3ZP7A

Arg90cit chorismate mutase of bacillus subtilis in complex with chorismate and prephenate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
116
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 31
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zp7A00
2CWJA 2B33A 2UYJA 3M4SA 1XRGA 2DYYA 3K0TA 3ZP7A 1PF5A 2UYNB 3I7TA 1COMA 3LMEA 3D01A 1JD1A 2CVLA 3LYBA 3M1XA 2CHSA 3ZP4A 3K12A 3R0PA 3MQWA 2CW4A 2UYPA 4NWOB 3ZOPA 3ZO8A 1FNKA 4ZK7A 1XHOA 3L7QA 2OTMA 1UFYA 3V4DA 2EWCA 1QU9A 2IG8A 2CSLA 2CHTA 2UYNA 1UI9A 1DBFA 3I3FA 3GTZA 5HP8A 1FNJA 1ODEA 2UYKA 1QAHA 1QD9A 1J7HA 3QUWA 1NQ3A 1X25A 3VCZA 3KJJA 3KJKA 1ONIA 5HP7A
chains in the Genus database with same CATH superfamily
3PLAC 3AGKA 4ZOLB 3RYCA 4TV8B 5KX5A 2H6LA 3CCQF 2LBTA 2QA4F 5LOVB 2RHOA 3U0OA 3B6NA 4FFBA 1TVKA 2ZODA 5LA6B 1Z5WA 4I4TA 3WGKA 2KTVA 4G4YA 1VQ6F 2HRUA 3WPXA 3HJWC 4O4HA 1GX1A 2VAWA 2QTPA 3LDTA 3ZO8A 1RLGA 1KNJA 3VMFB 1QU9A 3E22B 3JARB 4BVTA 2HRYA 1J7HA 3P0ZA 5C8YB 3RE3A 3J7AR 5EAZA 2ZVYA 1YJNF 4X20B 4E6EA 4ERHA 4IHJA 1Q81H 3RYIB 5JQGA 5JVDB 2RHJA 3JAWB 3KIZA 3RYHA 5MN6A 2YXZA 1JD1A 2CVLA 3LYBA 3TD3A 2BTOA 3RYCB 1YJ9F 5KX5B 1W5FA 2WALA 3QTYA 3VOBA 3CCUF 2Z1FA 2CHTA 1TVKB 4FFBB 1QVFF 1DBFA 2BO1A 5DCVA 2BTUA 2MQEA 4O4HB 2PMPA 4O2AA 1U40A 2CZWA 4TZZA 3CG6A 3Q8HA 3V7QA 2ZVZA 3LWQC 1Q8RA 3VTIC 1VQLF 5HY0A 4IHJB 4YJ2A 1R1MA 4BVRA 3L7QA 1FFXA 1ZWZA 3VYUC 5JQGB 5GINC 3MCQA 3CCLF 3HKCA 4C8EA 1YQNA 2IQQA 2PHNA 3IR9A 2VAPA 3N2KA 3RYHB 5GANK 1VQNF 2Z1EA 3S0WA 5GAPK 1VQ4F 2FC3A 1VQ8F 2AIZP 3ZP7A 4LCKA 3LWOC 1W581 5EIBD 1XBIA 3SIVA 3CMEF 3WJPA 3LFOA 3C9TA 2OTLF 5EZYA 1KQSF 1JJ2F 4LNUA 3OBWA 4O2AB 3CCJF 4X3MA 3KE1A 1OFUA 3LWVC 4O2BA 1Q7YH 3F0FA 3O85A 3CCRF 2L26A 1VQ5F 2H8CA 3F6MA 1YGYA 4I55A 2HP3A 1CK2A 1NMUB 1H47A 2B33A 4YJ2B 4C4WC 1FFXB 3S0HA 1JN1A 3HKCB 3E20B 3CCVF 3GHZA 3N2KB 2YYEA 3JARA 3JALA 3C9RA 1VHAA 3E1YA 5C8YA 1XV2A 1GZ0A 1W5EA 1X7OA 1W59A 1X7PA 5EB1B 1SA0A 3JAWA 5EZYB 3G6EF 5LP6C 2ZAUA 5HP7A 1ONIA 4C81A 1M90H 2CWJA 5ITZA 2KG4A 3BYQA 1SDSA 1CLIA 4O2BB 2HS3A 5IJ0A 3LWRC 3GYQA 5JCOA 3HWUA 3N4ZA 3F0DA 4I55B 3F0GA 3C9UA 3MQWA 