2UYNA 2FC3A 5LP6C 1DT9A 3OW2F 5MN4A 4LNUB 2VXYA 1NMUB 3M1XA 2QTPA 4O2BA 1W55A 3NVKE 1W5FA 4DRXA 5ITZB 4DRXB 3N4ZA 3JCMM 2F9ZC 1FFXA 1RQ7A 3JARA 3KJKA 3RYIB 5J2TB 2CSLA 1X7PA 3GYQA 3N2KA 2H6LA 4KWEA 3J81M 3P0ZA 3U0OA 3CC7F 1QVFF 3PLAC 2RB9A 4B46A 2OTMA 1Z5WA 5GONB 3FFMA 5C8YB 3WGNA 1VK3A 1U43A 3KE1A 2ZVYA 3QUWA 2Z1UA 5FJ4C 3I3FA 3VI6A 3HJWC 3S06A 3CYQA 3K12A 3ON1A 3K14A 2LCAA 1H48A 3TD3A 2ZAUA 1H7MA 3I56F 4X1YA 3N2KB 2RHHA 1VQ4F 2OTJF 3HKDB 3GHZA 3V7QA 3CCJF 3C9TA 3F6MA 4IIJB 1VQVA 3HKCB 4C81A 3F0EA 3WGMA 2OTLF 2GLZA 2HVYD 3I7TA 4G4WA 2VAPA 3CCQF 4YJ2B 3ZO8A 1M90H 3G71F 4O2BB 1Q81H 2Q1YA 2HP3A 5HXUA 5EZYB 3TD5A 4I50B 2BTUA 2RHJA 3AGKA 3CCVF 3G6EF 4BW0B 5G4VC 3UT5A 1FNJA 3J7AR 4E6EA 1IV2A 3D00A 4O4HB 3JARB 5KMGA 3WPXA 3JALA 1IV4A 3PAFA 1E7KA 3OBWA 1YHQF 1GO1A 5EYPB 3LWOC 2HP0A 3Q8HA 5FLXM 1DBFA 1YQNA 4EB6A 5GIPC 1XHOA 3KJJA 1VQ7F 1W57A 3RYFB 2LBWA 3VCZA 4HNAA 5CB4B 4BT7A 5AVMA 4C8GA 1R1MA 3V3TA 5IYZB 2HP0B 4C4WC 1JD1A 5LOVB 2P6YA 3DDNA 2W8BC 5JVDB 3JAWA 2UYKA 4X1KB 3HKBA 4FFBA 3NK6A 2HRYA 3IKFA 3M84A 3C9UA 1X25A 3RE3A 5KMGB 3S0YA 3HKCA 1YIJF 2AIFA 3RA5A 4EI9A 3QHDA 3SIUA 4TV8B 5EB0A 3MQWA 5GANK 3WJRA 3ZP7A 4G4ZA 2I6DA 3NVIB 3LWPC 4ZK7A 1YITF 1VQ5F 4ZHVA 1U3LA 4O4LB 1IV3A 2OZBA 5LYJA 4I55B 4O4IA 5G4UC 3GTZA 4ZI7A 4G4YA 4U39A 4EI7A 3JAWB 4X1KA 4X3LA 5EIBD 5EO3A 5BMVA 4IHJB 1NJIH 4O4LA 3RYCB 3CCUF 1X7OA 4O4HA 2Z1TA 1VQOF 3MCQA 5KX5B 2K1SA 2YYEA 5LXTB 1PXWA 1ODEA 3VYTC 2CVLA 2Z1FA 3JAKB 3LWVC 1NQ3A 3N4YA 4X1YB 4NUTA 3RYFA 2KTVA 1W5EA 3M4SA 4F6RA 2VGMA 5LXTA 1SDSA 3FBAA 4PWTA 3R0PA 1CLIA 3E22B 3WGJA 1M1KH 1VH8A 4ZHQA 3VYSC 1W581 3JVHA 1FNKA 3WPWA 1T0KB 3IEWA 5HY1A 1VQMF 5CA1A 4RQOA 4NQ3A 1VQ6F 1VQLF 1VQKF 4G4VA 3WJPA 2HS4A 1W3EX 1JJ2F 3ERNA
chains in the Genus database with same CATH topology
