1KQSF

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kqsF00
1YITF 5G4VC 1CK2A 1VQNF 3OBWA 3JCMM 1X7PA 1NMUB 5FLXM 2ALEA 3CG6A 2I6DA 1KQSF 3FFMA 2OHWA 3CD6F 3J7AR 3SIVA 1VQ9F 1RA4A 1YI2F 3CCRF 1K8AH 1JJ2F 1W2BF 1XBIA 3N4YA 3PAFA 3PLAC 1SDSA 3HAXD 1KD1H 3LWRC 4X3MA 1VQPF 1VQ6F 1GO1A 3CPQA 3IR9A 2CZWA 3CCEF 3CCVF 5A2QM 1DT9A 1N8RH 5GIOC 1S72F 2KTUA 1GZ0A 1YJWF 2VGMA 2BO1A 3CCQF 1E7KA 5EWRA 1W42A 3GYQA 4X3LA 3LWQC 1PXWA 1Q82H 3CMAF 4LCKA 1K73H 5GANK 1QVGF 3NVKE 2FC3A 3JAMM 4BW0B 3CC7F 2HVYD 3LWOC 1M90H 5G4UC 5IT9M 1W3EX 1VQ4F 1KC8H 1ZWZA 5EO3A 3E20B 3LWVC 2WALA 3HJWC 2LBWA 4C4WC 3G4SF 3ON1A 1YJNF 1VQMF 1X52A 3CCJF 3NVIB 5GINC 3V7EA 2LBXA 3WXMB 3VMFB 3CCUF 2QEXF 1K9MH 3CCLF 3V7QA 1M1KH 2JNBA 1H7MA 3G6EF 3AGKA 3MCAB 3NK6A 2OTJF 1VQLF 2OTLF 1YJ9F 1NJIH 1CN7A 1Q81H 3RA5A 2KTVA 3LWPC 5FJ4C 4NUTA 5GAPK 4BY9D 3VI6A 4TZZA 3CC2F 3N4ZA 1VQ8F 3CC4F 1VQ7F 1RLGA 1VQOF 1X7OA 1Q86H 3CCSF 5GIPC 3I56F 3CXCF 1W41A 1W40A 2QI2A 3RA6A 2KG4A 1IPAA 3G71F 3O85A 3CPWF 3NMUC 5DCVA 3I55F 3OBYA 1VQKF 2OZBA 1QVFF 3SIUA 3J80M 3CMEF 3NK7A 1Q7YH 2VGNA 1YHQF 2AIFA 1GO0A 1T0KB 2QA4F 3E1YA 1VQ5F 3OW2F 1YIJF 3CCMF 3J81M 3LFOA
chains in the Genus database with same CATH superfamily
1OAPA 4FFBB 4R40B 5LP6A 3HTNA 4BVSA 1NMUB 4B46A 3CYQA 4KWEA 3FD5A 1YQNA 4ZOLB 5CA1A 4YJ2A 3WJQA 4BT3A 3M1XA 4DRXB 3F0FA 5J2UB 2Z1EA 4F6RA 3LWRC 4NQ3A 1VQPF 1JFFA 1GO1A 4O4JB 1IV3A 4RQOA 2YYEA 3RYCA 2N48A 4BT4A 2H8CA 5MN5A 3CCEF 3C8LA 4I50B 2IAFA 2Q1YA 3KIZA 1QAHA 2H6LA 5LP6C 2KGWA 1YJWF 3RYFA 3VYSC 3GYQA 4EI9A 3IKEA 3LWQC 3K12A 2HP3A 1QVGF 2PMPA 1RLUA 5JQGB 5HWEA 2PHNA 3JAMM 4ZI7A 2HVYD 5EZYA 2HS0A 5IYZB 1FSZA 2ZF8A 5ITZB 1VQ4F 1YGYA 1RQ2A 2ZVYA 4BVRA 4X1IA 4DXDA 5LXTB 3KJJA 5LOVA 5MN6A 2L26A 2UYNB 2ZODA 3G4SF 3JAWB 1W5AA 1X52A 3CCJF 3HKBB 1PF5A 3K2XA 3P10A 5HY2A 3Q8HA 5AVMA 2QEXF 1K9MH 3EORA 2RHJA 1XHOA 3GTZA 4O4IA 1UI9A 2JNBA 3MCQA 4TV8A 3QHDA 3MCAB 1W57A 4X1YB 4I4TB 4WBNA 1CN7A 2KTVA 3RYIA 4U39A 4BVTA 2HRYA 4X20B 5KMGA 4BY9D 3N2GB 5JVDB 4G4YA 3UT5B 3ZP4A 3C9RA 1VQ7F 3WGMA 1RLGA 