2LBXA

Solution structure of the s. cerevisiae h/aca rnp protein nhp2p
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA ribonucleoprotein complex subunit 2
publication title Structure of H/ACA RNP Protein Nhp2p Reveals Cis/Trans Isomerization of a Conserved Proline at the RNA and Nop10 Binding Interface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 32
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2lbxA00
2WALA 1KD1H 4TZZA 5GANK 3CPQA 3OW2F 2HVYD 1YHQF 3LWQC 1ZWZA 2OTJF 2QI2A 4NUTA 5GINC 3CCJF 1VQNF 4LCKA 1Q86H 2AIFA 3CC7F 2LBWA 5EWRA 3CPWF 3CMEF 1NJIH 3CXCF 3J80M 2VGNA 3V7QA 1VQ4F 3G4SF 1VQ5F 3NVIB 2BO1A 1VQ9F 3NMUC 5FLXM 3G71F 1GZ0A 2JNBA 3PAFA 3I56F 4BY9D 3FFMA 1N8RH 1NMUB 3VI6A 3I55F 3NVKE 3HJWC 1SDSA 2QA4F 3CCSF 3SIUA 3LWPC 3CCEF 3GYQA 1W3EX 3V7EA 4BW0B 1YJWF 1X52A 1K9MH 1VQ8F 1DT9A 3VMFB 1QVFF 1W41A 1YITF 5FJ4C 2QEXF 1M90H 4X3LA 2VGMA 3E20B 3MCAB 3CC2F 1RLGA 1VQMF 1E7KA 1W2BF 3NK6A 5IT9M 1GO0A 3CMAF 3LFOA 3LWVC 1VQOF 3SIVA 1M1KH 3G6EF 1VQLF 1Q7YH 5DCVA 3ON1A 1W40A 1YJNF 2FC3A 1Q82H 2KTVA 3CG6A 3CCMF 2I6DA 3RA5A 1JJ2F 5EO3A 5A2QM 2OHWA 2KG4A 2ALEA 3RA6A 2CZWA 3JAMM 5G4UC 1YIJF 3OBWA 1W42A 3PLAC 3N4ZA 1XBIA 3CCRF 3HAXD 3LWRC 3NK7A 3CC4F 5GAPK 1GO1A 3JCMM 3J7AR 1K8AH 3WXMB 5GIPC 1VQ6F 3N4YA 1QVGF 2OTLF 2LBXA 3O85A 1H7MA 1CN7A 1KQSF 1CK2A 3J81M 3CCUF 3AGKA 1YJ9F 5GIOC 3CCLF 3OBYA 1X7PA 3IR9A 3CCVF 1KC8H 1T0KB 1RA4A 1K73H 2OZBA 3CD6F 1YI2F 2KTUA 3LWOC 1S72F 1PXWA 5G4VC 1X7OA 1VQ7F 1VQPF 3CCQF 4X3MA 3E1YA 1Q81H 4C4WC 1VQKF 1IPAA
chains in the Genus database with same CATH superfamily
2WALA 1KD1H 5LYJA 3WGNA 5LYJB 2HVYD 1RLUA 1YHQF 5LP6C 2OTJF 2VAPA 3V3TA 4NUTA 1VQNF 1Q86H 3JAWA 4KWEA 2AIFA 2EWCA 3JAWB 4F6RA 1W5FA 2I6RA 2Q1XA 2LBWA 3UT5A 3TD3A 1JFFA 1NJIH 2VGNA 3KJKA 2KGWA 3NVIB 2R751 2RHHA 3PAFA 3I56F 4BY9D 1W5BA 3VI6A 4ZHVA 2DT4A 1ONIA 5EB1B 3HJWC 1SDSA 2HQSC 2QA4F 2Z1TA 2DYYA 3V7EA 3HKCA 3HKEB 3HKCB 5JVDB 4BT2A 2Q1YA 1KNKA 1PF5A 3CYPB 3RYHA 1DT9A 3R0PA 2HS3A 4EI8A 1W55A 1JY8A 5AVMA 3S0YA 2QEXF 2CHSA 2NMUA 4G4ZA 2ZF8A 1H48A 4X1KB 3VYSC 3MQWA 4BVRA 2UYJA 