3ZOPA 4NWOB 3GTZA 3K0TA 2CHTA 3QUWA 3ZO8A 1COMA 2UYKA 5HP8A 2EWCA 3I3FA 2CHSA 1QD9A 3LYBA 2DYYA 3K12A 2IG8A 1QU9A 1FNKA 1UFYA 1X25A 1ODEA 3L7QA 2CW4A 1ONIA 1DBFA 3KJKA 2CVLA 1XHOA 2CSLA 3KJJA 5HP7A 3MQWA 2UYNB 1XRGA 1NQ3A 3ZP7A 1FNJA 1J7HA 3VCZA 2UYNA 1UI9A 1QAHA 2UYJA 2UYPA 3M4SA 4ZK7A 2OTMA 2CWJA 3V4DA 2B33A 3D01A 1JD1A 3LMEA 3ZP4A 3M1XA 1PF5A 3R0PA 3I7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOP A;  4NWO B;  3GTZ A;  3K0T A;  2CHT A;  3QUW A;  3ZO8 A;  1COM A;  2UYK A;  5HP8 A;  2EWC A;  3I3F A;  2CHS A;  1QD9 A;  3LYB A;  2DYY A;  3K12 A;  2IG8 A;  1QU9 A;  1FNK A;  1UFY A;  1X25 A;  1ODE A;  3L7Q A;  2CW4 A;  1ONI A;  1DBF A;  3KJK A;  2CVL A;  1XHO A;  2CSL A;  3KJJ A;  5HP7 A;  3MQW A;  2UYN B;  1XRG A;  1NQ3 A;  3ZP7 A;  1FNJ A;  1J7H A;  3VCZ A;  2UYN A;  1UI9 A;  1QAH A;  2UYJ A;  2UYP A;  3M4S A;  4ZK7 A;  2OTM A;  2CWJ A;  3V4D A;  2B33 A;  3D01 A;  1JD1 A;  3LME A;  3ZP4 A;  3M1X A;  1PF5 A;  3R0P A;  3I7T A; 
#chains in the Genus database with same CATH topology
 3T80 A;  3K0T A;  1K73 H;  1N8R H;  3HKB B;  3WGL A;  1U3P A;  2IQQ A;  3LWQ C;  5JQG B;  4B62 A;  1OFU A;  5HY4 A;  3BYQ A;  3F0G A;  3CB2 A;  2Q1X A;  3WXM B;  3JAT A;  3IEQ A;  3CXC F;  5J2T A;  3EOR A;  2DT4 A;  3CMA F;  2UYJ A;  4TV9 B;  1W5B A;  4X1I B;  5DCV A;  3D01 A;  2I6R A;  3HKE B;  4BT5 A;  5HXZ A;  4ZOL A;  4YJ3 A;  2CHT A;  5IJ0 A;  3MCA B;  2LBT A;  1VHA A;  5IJ0 B;  3LWR C;  1Z5V A;  1W42 A;  2BTO A;  3JAS B;  3CG6 A;  3B6N A;  4RHA A;  3WGK A;  4X3M A;  3CPQ A;  1QD9 A;  3HKE A;  3KIZ A;  3LYB A;  4LNU A;  4BT2 A;  3ESJ A;  1QU9 A;  3S0W A;  4LCK A;  4ZHY B;  2CW4 A;  2QI2 A;  1SA0 B;  5HP7 A;  4XCQ A;  2H8E A;  5IJ9 B;  5MN5 A;  2H8C A;  1K9M H;  1W5A A;  5CA1 B;  3S0H A;  3UT5 B;  5FNV A;  1RQ2 A;  1TVK A;  4X20 A;  5JH7 A;  3CCM F;  3OBY A;  4G4X A;  5HWE A;  2FGY A;  1FFX B;  4B5C A;  5GIN C;  1JN1 A;  1RLG A;  3C9R A;  5GAP K;  3G4S F;  4C8I A;  1COM A;  2LBX A;  5JVD A;  5C8Y A;  3NMU C;  1YGY A;  3D54 A;  2VGN A;  5JCO A;  3LDT A;  