1VQPF 5IYZA 3ESJA 2FGYA 5HXZA 5HY2A 3JALB 4RHAA 1FNJA 3QUWA 1X25A 3KJJA 4NQ3A 2I6RA 1SZQA 2I6DA 1IPAA 3S06A 4RQOA 2IAFA 3LWPC 3MCAB 3CPWF 3PAFA 2G9IA 3NVIB 3NVKE 2ZOVA 5CB4A 1SA0B 4G4XA 1QVGF 5EWRA 1IV2A 3FBAA 3LMEA 1T0AA 3HAXD 4I50A 1N8RH 2KGWA 5J2TB 2GZLA 3JASA 5LYJA 5ITZB 3OONA 3RYFA 5IJ0B 5JH7A 2OTJF 2EWCA 3VOAA 1UI9A 3FD5A 2QEXF 1YI2F 2UYKA 1K73H 3JCMM 1GO0A 2HX0A 2DYYA 5IYZB 4KWEA 1PF5A 3VO8A 3D00A 4G88A 2ALEA 5G4VC 3FPIA 1VQKF 1VQ7F 1VQVA 5KMGA 1RQ7A 3K12A 3HKEB 4ZHWA 3IEQA 4HNAA 3IMPA 5EB0A 4DRXA 4BT6A 2HS0A 5MN5A 5CB4B 1KD1H 2UYNA 1VH8A 1K9MH 1IV3A 3I56F 3I3FA 3C8LA 3CXCF 1QD9A 3CYQA 4I50B 5B8FA 4C8GA 3JASB 5LYJB 3N4YA 5IJ9A 3ERNA 3RYFB 3M4SA 4XCQA 5JH7B 2NMUA 4BT3A 3S0YA 1Q86H 2AIFA 3HKDA 1W55A 3IKFA 5LP6B 1W5BA 2UYPA 2QI2A 4X1KA 2R6R1 4B62A 1YIJF 3DC2A 3K2XA 2VGNA 4X1YA 1GO1A 3ELCA 5MN4A 5KMGB 1KNKA 3CC7F 3J81M 4HNAB 2OHWA 2UYJA 4DRXB 2VXYA 1CN7A 1XRGA 4U3JA 4BW0B 3WJQA 2UYNB 1VQOF 3D01A 4O4IA 2CW4A 2RHHA 4DXDA 5IJ9B 1TUBA 1W5AA 1IV1A 5HY4A 4X1IA 3CC2F 3TD4A 1T0KB 4ZHQA 4BT7A 3GTZA 4C8IA 3HKDB 4EI9A 4BY9D 3T80A 4F6RA 3J80M 3VCZA 5HY1A 5J2UA 4ZI7A 1RQ2A 4G4VA 3CMAF 1E7KA 5J2TA 4G4WA 4X1KB 1H7MA 3WJRA 3I7TA 4YJ3A 4X1YB 2HP0A 3HKBB 3CPQA 4WBNA 1COMA 4O4JA 1NJIH 3ZOPA 5FJ4C 3CB2A 3IKEA 3P4EA 4TV9A 4U3JB 3JAMM 3WGLA 3JAKA 3M84A 4U39A 3CCMF 3VIUA 3K14A 4O4IB 5HWEA 3WGNA 3EORA 4B46A 2Q1XA 1IV4A 1TUBB 3HKEA 1K8AH 1Z5VA 1VK3A 4X1IB 4BVSA 1DT9A 1H48A 4ZHQB 4O4LA 5GONA 3VYSC 4F6RB 3M1XA 1VQ9F 3MDOA 3JATA 3ON1A 3D54A 3KHNA 2BTQB 5J2UB 5BMVA 3VYTC 4ZI7B 2H8EA 4IIJA 3WPWA 3MBMA 2OZBA 4YJ3B 1W40A 5FLXM 1X52A 2HP0B 3RA5A 4B5CA 5A2QM 3C9SA 4WBNB 4O4JB 1QAHA 1RLUA 2GLZA 5LP6A 3NMUC 2Q1YA 2DT4A 4M8IA 5FNVA 4TV9B 1FSZA 4BT5A 3JAKB 3VI6A 5EYPA 4G4ZA 1W41A 3CCSF 4EB6A 3SIUA 1JFFA 1W57A 2F9ZC 3UT5A 2LBXA 4NWOB 3G71F 4C82A 3V3TA 3WGMA 2W8BC 1W2BF 3V4DA 2VAMA 5GIPC 3N2GA 4O4LB 3G4SF 4I4TB 5GONB 3JATB 5BMVB 1VQMF 4IIJB 5EIBC 1U43A 2UZHA 3P10A 5EO3A 1M1KH 2LCAA 3ZP4A 3HTNA 5CA1A 3CD6F 2CHSA 2P6YA 2HVYD 5CA0A 1RA4A 3NK6A 3WXMB 5FNVB 3OBYA 4TUYA 4ZK7A 1W3EX 2HS4A 5EYPB 3IEWA 1U3LA 2ZF8A 4X3LA 4EB6B 3HKBA 1JFFB 