3CCSF 2HS3A 5C8YA 3L7QA 3JARA 3CXCF 3HKDB 1U43A 1W40A 3CPWF 2KG4A 1FNJA 3FPIA 3HKCB 1VQKF 4IHJB 3SIUA 3F0GA 5JH7B 3JASB 3CMEF 3F6MA 2VAPA 3LMEA 1YHQF 4NWOB 3GHZA 3D01A 3E22A 4BT2A 1SA0A 2ZAUA 3C9UA 2HX0A 3HWUA 3J81M 3LFOA 3K14A 4EB6B 4C8GA 4EI8A 3IKFA 4IIJB 3ZOPA 2Q1XA 1TVKA 2I6DA 5IJ0B 1RA4A 4ZHVA 5CB4B 3CCRF 1YI2F 1K8AH 5J2TB 1W2BF 1XBIA 3N4YA 3PAFA 5FNVA 1TUBA 3RE3A 3ZO8A 1U3PA 4O4LB 4ZHQB 1KD1H 2CWJA 4X3MA 1VQ6F 4C82A 3IMPA 4LNUA 4TV9B 2CHSA 1JD1A 3CCVF 5KX5B 1N8RH 3I3FA 1OFUA 1S72F 2LBTA 2VGMA 3CCQF 5EWRA 3C9SA 1VHAA 2VAWA 2UYJA 1PXWA 1W5EA 3C9TA 2FC3A 1XV2A 4BT5A 4BW0B 3RYHA 3LWOC 4U3JB 1IV1A 5EYPB 5CA0B 2LCAA 5EO3A 4PWTA 4M8IA 1JN1A 4HNAB 3JALB 3DDNA 4E6EA 2NMUA 2LBWA 2ZOVA 5BMVA 3D54A 1YJNF 3NVIB 4I55B 4YJ3A 5JCOA 2BTQB 3WXMB 2HP0A 1FFXA 3CCLF 5LYJA 2HRUA 1U40A 3JAKB 1Q8RA 3N2KA 1H7MA 2IG8A 3S0WA 3NK6A 3S06A 3DC2A 4TUYA 3RA5A 2VXYA 3JATA 4O4HA 4ERHA 2R751 2DT4A 5EIBD 3CC2F 1VQ8F 4XCQA 2CW4A 1U3LA 5LA6B 1Q86H 1IV4A 3I56F 3VIUA 2GVIA 1W41A 3M84A 5GONB 5JCOC 1IPAA 4BVQA 4BT7A 4EI7A 1H48A 4O2AB 3MQWA 5EAZA 2OZBA 3WPXA 3TD3A 4O2BA 3NK7A 1JY8A 3WGKA 2AIFA 2MQEA 5LP6B 3WJPA 4X1KA 1GO0A 3E1YA 3F0DA 4C8EA 3OW2F 1YIJF 3J7AR 5CA1B 4YJ2B 3MDOA 1VQNF 3OBWA 3JCMM 3CYPB 3HKEA 2F9ZC 2HS4A 5FLXM 5IJ9A 1SZQA 3CG6A 3QUWA 2OHWA 4F6RB 3CD6F 2EWCA 3M4SA 1VQ9F 1JFFB 3SIVA 4FFBA 3RYCB 3IEQA 3PLAC 1KNKA 2CSLA 1SDSA 2BTOA 4ZOLA 2OTMA 3RYFB 5HXUA 3CPQA 2GLZA 3IR9A 1DT9A 5HY4A 4DRXA 5J2UA 5GIOC 2FGYA 4ZI7B 5EZYB 1GZ0A 2BO1A 1E7KA 4O4JA 3ZP7A 3CMAF 2R6R1 2I6RA 4X1IB 2CVLA 4LCKA 4I50A 3S02A 5HP8A 5GANK 3NVKE 3TD4A 5LOVB 3CC7F 1M90H 5G4UC 2P6YA 2GZLA 1ZWZA 3V4DA 3WGNA 3E20B 5MN4A 1IV2A 5JQGA 2WALA 3HJWC 3V3TA 4O4IB 3ERNA 3T80A 3B6NA 3WGLA 5B8FA 4TV8B 4C4WC 4G4XA 3ON1A 1COMA 5IYZA 1VQMF 5ITZA 5GINC 1VH8A 4ZHWA 2UYKA 3BYQA 4WBNB 5LXTA 3VMFB 3RYIB 3VOAA 5KMGB 3V7QA 1M1KH 2UYNA 3G6EF 1VK3A 3JAWA 2OTJF 2OTLF 1YJ9F 1T0AA 3HKBA 2AIZP 1Q81H 1X25A 3LWPC 5FJ4C 2UZHA 1Z5VA 4NUTA 5C8YB 3VTIC 3JARB 5GAPK 3K0TA 4TZZA 1R1MA 3N4ZA 3CC4F 4X1YA 4I4TA 3KJKA 1UFYA 4G4WA 