3K14A 3VCZA 1JD1A 3QTYA 5HY0A 5DCVA 1W40A 2VXYA 4BT6A 2FC3A 5LP6A 5JQGA 5LP6B 4O2BA 4WBNA 5JQGB 1COMA 4O2BB 4WBNB 2ZAUA 4HNAA 4HNAB 4X1YA 5EO3A 2OTMA 5IJ9A 3GHZA 2W8BC 5GONA 5C8YA 5GONB 3IKEA 5C8YB 3N4ZA 2RHJA 1Z5VA 3CC4F 5GAPK 1NQ3A 5GIPC 3JAKB 3K2XA 2LBXA 3T80A 2VAMA 2UYNB 1KQSF 3VOAA 4O2AA 4O2AB 3CCLF 3P10A 1X7PA 3IR9A 1RA4A 3DC2A 1K73H 3I7TA 2LCAA 2ZODA 4EB6B 3ELCA 1J7HA 3WJPA 2LBTA 4ERHA 5CA0A 2YYEA 5CA0B 3L7QA 3F0FA 5GANK 2UYKA 3RYFA 1FFXA 3D01A 3RYFB 3N2GA 4LCKA 4ZHYB 3ERNA 3N2GB 3CC7F 1KNJA 1JN1A 1W5EA 3C8LA 3LMEA 1SZQA 2CW4A 5EWRA 4ZI7A 3TD5A 3CMEF 4ZI7B 3CXCF 2K1SA 5EB0A 1X25A 1VQ5F 3NMUC 5FLXM 1GZ0A 2B33A 3ZO8A 4TV8A 5B8FA 2RHOA 4TV8B 5HY2A 3LWPC 3LDTA 1R1MA 4RQOA 2Z1EA 5CB4A 4RHAA 3VMFB 4F6RB 3RYIA 1W41A 3RYIB 1QU9A 3UT5B 5J2TA 3JALA 4G4YA 3JALB 1JFFB 1U43A 3HTNA 1T0AA 1U40A 4X3LA 1YQNA 5KX5A 1VQVA 2VGMA 3E20B 2BTQB 2QTPA 3P0ZA 1GX1A 1VQMF 1E7KA 3NK6A 3CMAF 2P6YA 3LWVC 3KHNA 1VQOF 3SIVA 1OAPA 5HP8A 1VQLF 5CA1A 3ON1A 3FD6A 5CA1B 3F6MA 2PHNA 3F0EA 3MBMA 5MN5A 4EI7A 3CG6A 3N2KA 3N2KB 3RYHB 5A2QM 4I50A 2OHWA 3HWUA 1Z5WA 3VYTC 1YIJF 1XRGA 4E6EA 2F9ZC 3C9SA 1UI9A 3HAXD 1XHOA 3NK7A 3LWRC 3E22A 5KMGA 5FNVA 2Z1FA 3J7AR 5KMGB 4XCQA 5FNVB 2PMPA 1QVGF 3O85A 4C8GA 1IV1A 3ESJA 2Z01A 2ZVYA 1CK2A 4C8EA 3FPIA 1YJ9F 5EIBC 3CCVF 1KC8H 4X1YB 1VH8A 2L26A 1YI2F 1W59A 3Q8HA 3RYCA 1S72F 3RYCB 1PXWA 4BT5A 5IJ9B 5G4VC 1VQ7F 3S0WA 3FBAA 3M4SA 3LYBA 5HWEA 4G4VA 1Q81H 3CB2A 4C4WC 3F0DA 2VAWA 3U0OA 2GLZA 5LXTA 2FGYA 3WPXA 1ZWZA 2IQQA 3VO8A 2QI2A 5IYZA 5GINC 2GVIA 4ZHQA 3CCJF 5EAZA 3WGJA 3B6NA 3J80M 1Q8RA 4O4IA 3V7QA 5EYPA 4O4IB 5HY4A 5EYPB 4DXDA 1ODEA 2Z1UA 3G4SF 2V9YA 3IEQA 3G71F 3FFMA 4M8IA 3I3FA 5EZYA 3I55F 5EZYB 3NVKE 2N48A 1VHAA 3C9TA 3CCSF 4C8IA 2HX0A 3SIUA 3S0HA 3CCEF 1YGYA 3GYQA 3VOBA 4R40B 2RHLA 1FFXB 4BW0B 1X52A 1TVKA 3DDNA 1TVKB 4TUYA 5J2UA 5J2UB 3JASA 3VTIC 3JASB 5LOVA 5LOVB 1UFYA 1M90H 3HKDA 3WJQA 3HKDB 3CYQA 5JH7A 3MCAB 5HY1A 5JH7B 2H8CA 3CC2F 1RLGA 3WJRA 1W2BF 3IEWA 3LFOA 1M1KH 3P4EA 3G6EF 1CLIA 1Q7YH 2HRYA 4ZK7A 1Q82H 2KTVA 5CB4B 2HP0A 2I6DA 2HP0B 3QUWA 3RA5A 4B62A 2HS4A 