1NQ3A 3UT5B 1KC8H 2LBWA 5G4UC 2VGMA 3QHDA 3JVHA 5JCOC 5LXTA 3K0TA 2Z01A 5AVMA 2Z1TA 3N2GB 4B45A 2K1SA 3V7EA 3RA6A 3WGJA 2AMTA 3CC4F 3R0PA 5HXUA 5IT9M 2RB9A 2GVIA 1JY8A 3I55F 2JNBA 4ZOLA 1W42A 4TV8A 1XHOA 4ZHYB 2OTMA 1UFYA 5LOVA 2CSLA 1YHQF 1Q82H 5CA1B 3TD5A 5LA6A 4BVQA 3OW2F 2KTUA 4EI8A 3CYPB 5CA0B 1YITF 2Z1UA 2V9YA 1OAPA 4NUTA 4TUYB 3DDNA 3FD6A 2RHLA 3CCEF 4BT4A 3E22A 1YJWF 3S03A 4PWTA 1PXWA 2N48A 4X20A 4ZHVA 1S72F 1FNKA 4EI7A 4R40B 5LXTB 3NK7A 3S02A 3FFMA 3RYIA 5JVDA 2IG8A 2R751 5GIOC 4BT2A 1U3PA 5HP8A 1ODEA 4LNUB 3KJKA 3F0EA 2HQSC
chains in the Genus database with same CATH topology
2CWJA 2B33A 2UYJA 3M4SA 1XRGA 2DYYA 3K0TA 3ZP7A 1PF5A 2UYNB 3I7TA 1COMA 3LMEA 3D01A 1JD1A 2CVLA 3LYBA 3M1XA 2CHSA 3ZP4A 3K12A 3R0PA 3MQWA 2CW4A 2UYPA 4NWOB 3ZOPA 3ZO8A 1FNKA 4ZK7A 1XHOA 3L7QA 2OTMA 1UFYA 3V4DA 2EWCA 1QU9A 2IG8A 2CSLA 2CHTA 2UYNA 1UI9A 1DBFA 3I3FA 3GTZA 5HP8A 1FNJA 1ODEA 2UYKA 1QAHA 1QD9A 1J7HA 3QUWA 1NQ3A 1X25A 3VCZA 3KJJA 3KJKA 1ONIA 5HP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWJ A;  2B33 A;  2UYJ A;  3M4S A;  1XRG A;  2DYY A;  3K0T A;  3ZP7 A;  1PF5 A;  2UYN B;  3I7T A;  1COM A;  3LME A;  3D01 A;  1JD1 A;  2CVL A;  3LYB A;  3M1X A;  2CHS A;  3ZP4 A;  3K12 A;  3R0P A;  3MQW A;  2CW4 A;  2UYP A;  4NWO B;  3ZOP A;  3ZO8 A;  1FNK A;  4ZK7 A;  1XHO A;  3L7Q A;  2OTM A;  1UFY A;  3V4D A;  2EWC A;  1QU9 A;  2IG8 A;  2CSL A;  2CHT A;  2UYN A;  1UI9 A;  1DBF A;  3I3F A;  3GTZ A;  5HP8 A;  1FNJ A;  1ODE A;  2UYK A;  1QAH A;  1QD9 A;  1J7H A;  3QUW A;  1NQ3 A;  1X25 A;  3VCZ A;  3KJJ A;  3KJK A;  1ONI A;  5HP7 A; 
#chains in the Genus database with same CATH topology
 3PLA C;  3AGK A;  4ZOL B;  3RYC A;  4TV8 B;  5KX5 A;  2H6L A;  3CCQ F;  2LBT A;  2QA4 F;  5LOV B;  2RHO A;  3U0O A;  3B6N A;  4FFB A;  1TVK A;  2ZOD A;  5LA6 B;  1Z5W A;  4I4T A;  3WGK A;  2KTV A;  4G4Y A;  1VQ6 F;  2HRU A;  3WPX A;  3HJW C;  4O4H A;  1GX1 A;  2VAW A;  2QTP A;  3LDT A;  3ZO8 A;  1RLG A;  1KNJ A;  3VMF B;  1QU9 A;  3E22 B;  3JAR B;  4BVT A;  2HRY A;  1J7H A;  3P0Z A;  5C8Y B;  3RE3 A;  3J7A R;  5EAZ A;  2ZVY