1ONI A;  2UZH A;  3CCS F;  4IIJ A;  3JAM M;  2IAF A;  2ZOV A;  4C82 A;  1VQN F;  3RYH B;  3CC4 F;  3CCL F;  2R6R 1;  3FD6 A;  1CK2 A;  3CME F;  1Q86 H;  2KG4 A;  2RHO A;  2HQS C;  4ZHQ B;  1YJ9 F;  1CN7 A;  3QTY A;  1KNK A;  5EYP A;  4FFB B;  1TUB A;  4NWO B;  3SIV A;  4C8E A;  2L26 A;  4M8I A;  4R40 B;  2N48 A;  4ZI7 B;  3JAL B;  1U40 A;  3CYP B;  4WBN B;  3E1Y A;  3CC2 F;  2BO1 A;  2JNB A;  5CA0 A;  5LP6 B;  3VOA A;  1XV2 A;  1T0A A;  2AMT A;  4HNA B;  4U3J B;  5CB4 A;  3JAT B;  1XBI A;  3JAK A;  3C8L A;  3CD6 F;  1UI9 A;  1GX1 A;  3HAX D;  1X52 A;  2ZF8 A;  2B33 A;  3CCR F;  1KNJ A;  1JFF A;  5JQG A;  4IHJ A;  3K2X A;  5EIB C;  3ZOP A;  3S02 A;  3HTN A;  1RA4 A;  3JAS A;  1GO0 A;  1QVG F;  4I55 A;  2PMP A;  3C9S A;  2QEX F;  5LOV A;  2ZVZ A;  4TUY A;  1TVK B;  1YI2 F;  3L7Q A;  1W41 A;  3F0F A;  5IYZ A;  5JCO C;  4X1I A;  4BVQ A;  4BT3 A;  5EWR A;  3IKE A;  3RA6 A;  3VYU C;  5GIO C;  2KTU A;  2UYN B;  2ALE A;  1VQ9 F;  1Q7Y H;  3VO8 A;  4TV8 A;  1OAP A;  3RYI A;  3FD5 A;  2UYP A;  3V7E A;  3DC2 A;  4WBN A;  1H47 A;  4EB6 B;  4ZHW A;  3V4D A;  4BT4 A;  5J2U A;  2AIZ P;  2R75 1;  1PF5 A;  3RYC A;  1VQP F;  1S72 F;  1KC8 H;  2NMU A;  5ITZ A;  4ZOL B;  3E22 A;  1TUB B;  2PHN A;  5J2U B;  4I4T A;  1JFF B;  5HY0 A;  4F6R B;  5LA6 B;  4O4J A;  4X20 B;  5HY2 A;  5JH7 B;  3MBM A;  3P10 A;  1YJN F;  2VAW A;  3RYH A;  1XRG A;  2G9I A;  5IJ9 A;  4BY9 D;  4U3J A;  3O85 A;  5IT9 M;  3IR9 A;  2CWJ A;  4O4J B;  5MN6 A;  4BVR A;  1K8A H;  5BMV B;  2BTQ B;  3FPI A;  3I55 F;  1W40 A;  5EZY A;  2GVI A;  3E20 B;  2CHS A;  4YJ3 B;  5LYJ B;  1KD1 H;  3OON A;  2V9Y A;  5FNV B;  2CZW A;  2RHL A;  4ERH A;  5EAZ A;  3CPW F;  1W2B F;  1J7H A;  1W59 A;  3LFO A;  4O2A A;  4TZZ A;  1SA0 A;  5CA0 B;  5LP6 A;  1ZWZ A;  2YXZ A;  4BT6 A;  1Q8R A;  3ZP4 A;  1IPA A;  4TUY B;  1Q82 H;  2HRU A;  3F0D A;  3N2G A;  3VIU A;  4YJ2 A;  3N2G B;  3HWU A;  