1OFUA 3TD4A 2ALEA 4NQ3A 2CZWA 3RA6A 3GTZA 5J2TB 4YJ3A 3OBWA 5HXZA 3WGMA 5KX5B 3ZP4A 3CCRF 4U39A 4DRXA 1GO1A 3RE3A 3WPWA 4C81A 1K8AH 4ZOLA 3N4YA 4ZOLB 1H7MA 1CN7A 2IAFA 3J81M 2RB9A 3D54A 3CCUF 1VK3A 1FNKA 1TUBA 1TUBB 3HKBA 3OBYA 3HKBB 4ZHWA 2CVLA 3CD6F 5HXUA 2YXZA 2KTUA 4I50B 3MDOA 5MN6A 4O4JA 3LWOC 4O4JB 2H6LA 5EIBD 1VQPF 4X3MA 2G9IA 3JVHA 3S02A 3KE1A 4I4TA 4I4TB 1VQKF 4PWTA 3E22B 4LNUA 3IMPA 4YJ2A 3FD5A 4LNUB 4YJ2B 4TZZA 3CPQA 3OW2F 2BTUA 3LWQC 3HKEA 5JVDA 2CSLA 1H47A 4C82A 3WGKA 1XV2A 2HS0A 4BVQA 4BT7A 3C9RA 3CPWF 3ZP7A 5BMVA 5BMVB 1VQ4F 5HP7A 1U3LA 4U3JA 2BO1A 1VQ9F 1W581 2AIZP 4U3JB 2CHTA 2JNBA 4X1KA 1N8RH 1NMUB 1IV2A 5JCOA 3K12A 4TV9A 2HRUA 4TV9B 1W57A 1W3EX 2H8EA 4BVSA 5LXTB 3M1XA 1RQ7A 4B46A 5IYZB 1YJWF 1K9MH 2ZOVA 1VQ8F 4ZHQB 2R6R1 3D00A 4X1IA 3VYUC 1QVFF 2ZVZA 4X1IB 2BTOA 1YITF 5FJ4C 3MCQA 5ITZA 3JARA 5ITZB 3JARB 3QHDA 3WGLA 5MN4A 2CWJA 3JAKA 5IT9M 1GO0A 1IV4A 4G4WA 2UYNA 1FSZA 3JATA 3JATB 2GZLA 2IG8A 4BT3A 1QAHA 1YJNF 2AMTA 3CCMF 1JJ2F 4TUYB 4B45A 4EB6A 2MQEA 3ZOPA 2KG4A 1DBFA 2HP3A 3JAMM 4BT4A 2UYPA 5G4UC 4NWOB 3VIUA 1W42A 3PLAC 1RQ2A 1XBIA 3S06A 3JCMM 1W5AA 3V4DA 4O4LA 5IJ0A 3WXMB 4O4LB 5IJ0B 1VQ6F 2OTLF 3KIZA 3EORA 4EI9A 4B5CA 3OONA 4O4HA 4FFBA 4O4HB 4FFBB 3AGKA 3F0GA 5GIOC 1SA0A 1SA0B 1T0KB 3IKFA 3K0TA 3BYQA 2OZBA 4I55A 1IV3A 4I55B 2UZHA 1X7OA 4X20A 3KJJA 3CCQF 4X20B 5LA6A 3E1YA 4G88A 4YJ3B 5LA6B 4G4XA 1FNJA 3S03A 3C9UA 1QD9A 1U3PA 4BVTA 4IHJA 4IIJA 5JCOC 3M84A 4IHJB 4IIJB 1IPAA 4DRXB
chains in the Genus database with same CATH topology
2WALA 1KD1H 2GLZA 4TZZA 5GANK 3CPQA 3OW2F 2FGYA 2HVYD 1YHQF 3LWQC 1ZWZA 2OTJF 2QI2A 3V3TA 4NUTA 5GINC 3CCJF 1VQNF 4LCKA 1Q86H 2AIFA 3CC7F 4BVQA 2LBWA 5EWRA 3CPWF 3CMEF 1NJIH 3CXCF 3J80M 2VGNA 3V7QA 1VQ4F 5HY4A 3G4SF 1VQ5F 3NVIB 2BO1A 1VQ9F 3NMUC 5FLXM 3G71F 1GZ0A 2JNBA 3PAFA 3I56F 4BY9D 3FFMA 1N8RH 1NMUB 3VI6A 3I55F 5HY2A 3NVKE 3HJWC 1SDSA 2QA4F 3CCSF 3SIUA 3LWPC 3CCEF 3GYQA 1W3EX 4BVSA 3V7EA 4BW0B 1YJWF 1X52A 1K9MH 1VQ8F 1DT9A 3D00A 3VMFB 4EI8A 1QVFF 1W41A 1YITF 5FJ4C 2QEXF 1M90H 4X3LA 2VGMA 3E20B 3MCAB 5HY1A 3CC2F 1RLGA 