1KQSF

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kqsF00
3OBYA 3J7AR 5FJ4C 3NK7A 3NVKE 1RLGA 1GZ0A 2QI2A 2KG4A 3G6EF 1VQ6F 3IR9A 3ON1A 2JNBA 3RA6A 1X52A 3OW2F 3FFMA 1N8RH 5EWRA 3HJWC 3JAMM 1VQ8F 3VMFB 3LWQC 1GO1A 3CC4F 2OTLF 1T0KB 2CZWA 5GIOC 1VQ5F 3O85A 1DT9A 3CCMF 3JCMM 1X7OA 1VQPF 1Q7YH 3CD6F 3J80M 1NJIH 4TZZA 3N4ZA 1YJNF 3CC7F 1QVFF 1VQMF 1KQSF 1YJ9F 1K8AH 3CG6A 4BW0B 5GAPK 1VQ7F 1VQ9F 3CMAF 1YI2F 3SIVA 1KD1H 1SDSA 2OZBA 1QVGF 3CXCF 5DCVA 3CCJF 3LWVC 3V7QA 5GIPC 2HVYD 2OTJF 1YJWF 1YIJF 1Q82H 1VQKF 1VQLF 3NMUC 1S72F 2QA4F 3J81M 3LWRC 3CCVF 4LCKA 1H7MA 1ZWZA 3NK6A 1X7PA 1M1KH 1VQ4F 3RA5A 1M90H 1W41A 2AIFA 1PXWA 2VGNA 3CCEF 5A2QM 3WXMB 1VQNF 3G4SF 3LWPC 3SIUA 1K9MH 4X3LA 1E7KA 3CCRF 3HAXD 3OBWA 5EO3A 2BO1A 3LFOA 3CPWF 4BY9D 3PAFA 5IT9M 1XBIA 3E20B 2QEXF 3E1YA 3CC2F 2I6DA 3CCUF 5G4UC 3N4YA 2OHWA 3G71F 1VQOF 3V7EA 1W2BF 3CCQF 4C4WC 3CCSF 1YHQF 1JJ2F 1GO0A 1W40A 1W3EX 1KC8H 3PLAC 5FLXM 1IPAA 4X3MA 2KTUA 4NUTA 1K73H 1CN7A 2FC3A 2VGMA 3AGKA 5GINC 3I55F 1YITF 1Q81H 2ALEA 3GYQA 2LBWA 3CPQA 1RA4A 3LWOC 3MCAB 2WALA 5GANK 3I56F 1W42A 1CK2A 3VI6A 1Q86H 3CCLF 3NVIB 2KTVA 1NMUB 2LBXA 3CMEF 5G4VC
chains in the Genus database with same CATH superfamily
3UT5B 3FBAA 3I7TA 3J7AR 5FJ4C 3JASA 5B8FA 5MN5A 3HKBA 5LYJA 1RLGA 2KG4A 1VQ6F 1QAHA 3L7QA 5IYZB 4EI9A 3WGMA 4B46A 3FFMA 4C8GA 3WJPA 5C8YB 3JAWB 3VMFB 3D54A 4O2BA 3HKDA 3M1XA 3MCQA 4M8IA 1VQ5F 4NWOB 4U3JA 1DT9A 3MDOA 5HP7A 1VQPF 5HY4A 5FNVA 3TD4A 3J80M 5J2TB 4BVSA 5IJ9B 3LDTA 5CB4B 3LMEA 5J2UA 5EB1B 3HKCB 3CMAF 1XHOA 1YGYA 3VO8A 1KD1H 1QVGF 5EYPB 3LWVC 1Q8RA 3IEWA 3T80A 5HWEA 1YIJF 1Q82H 4NQ3A 1VQKF 4X20B 5JQGB 4X1YB 1FNJA 3LWRC 4I4TA 3WPXA 3DDNA 1JY8A 1X7PA 3RA5A 4YJ2A 3VOAA 5CA1B 2VGNA 2ZODA 5LA6B 3WXMB 1CLIA 5KMGA 1K9MH 4X3LA 2ZVZA 3S03A 3V3TA 3VTIC 5EO3A 1RQ2A 2BO1A 3LFOA 4IHJA 3CPWF 4BY9D 5ITZA 2Q1YA 4LNUB 2YYEA 2Z1UA 3FD6A 3N4YA 4ZHWA 3G71F 4EI7A 2AIZP 1U3PA 3HTNA 2QTPA 1W5FA 4TV8B 3MBMA 3CCQF 4C4WC 4U39A 4BT6A 2H8EA 3OONA 3RYIA 4BT5A 1IPAA 1U40A 2KTUA 4X3MA 2CHTA 3TD5A 1W581 2FC3A 3P10A 1YITF 3VYUC 3MQWA 5IYZA 3VIUA 2LBWA 3JARA 3EORA 3CPQA 1VQVA 2V9YA 4O2AB 1W5EA 1CK2A 3VI6A 2Z1FA 