A;  1YJN F;  4X20 B;  4E6E A;  4ERH A;  4IHJ A;  1Q81 H;  3RYI B;  5JQG A;  5JVD B;  2RHJ A;  3JAW B;  3KIZ A;  3RYH A;  5MN6 A;  2YXZ A;  1JD1 A;  2CVL A;  3LYB A;  3TD3 A;  2BTO A;  3RYC B;  1YJ9 F;  5KX5 B;  1W5F A;  2WAL A;  3QTY A;  3VOB A;  3CCU F;  2Z1F A;  2CHT A;  1TVK B;  4FFB B;  1QVF F;  1DBF A;  2BO1 A;  5DCV A;  2BTU A;  2MQE A;  4O4H B;  2PMP A;  4O2A A;  1U40 A;  2CZW A;  4TZZ A;  3CG6 A;  3Q8H A;  3V7Q A;  2ZVZ A;  3LWQ C;  1Q8R A;  3VTI C;  1VQL F;  5HY0 A;  4IHJ B;  4YJ2 A;  1R1M A;  4BVR A;  3L7Q A;  1FFX A;  1ZWZ A;  3VYU C;  5JQG B;  5GIN C;  3MCQ A;  3CCL F;  3HKC A;  4C8E A;  1YQN A;  2IQQ A;  2PHN A;  3IR9 A;  2VAP A;  3N2K A;  3RYH B;  5GAN K;  1VQN F;  2Z1E A;  3S0W A;  5GAP K;  1VQ4 F;  2FC3 A;  1VQ8 F;  2AIZ P;  3ZP7 A;  4LCK A;  3LWO C;  1W58 1;  5EIB D;  1XBI A;  3SIV A;  3CME F;  3WJP A;  3LFO A;  3C9T A;  2OTL F;  5EZY A;  1KQS F;  1JJ2 F;  4LNU A;  3OBW A;  4O2A B;  3CCJ F;  4X3M A;  3KE1 A;  1OFU A;  3LWV C;  4O2B A;  1Q7Y H;  3F0F A;  3O85 A;  3CCR F;  2L26 A;  1VQ5 F;  2H8C A;  3F6M A;  1YGY A;  4I55 A;  2HP3 A;  1CK2 A;  1NMU B;  1H47 A;  2B33 A;  4YJ2 B;  4C4W C;  1FFX B;  3S0H A;  1JN1 A;  3HKC B;  3E20 B;  3CCV F;  3GHZ A;  3N2K B;  2YYE A;  3JAR A;  3JAL A;  3C9R A;  1VHA A;  3E1Y A;  5C8Y A;  1XV2 A;  1GZ0 A;  1W5E A;  1X7O A;  1W59 A;  1X7P A;  5EB1 B;  1SA0 A;  3JAW A;  5EZY B;  3G6E F;  5LP6 C;  2ZAU A;  5HP7 A;  1ONI A;  4C81 A;  1M90 H;  2CWJ A;  5ITZ A;  2KG4 A;  3BYQ A;  1SDS A;  1CLI A;  4O2B B;  2HS3 A;  5IJ0 A;  3LWR C;  3GYQ A;  5JCO A;  3HWU A;  3N4Z A;  3F0D A;  4I55 B;  3F0G A;  3C9U A;  3MQW A;  1VQP F;  5IYZ A;  3ESJ A;  2FGY A;  5HXZ A;  5HY2 A;  3JAL B;  4RHA A;  1FNJ A;  3QUW A;  1X25 A;  3KJJ A;  4NQ3 A;  2I6R A;  1SZQ A;  2I6D A;  1IPA A;  3S06 A;  4RQO A;  2IAF A;  3LWP C;  3MCA B;  3CPW F;  3PAF A;  2G9I A;  3NVI B;  3NVK E;  2ZOV A;  5CB4 A;  1SA0 B;  4G4X A;  1QVG F;  5EWR A;  1IV2 A;  3FBA A;  3LME A;  1T0A A;  3HAX D;  4I50 A;  1N8R H;  2KGW A;  5J2T B;  2GZL A;  3JAS A;  5LYJ A;  5ITZ B;  3OON A;  3RYF A;  5IJ0 B;  5JH7 