4BVRA 1VQMF 1E7KA 1W2BF 3NK6A 5IT9M 1GO0A 3CMAF 3LFOA 3LWVC 1VQOF 3SIVA 1M1KH 3G6EF 5HY0A 1VQLF 1Q7YH 5DCVA 3ON1A 1W40A 1YJNF 2FC3A 1Q82H 2KTVA 4EI7A 3CG6A 3CCMF 2I6DA 3RA5A 1JJ2F 5EO3A 5A2QM 2OHWA 2KG4A 2ALEA 4NQ3A 2CZWA 3RA6A 3JAMM 5G4UC 1YIJF 3OBWA 5HXZA 1W42A 2F9ZC 3PLAC 3N4ZA 1XBIA 3CCRF 3HAXD 3LWRC 3NK7A 3CC4F 1GO1A 3JCMM 5GAPK 3J7AR 1K8AH 4XCQA 3WXMB 5GIPC 1VQ6F 3N4YA 1QVGF 2OTLF 2LBXA 3O85A 1H7MA 1CN7A 4EI9A 1KQSF 1CK2A 3J81M 3CCUF 3AGKA 1YJ9F 5GIOC 3CCLF 3OBYA 1X7PA 3IR9A 3CCVF 1KC8H 1T0KB 1RA4A 1K73H 2OZBA 3CD6F 5HXUA 1YI2F 2KTUA 3LWOC 1S72F 1PXWA 5G4VC 1X7OA 1VQ7F 1VQPF 3CCQF 4X3MA 5HWEA 3E1YA 1Q81H 4BVTA 4C4WC 1VQKF 1IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAL A;  1KD1 H;  4TZZ A;  5GAN K;  3CPQ A;  3OW2 F;  2HVY D;  1YHQ F;  3LWQ C;  1ZWZ A;  2OTJ F;  2QI2 A;  4NUT A;  5GIN C;  3CCJ F;  1VQN F;  4LCK A;  1Q86 H;  2AIF A;  3CC7 F;  2LBW A;  5EWR A;  3CPW F;  3CME F;  1NJI H;  3CXC F;  3J80 M;  2VGN A;  3V7Q A;  1VQ4 F;  3G4S F;  1VQ5 F;  3NVI B;  2BO1 A;  1VQ9 F;  3NMU C;  5FLX M;  3G71 F;  1GZ0 A;  2JNB A;  3PAF A;  3I56 F;  4BY9 D;  3FFM A;  1N8R H;  1NMU B;  3VI6 A;  3I55 F;  3NVK E;  3HJW C;  1SDS A;  2QA4 F;  3CCS F;  3SIU A;  3LWP C;  3CCE F;  3GYQ A;  1W3E X;  3V7E A;  4BW0 B;  1YJW F;  1X52 A;  1K9M H;  1VQ8 F;  1DT9 A;  3VMF B;  1QVF F;  1W41 A;  1YIT F;  5FJ4 C;  2QEX F;  1M90 H;  4X3L A;  2VGM A;  3E20 B;  3MCA B;  3CC2 F;  1RLG A;  1VQM F;  1E7K A;  1W2B F;  3NK6 A;  5IT9 M;  1GO0 A;  3CMA F;  3LFO A;  3LWV C;  1VQO F;  3SIV A;  1M1K H;  3G6E F;  1VQL F;  1Q7Y H;  5DCV A;  3ON1 A;  1W40 A;  1YJN F;  2FC3 A;  1Q82 H;  2KTV A;  3CG6 A;  3CCM F;  2I6D A;  3RA5 A;  1JJ2 F;  5EO3 A;  5A2Q M;  2OHW A;  2KG4 A;  2ALE A;  3RA6 A;  2CZW A;  3JAM M;  5G4U C;  1YIJ F;  3OBW A;  1W42 A;  3PLA C;  3N4Z A;  1XBI A;  3CCR F;  3HAX D;  3LWR C;  3NK7 A;  3CC4 F;  5GAP K;  1GO1 A;  3JCM M;  3J7A R;  1K8A H;  3WXM B;  5GIP C;  1VQ6 F;  3N4Y A;  1QVG F;  2OTL F;  2LBX A;  3O85 A;  1H7M A;  1CN7 A;  1KQS F;  1CK2 A;  3J81 M;  3CCU F;  3AGK A;  1YJ9 F;  5GIO C;  3CCL F;  3OBY A;  1X7P A;  3IR9 A;  3CCV F;  1KC8 H;  1T0K B;  1RA4 A;  1K73 H;  2OZB A;  3CD6 F;  1YI2 F;  2KTU A;  3LWO C;  1S72 F;  1PXW A;  5G4V C;  1X7O A;  1VQ7 F;  1VQP F;  3CCQ F;  4X3M A;  3E1Y A;  1Q81 H;  4C4W C;  1VQK F;  1IPA A; 