1VQOF 1X7OA 4X20A 3LYBA 3N2GA 5JVDA 3F0EA 2QI2A 3UT5A 3RA6A 3O85A 3VYUC 1J7HA 3E22B 3I55F 3OBYA 1SA0B 1QVFF 2RB9A 3S03A 4RHAA 3HKDA 1Q7YH 2VGNA 4G4VA 1GX1A 1TVKB 3HKCA 1W5BA 4IHJA 5EIBC 3CCMF 1W55A 1QD9A 3CB2A 2Z01A 5JH7A 3JASA 1YITF 5G4VC 2Z1FA 1CK2A 1RQ7A 1ODEA 1VQVA 5FNVB 1X7PA 1Z5WA 3P4EA 1TUBB 2ALEA 1KQSF 2RHOA 3FFMA 2VAMA 4EB6A 4B5CA 5HXZA 4IIJA 1JJ2F 4LNUB 2UYPA 2V9YA 1NQ3A 1FNKA 3VOBA 3HAXD 2RHHA 3VCZA 1H47A 4ZK7A 2H8EA 1CLIA 3WJRA 5IJ0A 2CHTA 5CB4A 3JVHA 5J2TA 5HY1A 2CZWA 1W59A 5A2QM 5EB1B 2KTUA 1DBFA 4O4LA 3RYHB 4ZHQA 1W42A 4X3LA 2BTUA 4TV9A 1Q82H 3S0HA 5KX5A 1K73H 5HY0A 4B45A 3TD5A 3R0PA 2B33A 3ELCA 5BMVB 5IT9M 2G9IA 1W3EX 4YJ3B 1KC8H 3WPWA 2HP0B 3IEWA 1FFXB 3D00A 2W8BC 3LWVC 1QU9A 5LYJB 4C8IA 3N2KB 4U3JA 2RHLA 3KHNA 2LBXA 1W5FA 5EYPA 5CA0A 3V7EA 1W581 4TUYB 4B62A 3CCUF 2QTPA 3JATB 4O4HB 4HNAA 3JALA 3LDTA 2IQQA 3AGKA 4I55A 1VQLF 1NJIH 4G4ZA 3WGJA 4ZHYB 3VI6A 3JAKA 3VO8A 3KE1A 2DYYA 2YXZA 1ONIA 3MBMA 2HQSC 3OONA 3QTYA 5GIPC 3ESJA 4O2BB 3NMUC 1KNJA 3G71F 4X1KB 4BT6A 5DCVA 2Z1TA 5LA6A 2Z1UA 3FD6A 3FBAA 5HP7A 3J80M 3S0YA 1XRGA 5GONA 2K1SA 4C81A 3P0ZA 3U0OA 3VYTC 1T0KB 3I7TA 4O2AA 3HKEB 5EB0A 5IJ9B 2QA4F 1VQ5F 2AMTA 2ZVZA 4G88A
chains in the Genus database with same CATH topology
1YITF 5G4VC 4EI8A 1CK2A 1VQNF 3OBWA 3JCMM 4BVSA 1X7PA 1NMUB 2F9ZC 5FLXM 2ALEA 3CG6A 2I6DA 1KQSF 3FFMA 2OHWA 3CD6F 3J7AR 3SIVA 1VQ9F 1RA4A 5HXZA 3CCRF 1YI2F 1K8AH 1JJ2F 1W2BF 1XBIA 3N4YA 3PAFA 3PLAC 1SDSA 3HAXD 1KD1H 3LWRC 4NQ3A 4X3MA 1VQPF 1VQ6F 1GO1A 5HXUA 3CPQA 2GLZA 5HY1A 3IR9A 2CZWA 3CCEF 3CCVF 5A2QM 1DT9A 1N8RH 5HY4A 5GIOC 2FGYA 1S72F 2KTUA 1GZ0A 1YJWF 2VGMA 2BO1A 3CCQF 1E7KA 5EWRA 4EI9A 1W42A 3GYQA 4X3LA 3LWQC 1PXWA 1Q82H 3CMAF 4LCKA 1K73H 5GANK 1QVGF 3NVKE 5HY0A 2FC3A 5HWEA 3JAMM 4BW0B 3CC7F 2HVYD 3LWOC 1M90H 5G4UC 5IT9M 1W3EX 1VQ4F 1KC8H 1ZWZA 5EO3A 4BVRA 3E20B 3D00A 3LWVC 2WALA 3HJWC 3V3TA 2LBWA 4C4WC 3G4SF 3ON1A 1YJNF 1VQMF 1X52A 3CCJF 3NVIB 5GINC 3V7EA 2LBXA 3WXMB 3VMFB 3CCUF 5HY2A 2QEXF 1K9MH 3CCLF 3V7QA 1M1KH 2JNBA 1H7MA 3G6EF 3AGKA 3MCAB 3NK6A 2OTJF 1VQLF 2OTLF 1YJ9F 1NJIH 1CN7A 1Q81H 3RA5A 2KTVA 3LWPC 5FJ4C 4BVTA 4NUTA 5GAPK 4BY9D 3VI6A 4TZZA 3CC2F 3N4ZA 1VQ8F 3CC4F 4XCQA 1VQ7F 1RLGA 1VQOF 1X7OA 1Q86H 3CCSF 5GIPC 3I56F 3CXCF 1W41A 1W40A 2QI2A 3RA6A 2KG4A 1IPAA 3G71F 3O85A 3CPWF 4BVQA 4EI7A 5DCVA 3I55F 3OBYA 1VQKF 2OZBA 1QVFF 3SIUA 3J80M 3CMEF 3NK7A 1Q7YH 3NMUC 2VGNA 1YHQF 2AIFA 1GO0A 1T0KB 2QA4F 3E1YA 1VQ5F 3OW2F 1YIJF 3CCMF 3J81M 3LFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT F;  5G4V C;  1CK2 A;  1VQN F;  3OBW A;  3JCM M;  1X7P A;  1NMU B;  5FLX M;  2ALE A;  3CG6 A;  2I6D A;  1KQS F;  3FFM A;  2OHW A;  3CD6 F;  3J7A R;  3SIV A;  1VQ9 F;  1RA4 A;  1YI2 F;  3CCR F;  1K8A H;  1JJ2 F;  1W2B F;  1XBI A;  3N4Y A;  3PAF A;  3PLA C;  1SDS A;  3HAX D;  1KD1 H;  3LWR C;  4X3M A;  1VQP F;  1VQ6 F;  1GO1 A;  3CPQ A;  3IR9 A;  2CZW A;  3CCE F;  3CCV F;  5A2Q M;  1DT9 A;  1N8R H;  5GIO C;  1S72 F;  2KTU A;  1GZ0 A;  1YJW F;  2VGM A;  2BO1 A;  3CCQ F;  1E7K A;  5EWR A;  1W42 A;  3GYQ A;  4X3L A;  3LWQ C;  1PXW A;  1Q82 H;  3CMA F;  4LCK A;  1K73 H;  5GAN K;  1QVG F;  3NVK E;  2FC3 A;  3JAM M;  4BW0 B;  3CC7 F;  2HVY D;  3LWO C;  1M90 H;  5G4U C;  5IT9 M;  1W3E X;  1VQ4 F;  1KC8 H;  1ZWZ A;  5EO3 A;  3E20 B;  3LWV C;  2WAL A;  3HJW C;  2LBW A;  4C4W C;  3G4S F;  3ON1 A;  1YJN F;  1VQM F;  1X52 A;  3CCJ F;  3NVI B;  5GIN C;  3V7E A;  2LBX A;  3WXM B;  3VMF B;  3CCU F;  2QEX F;  1K9M H;  3CCL F;  3V7Q A;  1M1K H;  2JNB A;  1H7M A;  3G6E F;  3AGK A;  3MCA B;  3NK6 A;  2OTJ F;  1VQL F;  2OTL F;  1YJ9 F;  1NJI H;  1CN7 A;  1Q81 H;  3RA5 A;  2KTV A;  3LWP C;  5FJ4 C;  4NUT A;  5GAP K;  4BY9 D;  3VI6 A;  4TZZ A;  3CC2 F;  3N4Z A;  1VQ8 F;  3CC4 F;  1VQ7 F;  1RLG A;  1VQO F;  1X7O A;  1Q86 H;  3CCS F;  5GIP C;  3I56 F;  3CXC F;  1W41 A;  1W40 A;  2QI2 A;  3RA6 A;  2KG4 A;  1IPA A;  3G71 F;  3O85 A;  3CPW F;  3NMU C;  5DCV A;  3I55 F;  3OBY A;  1VQK F;  2OZB A;  1QVF F;  3SIU A;  3J80 M;  3CME F;  3NK7 A;  1Q7Y H;  2VGN A;  1YHQ F;  2AIF A;  1GO0 A;  1T0K B;  2QA4 F;  3E1Y A;  1VQ5 F;  3OW2 F;  1YIJ F;  3CCM F;  3J81 M;  3LFO A; 