3CCE F;  2QA4 F;  1JY8 A;  3MDO A;  2DYY A;  2GZL A;  1IV1 A;  2IG8 A;  2Z1E A;  4G88 A;  4DXD A;  5GON A;  1FSZ A;  1YJW F;  2HS3 A;  5EB1 B;  2WAL A;  3J80 M;  3IMP A;  1KQS F;  1SZQ A;  1QAH A;  4EI8 A;  2ZOD A;  5B8F A;  1RLU A;  5A2Q M;  5KX5 A;  2KGW A;  3KHN A;  3P4E A;  1GZ0 A;  2HS0 A;  3LME A;  5LA6 A;  4I4T B;  4I50 A;  3VMF B;  1VQ8 F;  5HP8 A;  4BVS A;  3TD4 A;  4O4I B;  2EWC A;  2Z01 A;  4BVT A;  3ELC A;  4B45 A;  3S03 A;  2VAM A;  2OHW A;  1UFY A;  3WJQ A;  3VOB A;  2MQE A;  4TV9 A;  3NK7 A;  2HX0 A;  3HKD A;  3VTI C;  4O2A B;  2UYN A;  2FC3 A;  5LP6 C;  1DT9 A;  3OW2 F;  5MN4 A;  4LNU B;  2VXY A;  1NMU B;  3M1X A;  2QTP A;  4O2B A;  1W55 A;  3NVK E;  1W5F A;  4DRX A;  5ITZ B;  4DRX B;  3N4Z A;  3JCM M;  2F9Z C;  1FFX A;  1RQ7 A;  3JAR A;  3KJK A;  3RYI B;  5J2T B;  2CSL A;  1X7P A;  3GYQ A;  3N2K A;  2H6L A;  4KWE A;  3J81 M;  3P0Z A;  3U0O A;  3CC7 F;  1QVF F;  3PLA C;  2RB9 A;  4B46 A;  2OTM A;  1Z5W A;  5GON B;  3FFM A;  5C8Y B;  3WGN A;  1VK3 A;  1U43 A;  3KE1 A;  2ZVY A;  3QUW A;  2Z1U A;  5FJ4 C;  3I3F A;  3VI6 A;  3HJW C;  3S06 A;  3CYQ A;  3K12 A;  3ON1 A;  3K14 A;  2LCA A;  1H48 A;  3TD3 A;  2ZAU A;  1H7M A;  3I56 F;  4X1Y A;  3N2K B;  2RHH A;  1VQ4 F;  2OTJ F;  3HKD B;  3GHZ A;  3V7Q A;  3CCJ F;  3C9T A;  3F6M A;  4IIJ B;  1VQV A;  3HKC B;  4C81 A;  3F0E A;  3WGM A;  2OTL F;  2GLZ A;  2HVY D;  3I7T A;  4G4W A;  2VAP A;  3CCQ F;  4YJ2 B;  3ZO8 A;  1M90 H;  3G71 F;  4O2B B;  1Q81 H;  2Q1Y A;  2HP3 A;  5HXU A;  5EZY B;  3TD5 A;  4I50 B;  2BTU A;  2RHJ A;  3AGK A;  3CCV F;  3G6E F;  4BW0 B;  5G4V C;  3UT5 A;  1FNJ A;  3J7A R;  4E6E A;  1IV2 A;  3D00 A;  4O4H B;  3JAR B;  5KMG A;  3WPX A;  3JAL A;  1IV4 A;  3PAF A;  1E7K A;  3OBW A;  1YHQ F;  1GO1 A;  5EYP B;  3LWO C;  2HP0 A;  3Q8H A;  5FLX M;  1DBF A;  1YQN A;  4EB6 A;  5GIP C;  1XHO A;  3KJJ A;  1VQ7 F;  1W57 A;  3RYF B;  2LBW A;  3VCZ A;  4HNA A;  5CB4 B;  4BT7 A;  5AVM A;  4C8G A;  1R1M A;  3V3T A;  5IYZ B;  2HP0 B;  4C4W C;  1JD1 A;  5LOV B;  2P6Y A;  3DDN A;  2W8B C;  5JVD B;  3JAW A;  2UYK A;  4X1K B;  3HKB A;  4FFB A;  3NK6 A;  2HRY A;  3IKF A;  3M84 A;  3C9U A;  1X25 A;  3RE3 A;  5KMG B;  3S0Y A;  3HKC A;  1YIJ F;  2AIF A;  3RA5 A;  4EI9 A;  3QHD A;  3SIU A;  4TV8 B;  5EB0 A;  3MQW A;  5GAN K;  3WJR A;  3ZP7 A;  4G4Z A;  2I6D A;  3NVI B;  3LWP C;  4ZK7 A;  1YIT F;  1VQ5 F;  4ZHV A;  1U3L A;  4O4L B;  1IV3 A;  2OZB A;  5LYJ A;  4I55 B;  4O4I A;  5G4U C;  3GTZ A;  4ZI7 A;  4G4Y A;  4U39 A;  4EI7 A;  3JAW B;  4X1K A;  4X3L A;  5EIB D;  5EO3 A;  5BMV A;  4IHJ B;  1NJI H;  4O4L A;  3RYC B;  3CCU F;  1X7O A;  4O4H A;  2Z1T A;  1VQO F;  3MCQ A;  5KX5 B;  2K1S A;  2YYE A;  5LXT B;  1PXW A;  1ODE A;  3VYT C;  2CVL A;  2Z1F A;  3JAK B;  3LWV C;  1NQ3 A;  3N4Y A;  4X1Y B;  4NUT A;  3RYF A;  2KTV A;  1W5E A;  3M4S A;  4F6R A;  2VGM A;  5LXT A;  1SDS A;  3FBA A;  4PWT A;  3R0P A;  1CLI A;  3E22 B;  3WGJ A;  1M1K H;  1VH8 A;  4ZHQ A;  3VYS C;  1W58 1;  3JVH A;  1FNK A;  3WPW A;  1T0K B;  3IEW A;  5HY1 A;  1VQM F;  5CA1 A;  4RQO A;  4NQ3 A;  1VQ6 F;  1VQL F;  1VQK F;  4G4V A;  3WJP A;  2HS4 A;  1W3E X;  1JJ2 F;  3ERN A; 
#chains in the Genus database with same CATH homology
 3ZOP A;  4NWO B;  3GTZ A;  3K0T A;  2CHT A;  3QUW A;  3ZO8 A;  1COM A;  2UYK A;  5HP8 A;  2EWC A;  3I3F A;  2CHS A;  1QD9 A;  3LYB A;  2DYY A;  3K12 A;  2IG8 A;  1QU9 A;  1FNK A;  1UFY A;  1X25 A;  1ODE A;  3L7Q A;  2CW4 A;  1ONI A;  1DBF A;  3KJK A;  2CVL A;  1XHO A;  2CSL A;  3KJJ A;  5HP7 A;  3MQW A;  2UYN B;  1XRG A;  1NQ3 A;  3ZP7 A;  1FNJ A;  1J7H A;  3VCZ A;  2UYN A;  1UI9 A;  1QAH A;  2UYJ A;  2UYP A;  3M4S A;  4ZK7 A;  2OTM A;  2CWJ A;  3V4D A;  2B33 A;  3D01 A;  1JD1 A;  3LME A;  3ZP4 A;  3M1X A;  1PF5 A;  3R0P A;  3I7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...