#chains in the Genus database with same CATH topology
 2WAL A;  1KD1 H;  5LYJ A;  3WGN A;  5LYJ B;  2HVY D;  1RLU A;  1YHQ F;  5LP6 C;  2OTJ F;  2VAP A;  3V3T A;  4NUT A;  1VQN F;  1Q86 H;  3JAW A;  4KWE A;  2AIF A;  2EWC A;  3JAW B;  4F6R A;  1W5F A;  2I6R A;  2Q1X A;  2LBW A;  3UT5 A;  3TD3 A;  1JFF A;  1NJI H;  2VGN A;  3KJK A;  2KGW A;  3NVI B;  2R75 1;  2RHH A;  3PAF A;  3I56 F;  4BY9 D;  1W5B A;  3VI6 A;  4ZHV A;  2DT4 A;  1ONI A;  5EB1 B;  3HJW C;  1SDS A;  2HQS C;  2QA4 F;  2Z1T A;  2DYY A;  3V7E A;  3HKC A;  3HKE B;  3HKC B;  5JVD B;  4BT2 A;  2Q1Y A;  1KNK A;  1PF5 A;  3CYP B;  3RYH A;  1DT9 A;  3R0P A;  2HS3 A;  4EI8 A;  1W55 A;  1JY8 A;  5AVM A;  3S0Y A;  2QEX F;  2CHS A;  2NMU A;  4G4Z A;  2ZF8 A;  1H48 A;  4X1K B;  3VYS C;  3MQW A;  4BVR A;  2UYJ A;  3K14 A;  3VCZ A;  1JD1 A;  3QTY A;  5HY0 A;  5DCV A;  1W40 A;  2VXY A;  4BT6 A;  2FC3 A;  5LP6 A;  5JQG A;  5LP6 B;  4O2B A;  4WBN A;  5JQG B;  1COM A;  4O2B B;  4WBN B;  2ZAU A;  4HNA A;  4HNA B;  4X1Y A;  5EO3 A;  2OTM A;  5IJ9 A;  3GHZ A;  2W8B C;  5GON A;  5C8Y A;  5GON B;  3IKE A;  5C8Y B;  3N4Z A;  2RHJ A;  1Z5V A;  3CC4 F;  5GAP K;  1NQ3 A;  5GIP C;  3JAK B;  3K2X A;  2LBX A;  3T80 A;  2VAM A;  2UYN B;  1KQS F;  3VOA A;  4O2A A;  4O2A B;  3CCL F;  3P10 A;  1X7P A;  3IR9 A;  1RA4 A;  3DC2 A;  1K73 H;  3I7T A;  2LCA A;  2ZOD A;  4EB6 B;  3ELC A;  1J7H A;  3WJP A;  2LBT A;  4ERH A;  5CA0 A;  2YYE A;  5CA0 B;  3L7Q A;  3F0F A;  5GAN K;  2UYK A;  3RYF A;  1FFX A;  3D01 A;  3RYF B;  3N2G A;  4LCK A;  4ZHY B;  3ERN A;  3N2G B;  3CC7 F;  1KNJ A;  1JN1 A;  1W5E A;  3C8L A;  3LME A;  1SZQ A;  2CW4 A;  5EWR A;  4ZI7 A;  3TD5 A;  3CME F;  4ZI7 B;  3CXC F;  2K1S A;  5EB0 A;  1X25 A;  1VQ5 F;  3NMU C;  5FLX M;  1GZ0 A;  2B33 A;  3ZO8 A;  4TV8 A;  5B8F A;  2RHO A;  4TV8 B;  