A;  2OTJ F;  2EWC A;  3VOA A;  1UI9 A;  3FD5 A;  2QEX F;  1YI2 F;  2UYK A;  1K73 H;  3JCM M;  1GO0 A;  2HX0 A;  2DYY A;  5IYZ B;  4KWE A;  1PF5 A;  3VO8 A;  3D00 A;  4G88 A;  2ALE A;  5G4V C;  3FPI A;  1VQK F;  1VQ7 F;  1VQV A;  5KMG A;  1RQ7 A;  3K12 A;  3HKE B;  4ZHW A;  3IEQ A;  4HNA A;  3IMP A;  5EB0 A;  4DRX A;  4BT6 A;  2HS0 A;  5MN5 A;  5CB4 B;  1KD1 H;  2UYN A;  1VH8 A;  1K9M H;  1IV3 A;  3I56 F;  3I3F A;  3C8L A;  3CXC F;  1QD9 A;  3CYQ A;  4I50 B;  5B8F A;  4C8G A;  3JAS B;  5LYJ B;  3N4Y A;  5IJ9 A;  3ERN A;  3RYF B;  3M4S A;  4XCQ A;  5JH7 B;  2NMU A;  4BT3 A;  3S0Y A;  1Q86 H;  2AIF A;  3HKD A;  1W55 A;  3IKF A;  5LP6 B;  1W5B A;  2UYP A;  2QI2 A;  4X1K A;  2R6R 1;  4B62 A;  1YIJ F;  3DC2 A;  3K2X A;  2VGN A;  4X1Y A;  1GO1 A;  3ELC A;  5MN4 A;  5KMG B;  1KNK A;  3CC7 F;  3J81 M;  4HNA B;  2OHW A;  2UYJ A;  4DRX B;  2VXY A;  1CN7 A;  1XRG A;  4U3J A;  4BW0 B;  3WJQ A;  2UYN B;  1VQO F;  3D01 A;  4O4I A;  2CW4 A;  2RHH A;  4DXD A;  5IJ9 B;  1TUB A;  1W5A A;  1IV1 A;  5HY4 A;  4X1I A;  3CC2 F;  3TD4 A;  1T0K B;  4ZHQ A;  4BT7 A;  3GTZ A;  4C8I A;  3HKD B;  4EI9 A;  4BY9 D;  3T80 A;  4F6R A;  3J80 M;  3VCZ A;  5HY1 A;  5J2U A;  4ZI7 A;  1RQ2 A;  4G4V A;  3CMA F;  1E7K A;  5J2T A;  4G4W A;  4X1K B;  1H7M A;  3WJR A;  3I7T A;  4YJ3 A;  4X1Y B;  2HP0 A;  3HKB B;  3CPQ A;  4WBN A;  1COM A;  4O4J A;  1NJI H;  3ZOP A;  5FJ4 C;  3CB2 A;  3IKE A;  3P4E A;  4TV9 A;  4U3J B;  3JAM M;  3WGL A;  3JAK A;  3M84 A;  4U39 A;  3CCM F;  3VIU A;  3K14 A;  4O4I B;  5HWE A;  3WGN A;  3EOR A;  4B46 A;  2Q1X A;  1IV4 A;  1TUB B;  3HKE A;  1K8A H;  1Z5V A;  1VK3 A;  4X1I B;  4BVS A;  1DT9 A;  1H48 A;  4ZHQ B;  4O4L A;  5GON A;  3VYS C;  4F6R B;  3M1X A;  1VQ9 F;  3MDO A;  3JAT A;  3ON1 A;  3D54 A;  3KHN A;  2BTQ B;  5J2U B;  5BMV A;  3VYT C;  4ZI7 B;  2H8E A;  4IIJ A;  3WPW A;  3MBM A;  2OZB A;  4YJ3 B;  1W40 A;  5FLX M;  1X52 A;  2HP0 B;  3RA5 A;  4B5C A;  5A2Q M;  3C9S A;  4WBN B;  4O4J B;  1QAH A;  1RLU A;  2GLZ A;  5LP6 A;  3NMU C;  2Q1Y A;  2DT4 A;  4M8I A;  5FNV A;  4TV9 B;  1FSZ A;  4BT5 A;  3JAK