#chains in the Genus database with same CATH topology
 1OAP A;  4FFB B;  4R40 B;  5LP6 A;  3HTN A;  4BVS A;  1NMU B;  4B46 A;  3CYQ A;  4KWE A;  3FD5 A;  1YQN A;  4ZOL B;  5CA1 A;  4YJ2 A;  3WJQ A;  4BT3 A;  3M1X A;  4DRX B;  3F0F A;  5J2U B;  2Z1E A;  4F6R A;  3LWR C;  4NQ3 A;  1VQP F;  1JFF A;  1GO1 A;  4O4J B;  1IV3 A;  4RQO A;  2YYE A;  3RYC A;  2N48 A;  4BT4 A;  2H8C A;  5MN5 A;  3CCE F;  3C8L A;  4I50 B;  2IAF A;  2Q1Y A;  3KIZ A;  1QAH A;  2H6L A;  5LP6 C;  2KGW A;  1YJW F;  3RYF A;  3VYS C;  3GYQ A;  4EI9 A;  3IKE A;  3LWQ C;  3K12 A;  2HP3 A;  1QVG F;  2PMP A;  1RLU A;  5JQG B;  5HWE A;  2PHN A;  3JAM M;  4ZI7 A;  2HVY D;  5EZY A;  2HS0 A;  5IYZ B;  1FSZ A;  2ZF8 A;  5ITZ B;  1VQ4 F;  1YGY A;  1RQ2 A;  2ZVY A;  4BVR A;  4X1I A;  4DXD A;  5LXT B;  3KJJ A;  5LOV A;  5MN6 A;  2L26 A;  2UYN B;  2ZOD A;  3G4S F;  3JAW B;  1W5A A;  1X52 A;  3CCJ F;  3HKB B;  1PF5 A;  3K2X A;  3P10 A;  5HY2 A;  3Q8H A;  5AVM A;  2QEX F;  1K9M H;  3EOR A;  2RHJ A;  1XHO A;  3GTZ A;  4O4I A;  1UI9 A;  2JNB A;  3MCQ A;  4TV8 A;  3QHD A;  3MCA B;  1W57 A;  4X1Y B;  4I4T B;  4WBN A;  1CN7 A;  2KTV A;  3RYI A;  4U39 A;  4BVT A;  2HRY A;  4X20 B;  5KMG A;  4BY9 D;  3N2G B;  5JVD B;  4G4Y A;  3UT5 B;  3ZP4 A;  3C9R A;  1VQ7 F;  3WGM A;  1RLG A;  3CCS F;  2HS3 A;  5C8Y A;  3L7Q A;  3JAR A;  3CXC F;  3HKD B;  1U43 A;  1W40 A;  3CPW F;  2KG4 A;  1FNJ A;  3FPI A;  3HKC B;  1VQK F;  4IHJ B;  3SIU A;  3F0G A;  5JH7 B;  3JAS B;  3CME F;  3F6M A;  2VAP A;  3LME A;  1YHQ F;  4NWO B;  3GHZ A;  3D01 A;  3E22 A;  4BT2 A;  1SA0 A;  2ZAU A;  3C9U A;  2HX0 A;  3HWU A;  3J81 M;  3LFO A;  3K14 A;  4EB6 B;  4C8G A;  4EI8 A;  3IKF A;  4IIJ B;  3ZOP A;  2Q1X A;  1TVK A;  2I6D A;  5IJ0 B;  1RA4 A;  4ZHV A;  5CB4 B;  3CCR F;  1YI2 F;  1K8A H;  5J2T B;  1W2B F;  1XBI A;  3N4Y A;  3PAF A;  5FNV A;  1TUB A;  3RE3 A;  3ZO8 A;  1U3P A;  4O4L B;  4ZHQ B;  1KD1 H;  2CWJ A;  4X3M A;  1VQ6 F;  4C82 A;  3IMP A;  