5HY2 A;  3LWP C;  3LDT A;  1R1M A;  4RQO A;  2Z1E A;  5CB4 A;  4RHA A;  3VMF B;  4F6R B;  3RYI A;  1W41 A;  3RYI B;  1QU9 A;  3UT5 B;  5J2T A;  3JAL A;  4G4Y A;  3JAL B;  1JFF B;  1U43 A;  3HTN A;  1T0A A;  1U40 A;  4X3L A;  1YQN A;  5KX5 A;  1VQV A;  2VGM A;  3E20 B;  2BTQ B;  2QTP A;  3P0Z A;  1GX1 A;  1VQM F;  1E7K A;  3NK6 A;  3CMA F;  2P6Y A;  3LWV C;  3KHN A;  1VQO F;  3SIV A;  1OAP A;  5HP8 A;  1VQL F;  5CA1 A;  3ON1 A;  3FD6 A;  5CA1 B;  3F6M A;  2PHN A;  3F0E A;  3MBM A;  5MN5 A;  4EI7 A;  3CG6 A;  3N2K A;  3N2K B;  3RYH B;  5A2Q M;  4I50 A;  2OHW A;  3HWU A;  1Z5W A;  3VYT C;  1YIJ F;  1XRG A;  4E6E A;  2F9Z C;  3C9S A;  1UI9 A;  3HAX D;  1XHO A;  3NK7 A;  3LWR C;  3E22 A;  5KMG A;  5FNV A;  2Z1F A;  3J7A R;  5KMG B;  4XCQ A;  5FNV B;  2PMP A;  1QVG F;  3O85 A;  4C8G A;  1IV1 A;  3ESJ A;  2Z01 A;  2ZVY A;  1CK2 A;  4C8E A;  3FPI A;  1YJ9 F;  5EIB C;  3CCV F;  1KC8 H;  4X1Y B;  1VH8 A;  2L26 A;  1YI2 F;  1W59 A;  3Q8H A;  3RYC A;  1S72 F;  3RYC B;  1PXW A;  4BT5 A;  5IJ9 B;  5G4V C;  1VQ7 F;  3S0W A;  3FBA A;  3M4S A;  3LYB A;  5HWE A;  4G4V A;  1Q81 H;  3CB2 A;  4C4W C;  3F0D A;  2VAW A;  3U0O A;  2GLZ A;  5LXT A;  2FGY A;  3WPX A;  1ZWZ A;  2IQQ A;  3VO8 A;  2QI2 A;  5IYZ A;  5GIN C;  2GVI A;  4ZHQ A;  3CCJ F;  5EAZ A;  3WGJ A;  3B6N A;  3J80 M;  1Q8R A;  4O4I A;  3V7Q A;  5EYP A;  4O4I B;  5HY4 A;  5EYP B;  4DXD A;  1ODE A;  2Z1U A;  3G4S F;  2V9Y A;  3IEQ A;  3G71 F;  3FFM A;  4M8I A;  3I3F A;  5EZY A;  3I55 F;  5EZY B;  3NVK E;  2N48 A;  1VHA A;  3C9T A;  3CCS F;  4C8I A;  2HX0 A;  3SIU A;  3S0H A;  3CCE F;  1YGY A;  3GYQ A;  3VOB A;  4R40 B;  2RHL A;  1FFX B;  4BW0 B;  1X52 A;  1TVK A;  3DDN A;  1TVK B;  4TUY A;  5J2U A;  5J2U B;  3JAS A;  3VTI C;  3JAS B;  5LOV A;  5LOV B;  1UFY A;  1M90 H;  3HKD A;  3WJQ A;  3HKD B;  3CYQ A;  5JH7 A;  3MCA B;  5HY1 A;  5JH7 B;  2H8C A;  3CC2 F;  1RLG A;  3WJR A;  1W2B F;  3IEW A;  3LFO A;  1M1K H;  3P4E A;  3G6E F;  1CLI A;  1Q7Y H;  2HRY A;  4ZK7 A;  1Q82 H;  2KTV A;  5CB4 B;  2HP0 A;  2I6D A;  2HP0 B;  3QUW A;  3RA5 A;  