B;  3VI6 A;  5EYP A;  4G4Z A;  1W41 A;  3CCS F;  4EB6 A;  3SIU A;  1JFF A;  1W57 A;  2F9Z C;  3UT5 A;  2LBX A;  4NWO B;  3G71 F;  4C82 A;  3V3T A;  3WGM A;  2W8B C;  1W2B F;  3V4D A;  2VAM A;  5GIP C;  3N2G A;  4O4L B;  3G4S F;  4I4T B;  5GON B;  3JAT B;  5BMV B;  1VQM F;  4IIJ B;  5EIB C;  1U43 A;  2UZH A;  3P10 A;  5EO3 A;  1M1K H;  2LCA A;  3ZP4 A;  3HTN A;  5CA1 A;  3CD6 F;  2CHS A;  2P6Y A;  2HVY D;  5CA0 A;  1RA4 A;  3NK6 A;  3WXM B;  5FNV B;  3OBY A;  4TUY A;  4ZK7 A;  1W3E X;  2HS4 A;  5EYP B;  3IEW A;  1U3L A;  2ZF8 A;  4X3L A;  4EB6 B;  3HKB A;  1JFF B;  1NQ3 A;  3UT5 B;  1KC8 H;  2LBW A;  5G4U C;  2VGM A;  3QHD A;  3JVH A;  5JCO C;  5LXT A;  3K0T A;  2Z01 A;  5AVM A;  2Z1T A;  3N2G B;  4B45 A;  2K1S A;  3V7E A;  3RA6 A;  3WGJ A;  2AMT A;  3CC4 F;  3R0P A;  5HXU A;  5IT9 M;  2RB9 A;  2GVI A;  1JY8 A;  3I55 F;  2JNB A;  4ZOL A;  1W42 A;  4TV8 A;  1XHO A;  4ZHY B;  2OTM A;  1UFY A;  5LOV A;  2CSL A;  1YHQ F;  1Q82 H;  5CA1 B;  3TD5 A;  5LA6 A;  4BVQ A;  3OW2 F;  2KTU A;  4EI8 A;  3CYP B;  5CA0 B;  1YIT F;  2Z1U A;  2V9Y A;  1OAP A;  4NUT A;  4TUY B;  3DDN A;  3FD6 A;  2RHL A;  3CCE F;  4BT4 A;  3E22 A;  1YJW F;  3S03 A;  4PWT A;  1PXW A;  2N48 A;  4X20 A;  4ZHV A;  1S72 F;  1FNK A;  4EI7 A;  4R40 B;  5LXT B;  3NK7 A;  3S02 A;  3FFM A;  3RYI A;  5JVD A;  2IG8 A;  2R75 1;  5GIO C;  4BT2 A;  1U3P A;  5HP8 A;  1ODE A;  4LNU B;  3KJK A;  3F0E A;  2HQS C; 
#chains in the Genus database with same CATH homology
 2CWJ A;  2B33 A;  2UYJ A;  3M4S A;  1XRG A;  2DYY A;  3K0T A;  3ZP7 A;  1PF5 A;  2UYN B;  3I7T A;  1COM A;  3LME A;  3D01 A;  1JD1 A;  2CVL A;  3LYB A;  3M1X A;  2CHS A;  3ZP4 A;  3K12 A;  3R0P A;  3MQW A;  2CW4 A;  2UYP A;  4NWO B;  3ZOP A;  3ZO8 A;  1FNK A;  4ZK7 A;  1XHO A;  3L7Q A;  2OTM A;  1UFY A;  3V4D A;  2EWC A;  1QU9 A;  2IG8 A;  2CSL A;  2CHT A;  2UYN A;  1UI9 A;  1DBF A;  3I3F A;  3GTZ A;  5HP8 A;  1FNJ A;  1ODE A;  2UYK A;  1QAH A;  1QD9 A;  1J7H A;  3QUW A;  1NQ3 A;  1X25 A;  3VCZ A;  3KJJ A;  3KJK A;  1ONI A;  5HP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...