4LNU A;  4TV9 B;  2CHS A;  1JD1 A;  3CCV F;  5KX5 B;  1N8R H;  3I3F A;  1OFU A;  1S72 F;  2LBT A;  2VGM A;  3CCQ F;  5EWR A;  3C9S A;  1VHA A;  2VAW A;  2UYJ A;  1PXW A;  1W5E A;  3C9T A;  2FC3 A;  1XV2 A;  4BT5 A;  4BW0 B;  3RYH A;  3LWO C;  4U3J B;  1IV1 A;  5EYP B;  5CA0 B;  2LCA A;  5EO3 A;  4PWT A;  4M8I A;  1JN1 A;  4HNA B;  3JAL B;  3DDN A;  4E6E A;  2NMU A;  2LBW A;  2ZOV A;  5BMV A;  3D54 A;  1YJN F;  3NVI B;  4I55 B;  4YJ3 A;  5JCO A;  2BTQ B;  3WXM B;  2HP0 A;  1FFX A;  3CCL F;  5LYJ A;  2HRU A;  1U40 A;  3JAK B;  1Q8R A;  3N2K A;  1H7M A;  2IG8 A;  3S0W A;  3NK6 A;  3S06 A;  3DC2 A;  4TUY A;  3RA5 A;  2VXY A;  3JAT A;  4O4H A;  4ERH A;  2R75 1;  2DT4 A;  5EIB D;  3CC2 F;  1VQ8 F;  4XCQ A;  2CW4 A;  1U3L A;  5LA6 B;  1Q86 H;  1IV4 A;  3I56 F;  3VIU A;  2GVI A;  1W41 A;  3M84 A;  5GON B;  5JCO C;  1IPA A;  4BVQ A;  4BT7 A;  4EI7 A;  1H48 A;  4O2A B;  3MQW A;  5EAZ A;  2OZB A;  3WPX A;  3TD3 A;  4O2B A;  3NK7 A;  1JY8 A;  3WGK A;  2AIF A;  2MQE A;  5LP6 B;  3WJP A;  4X1K A;  1GO0 A;  3E1Y A;  3F0D A;  4C8E A;  3OW2 F;  1YIJ F;  3J7A R;  5CA1 B;  4YJ2 B;  3MDO A;  1VQN F;  3OBW A;  3JCM M;  3CYP B;  3HKE A;  2F9Z C;  2HS4 A;  5FLX M;  5IJ9 A;  1SZQ A;  3CG6 A;  3QUW A;  2OHW A;  4F6R B;  3CD6 F;  2EWC A;  3M4S A;  1VQ9 F;  1JFF B;  3SIV A;  4FFB A;  3RYC B;  3IEQ A;  3PLA C;  1KNK A;  2CSL A;  1SDS A;  2BTO A;  4ZOL A;  2OTM A;  3RYF B;  5HXU A;  3CPQ A;  2GLZ A;  3IR9 A;  1DT9 A;  5HY4 A;  4DRX A;  5J2U A;  5GIO C;  2FGY A;  4ZI7 B;  5EZY B;  1GZ0 A;  2BO1 A;  1E7K A;  4O4J A;  3ZP7 A;  3CMA F;  2R6R 1;  2I6R A;  4X1I B;  2CVL A;  4LCK A;  4I50 A;  3S02 A;  5HP8 A;  5GAN K;  3NVK E;  3TD4 A;  5LOV B;  3CC7 F;  1M90 H;  5G4U C;  2P6Y A;  2GZL A;  1ZWZ A;  3V4D A;  3WGN A;  3E20 B;  5MN4 A;  1IV2 A;  5JQG A;  2WAL A;  3HJW C;  3V3T A;  4O4I B;  3ERN A;  3T80 A;  3B6N A;  3WGL A;  5B8F A;  4TV8 B;  4C4W C;  4G4X A;  3ON1 A;  1COM A;  5IYZ A;  1VQM F;  5ITZ A;  5GIN C;  1VH8 A;  4ZHW A;  2UYK A;  3BYQ A;  4WBN B;  5LXT A;  