4B62 A;  2HS4 A;  1OFU A;  3TD4 A;  2ALE A;  4NQ3 A;  2CZW A;  3RA6 A;  3GTZ A;  5J2T B;  4YJ3 A;  3OBW A;  5HXZ A;  3WGM A;  5KX5 B;  3ZP4 A;  3CCR F;  4U39 A;  4DRX A;  1GO1 A;  3RE3 A;  3WPW A;  4C81 A;  1K8A H;  4ZOL A;  3N4Y A;  4ZOL B;  1H7M A;  1CN7 A;  2IAF A;  3J81 M;  2RB9 A;  3D54 A;  3CCU F;  1VK3 A;  1FNK A;  1TUB A;  1TUB B;  3HKB A;  3OBY A;  3HKB B;  4ZHW A;  2CVL A;  3CD6 F;  5HXU A;  2YXZ A;  2KTU A;  4I50 B;  3MDO A;  5MN6 A;  4O4J A;  3LWO C;  4O4J B;  2H6L A;  5EIB D;  1VQP F;  4X3M A;  2G9I A;  3JVH A;  3S02 A;  3KE1 A;  4I4T A;  4I4T B;  1VQK F;  4PWT A;  3E22 B;  4LNU A;  3IMP A;  4YJ2 A;  3FD5 A;  4LNU B;  4YJ2 B;  4TZZ A;  3CPQ A;  3OW2 F;  2BTU A;  3LWQ C;  3HKE A;  5JVD A;  2CSL A;  1H47 A;  4C82 A;  3WGK A;  1XV2 A;  2HS0 A;  4BVQ A;  4BT7 A;  3C9R A;  3CPW F;  3ZP7 A;  5BMV A;  5BMV B;  1VQ4 F;  5HP7 A;  1U3L A;  4U3J A;  2BO1 A;  1VQ9 F;  1W58 1;  2AIZ P;  4U3J B;  2CHT A;  2JNB A;  4X1K A;  1N8R H;  1NMU B;  1IV2 A;  5JCO A;  3K12 A;  4TV9 A;  2HRU A;  4TV9 B;  1W57 A;  1W3E X;  2H8E A;  4BVS A;  5LXT B;  3M1X A;  1RQ7 A;  4B46 A;  5IYZ B;  1YJW F;  1K9M H;  2ZOV A;  1VQ8 F;  4ZHQ B;  2R6R 1;  3D00 A;  4X1I A;  3VYU C;  1QVF F;  2ZVZ A;  4X1I B;  2BTO A;  1YIT F;  5FJ4 C;  3MCQ A;  5ITZ A;  3JAR A;  5ITZ B;  3JAR B;  3QHD A;  3WGL A;  5MN4 A;  2CWJ A;  3JAK A;  5IT9 M;  1GO0 A;  1IV4 A;  4G4W A;  2UYN A;  1FSZ A;  3JAT A;  3JAT B;  2GZL A;  2IG8 A;  4BT3 A;  1QAH A;  1YJN F;  2AMT A;  3CCM F;  1JJ2 F;  4TUY B;  4B45 A;  4EB6 A;  2MQE A;  3ZOP A;  2KG4 A;  1DBF A;  2HP3 A;  3JAM M;  4BT4 A;  2UYP A;  5G4U C;  4NWO B;  3VIU A;  1W42 A;  3PLA C;  1RQ2 A;  1XBI A;  3S06 A;  3JCM M;  1W5A A;  3V4D A;  4O4L A;  5IJ0 A;  3WXM B;  4O4L B;  5IJ0 B;  1VQ6 F;  2OTL F;  3KIZ A;  3EOR A;  4EI9 A;  4B5C A;  3OON A;  4O4H A;  4FFB A;  4O4H B;  4FFB B;  3AGK A;  3F0G A;  5GIO C;  1SA0 A;  1SA0 B;  1T0K B;  3IKF A;  3K0T A;  3BYQ A;  2OZB A;  4I55 A;  1IV3 A;  4I55 B;  2UZH A;  1X7O A;  4X20 A;  3KJJ A;  3CCQ F;  4X20 B;  5LA6 A;  3E1Y A;  4G88 A;  4YJ3 B;  5LA6 B;  4G4X A;  1FNJ A;  3S03 A;  3C9U A;  1QD9 A;  1U3P A;  4BVT A;  4IHJ A;  4IIJ A;  5JCO C;  3M84 A;  4IHJ B;  4IIJ B;  1IPA A;  4DRX B; 