3VMF B;  3RYI B;  3VOA A;  5KMG B;  3V7Q A;  1M1K H;  2UYN A;  3G6E F;  1VK3 A;  3JAW A;  2OTJ F;  2OTL F;  1YJ9 F;  1T0A A;  3HKB A;  2AIZ P;  1Q81 H;  1X25 A;  3LWP C;  5FJ4 C;  2UZH A;  1Z5V A;  4NUT A;  5C8Y B;  3VTI C;  3JAR B;  5GAP K;  3K0T A;  4TZZ A;  1R1M A;  3N4Z A;  3CC4 F;  4X1Y A;  4I4T A;  3KJK A;  1UFY A;  4G4W A;  1VQO F;  1X7O A;  4X20 A;  3LYB A;  3N2G A;  5JVD A;  3F0E A;  2QI2 A;  3UT5 A;  3RA6 A;  3O85 A;  3VYU C;  1J7H A;  3E22 B;  3I55 F;  3OBY A;  1SA0 B;  1QVF F;  2RB9 A;  3S03 A;  4RHA A;  3HKD A;  1Q7Y H;  2VGN A;  4G4V A;  1GX1 A;  1TVK B;  3HKC A;  1W5B A;  4IHJ A;  5EIB C;  3CCM F;  1W55 A;  1QD9 A;  3CB2 A;  2Z01 A;  5JH7 A;  3JAS A;  1YIT F;  5G4V C;  2Z1F A;  1CK2 A;  1RQ7 A;  1ODE A;  1VQV A;  5FNV B;  1X7P A;  1Z5W A;  3P4E A;  1TUB B;  2ALE A;  1KQS F;  2RHO A;  3FFM A;  2VAM A;  4EB6 A;  4B5C A;  5HXZ A;  4IIJ A;  1JJ2 F;  4LNU B;  2UYP A;  2V9Y A;  1NQ3 A;  1FNK A;  3VOB A;  3HAX D;  2RHH A;  3VCZ A;  1H47 A;  4ZK7 A;  2H8E A;  1CLI A;  3WJR A;  5IJ0 A;  2CHT A;  5CB4 A;  3JVH A;  5J2T A;  5HY1 A;  2CZW A;  1W59 A;  5A2Q M;  5EB1 B;  2KTU A;  1DBF A;  4O4L A;  3RYH B;  4ZHQ A;  1W42 A;  4X3L A;  2BTU A;  4TV9 A;  1Q82 H;  3S0H A;  5KX5 A;  1K73 H;  5HY0 A;  4B45 A;  3TD5 A;  3R0P A;  2B33 A;  3ELC A;  5BMV B;  5IT9 M;  2G9I A;  1W3E X;  4YJ3 B;  1KC8 H;  3WPW A;  2HP0 B;  3IEW A;  1FFX B;  3D00 A;  2W8B C;  3LWV C;  1QU9 A;  5LYJ B;  4C8I A;  3N2K B;  4U3J A;  2RHL A;  3KHN A;  2LBX A;  1W5F A;  5EYP A;  5CA0 A;  3V7E A;  1W58 1;  4TUY B;  4B62 A;  3CCU F;  2QTP A;  3JAT B;  4O4H B;  4HNA A;  3JAL A;  3LDT A;  2IQQ A;  3AGK A;  4I55 A;  1VQL F;  1NJI H;  4G4Z A;  3WGJ A;  4ZHY B;  3VI6 A;  3JAK A;  3VO8 A;  3KE1 A;  2DYY A;  2YXZ A;  1ONI A;  3MBM A;  2HQS C;  3OON A;  3QTY A;  5GIP C;  3ESJ A;  4O2B B;  3NMU C;  1KNJ A;  3G71 F;  4X1K B;  4BT6 A;  5DCV A;  2Z1T A;  5LA6 A;  2Z1U A;  3FD6 A;  3FBA A;  5HP7 A;  3J80 M;  3S0Y A;  1XRG A;  5GON A;  2K1S A;  4C81 A;  3P0Z A;  3U0O A;  3VYT C;  1T0K B;  3I7T A;  4O2A A;  3HKE B;  5EB0 A;  5IJ9 B;  2QA4 F;  1VQ5 F;  2AMT A;  2ZVZ A;  4G88 A; 
#chains in the Genus database with same CATH homology
 1YIT F;  5G4V C;  4EI8 A;  1CK2 A;  1VQN F;  3OBW A;  3JCM M;  4BVS A;  1X7P A;  1NMU B;  2F9Z C;  5FLX M;  2ALE A;  3CG6 A;  2I6D A;  1KQS F;  3FFM A;  2OHW A;  3CD6 F;  3J7A R;  3SIV A;  1VQ9 F;  1RA4 A;  5HXZ A;  3CCR F;  1YI2 F;  1K8A H;  1JJ2 F;  1W2B F;  1XBI A;  3N4Y A;  3PAF A;  3PLA C;  1SDS A;  3HAX D;  1KD1 H;  3LWR C;  4NQ3 A;  4X3M A;  1VQP F;  1VQ6 F;  1GO1 A;  5HXU A;  3CPQ A;  2GLZ A;  5HY1 A;  3IR9 A;  2CZW A;  3CCE F;  3CCV F;  5A2Q M;  1DT9 A;  1N8R H;  5HY4 A;  5GIO C;  2FGY A;  1S72 F;  2KTU A;  1GZ0 A;  1YJW F;  2VGM A;  2BO1 A;  3CCQ F;  1E7K A;  5EWR A;  4EI9 A;  1W42 A;  3GYQ A;  4X3L A;  3LWQ C;  1PXW A;  1Q82 H;  3CMA F;  4LCK A;  1K73 H;  5GAN K;  1QVG F;  3NVK E;  5HY0 A;  2FC3 A;  5HWE A;  3JAM M;  4BW0 B;  3CC7 F;  2HVY D;  3LWO C;  1M90 H;  5G4U C;  5IT9 M;  1W3E X;  1VQ4 F;  1KC8 H;  1ZWZ A;  5EO3 A;  4BVR A;  3E20 B;  3D00 A;  3LWV C;  2WAL A;  3HJW C;  3V3T A;  2LBW A;  4C4W C;  3G4S F;  3ON1 A;  1YJN F;  1VQM F;  1X52 A;  3CCJ F;  3NVI B;  5GIN C;  3V7E A;  2LBX A;  3WXM B;  3VMF B;  3CCU F;  5HY2 A;  2QEX F;  1K9M H;  3CCL F;  3V7Q A;  1M1K H;  2JNB A;  1H7M A;  3G6E F;  3AGK A;  3MCA B;  3NK6 A;  2OTJ F;  1VQL F;  2OTL F;  1YJ9 F;  1NJI H;  1CN7 A;  1Q81 H;  3RA5 A;  2KTV A;  3LWP C;  5FJ4 C;  4BVT A;  4NUT A;  5GAP K;  4BY9 D;  3VI6 A;  4TZZ A;  3CC2 F;  3N4Z A;  1VQ8 F;  3CC4 F;  4XCQ A;  1VQ7 F;  1RLG A;  1VQO F;  1X7O A;  1Q86 H;  3CCS F;  5GIP C;  3I56 F;  3CXC F;  1W41 A;  1W40 A;  2QI2 A;  3RA6 A;  2KG4 A;  1IPA A;  3G71 F;  3O85 A;  3CPW F;  4BVQ A;  4EI7 A;  5DCV A;  3I55 F;  3OBY A;  1VQK F;  2OZB A;  1QVF F;  3SIU A;  3J80 M;  3CME F;  3NK7 A;  1Q7Y H;  3NMU C;  2VGN A;  1YHQ F;  2AIF A;  1GO0 A;  1T0K B;  2QA4 F;  3E1Y A;  1VQ5 F;  3OW2 F;  1YIJ F;  3CCM F;  3J81 M;  3LFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...