#chains in the Genus database with same CATH homology
 2WAL A;  1KD1 H;  2GLZ A;  4TZZ A;  5GAN K;  3CPQ A;  3OW2 F;  2FGY A;  2HVY D;  1YHQ F;  3LWQ C;  1ZWZ A;  2OTJ F;  2QI2 A;  3V3T A;  4NUT A;  5GIN C;  3CCJ F;  1VQN F;  4LCK A;  1Q86 H;  2AIF A;  3CC7 F;  4BVQ A;  2LBW A;  5EWR A;  3CPW F;  3CME F;  1NJI H;  3CXC F;  3J80 M;  2VGN A;  3V7Q A;  1VQ4 F;  5HY4 A;  3G4S F;  1VQ5 F;  3NVI B;  2BO1 A;  1VQ9 F;  3NMU C;  5FLX M;  3G71 F;  1GZ0 A;  2JNB A;  3PAF A;  3I56 F;  4BY9 D;  3FFM A;  1N8R H;  1NMU B;  3VI6 A;  3I55 F;  5HY2 A;  3NVK E;  3HJW C;  1SDS A;  2QA4 F;  3CCS F;  3SIU A;  3LWP C;  3CCE F;  3GYQ A;  1W3E X;  4BVS A;  3V7E A;  4BW0 B;  1YJW F;  1X52 A;  1K9M H;  1VQ8 F;  1DT9 A;  3D00 A;  3VMF B;  4EI8 A;  1QVF F;  1W41 A;  1YIT F;  5FJ4 C;  2QEX F;  1M90 H;  4X3L A;  2VGM A;  3E20 B;  3MCA B;  5HY1 A;  3CC2 F;  1RLG A;  4BVR A;  1VQM F;  1E7K A;  1W2B F;  3NK6 A;  5IT9 M;  1GO0 A;  3CMA F;  3LFO A;  3LWV C;  1VQO F;  3SIV A;  1M1K H;  3G6E F;  5HY0 A;  1VQL F;  1Q7Y H;  5DCV A;  3ON1 A;  1W40 A;  1YJN F;  2FC3 A;  1Q82 H;  2KTV A;  4EI7 A;  3CG6 A;  3CCM F;  2I6D A;  3RA5 A;  1JJ2 F;  5EO3 A;  5A2Q M;  2OHW A;  2KG4 A;  2ALE A;  4NQ3 A;  2CZW A;  3RA6 A;  3JAM M;  5G4U C;  1YIJ F;  3OBW A;  5HXZ A;  1W42 A;  2F9Z C;  3PLA C;  3N4Z A;  1XBI A;  3CCR F;  3HAX D;  3LWR C;  3NK7 A;  3CC4 F;  1GO1 A;  3JCM M;  5GAP K;  3J7A R;  1K8A H;  4XCQ A;  3WXM B;  5GIP C;  1VQ6 F;  3N4Y A;  1QVG F;  2OTL F;  2LBX A;  3O85 A;  1H7M A;  1CN7 A;  4EI9 A;  1KQS F;  1CK2 A;  3J81 M;  3CCU F;  3AGK A;  1YJ9 F;  5GIO C;  3CCL F;  3OBY A;  1X7P A;  3IR9 A;  3CCV F;  1KC8 H;  1T0K B;  1RA4 A;  1K73 H;  2OZB A;  3CD6 F;  5HXU A;  1YI2 F;  2KTU A;  3LWO C;  1S72 F;  1PXW A;  5G4V C;  1X7O A;  1VQ7 F;  1VQP F;  3CCQ F;  4X3M A;  5HWE A;  3E1Y A;  1Q81 H;  4BVT A;  4C4W C;  1VQK F;  1IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...