5JCOC 1RLUA 3S06A 1TVKA 5LXTB 3F0FA 3M4SA 4BVQA 1SA0B 3D00A 2LBXA 1UI9A 4FFBB 2LBTA 3N2GB 5J2TA 2VXYA 3NK7A 1OFUA 4IIJB 3NVKE 2HP3A 1GZ0A 5AVMA 5CB4A 2QI2A 3WGJA 2YXZA 3G6EF 3IR9A 3ON1A 3R0PA 3RYHA 2Z1EA 5EIBC 2JNBA 5EYPA 1X52A 1N8RH 2VAWA 5CA0B 5EWRA 2IG8A 3E22B 3JAMM 2HRYA 1ONIA 1R1MA 4ZI7B 1GO1A 2IAFA 3QTYA 5JQGA 1PF5A 2OTLF 4X1YA 1T0KB 3O85A 1W57A 3CCMF 1VK3A 2FGYA 3Q8HA 3CD6F 1KNJA 3N4ZA 1JFFA 3M84A 1KQSF 1YJ9F 3IKFA 3SIVA 5GAPK 1VQ7F 1YI2F 5LA6A 4O4IA 3CXCF 3V7QA 2HVYD 3GTZA 2CHSA 4EB6A 2R751 3ZOPA 1H47A 5EZYB 1H7MA 4LNUA 1ZWZA 2RB9A 3NK6A 4TV9B 1M1KH 1VQ4F 1M90H 2HP0A 3CYQA 2B33A 4F6RB 1VQNF 1U3LA 1NQ3A 3SIUA 4C81A 3CCRF 3IEQA 3CB2A 3OBWA 4X1IA 5IT9M 4X1KB 3IKEA 2CVLA 1W5AA 4E6EA 4ERHA 3BYQA 2OHWA 5MN4A 4TUYB 1JN1A 1W2BF 5EIBD 5LOVA 4DRXB 3K2XA 1JJ2F 5JVDB 4O4LB 1Z5WA 3K0TA 2UYNB 3N2GA 3HKEB 4IIJA 4NUTA 1CN7A 3AGKA 1QU9A 3FD5A 1IV3A 5JH7B 3I55F 1Q81H 2GLZA 4BVTA 2PHNA 5LP6B 3RYCB 2HQSC 3C8LA 2HS4A 3K14A 4ZHQB 3C9TA 5GANK 2G9IA 4G4ZA 4ZI7A 1IV2A 2H8CA 2KTVA 2OTMA 1NMUB 2I6RA 3JAKA 3KE1A 1QD9A 3CMEF 2IQQA 3VYTC 3P4EA 3HKBB 1GX1A 2BTOA 2ZVYA 5IJ0B 3UT5A 4B45A 4RQOA 3C9RA 4HNAB 2HRUA 3WGNA 2N48A 3HKDB 4ZK7A 3HJWC 1VQ8F 3LWQC 4U3JB 5GIOC 5C8YA 3JAWA 1IV4A 2Z01A 3JCMM 1X7OA 4WBNB 3KJKA 4BT2A 1NJIH 3ERNA 3CC7F 5GONB 3C9UA 1QVFF 2GZLA 2VAPA 5IJ9A 3JALB 3VYSC 5HY1A 4O4HB 4G4XA 3I3FA 2OZBA 1XRGA 5DCVA 3HKCA 3CCJF 3ELCA 5JCOA 3WGKA 4BT3A 5GIPC 2OTJF 4B5CA 3JVHA 4I4TB 4G4WA 3S0HA 1VQLF 3NMUC 1J7HA 1ODEA 2RHLA 4X20A 1U43A 2R6R1 1W41A 2AIFA 1PXWA 2RHJA 5LP6C 2HS3A 4G4VA 2NMUA 1YQNA 2UYKA 5A2QM 2VAMA 5JVDA 5CA1A 3C9SA 4C8EA 2ZAUA 1FSZA 4O4JB 4PWTA 4IHJB 2EWCA 5ITZB 2W8BC 2L26A 3N2KB 3QUWA 3PAFA 2CSLA 5HY0A 2KGWA 1XBIA 3E20B 3E1YA 3ZP7A 4ZHQA 1FFXB 5HP8A 5G4UC 5EAZA 1VQOF 3V7EA 3JATB 2H6LA 4XCQA 4YJ3B 3RYIB 1X25A 1YHQF 1GO0A 4TV8A 1XV2A 4DXDA 2UZHA 3PLAC 4ZHYB 3F0GA 1DBFA 2RHHA 5IJ0A 1K73H 2F9ZC 5GINC 3JARB 4HNAA 3GYQA 3RE3A 4I55B 1UFYA 1RA4A 1TVKB 3MCAB 4I50B 2HS0A 2WALA 3LWOC 4ZOLB 1W42A 3KIZA 3F0DA 2DYYA 4O2AA 4BT4A 3ESJA 3KJJA 4G88A 3GHZA 3QHDA 1W59A 5G4VC 5LXTA 4WBNA 3OBYA 1SA0A 1T0AA 5EB0A 3WGLA 4FFBA 5GONA 3RYHB 3S0YA 4C8IA 5HY2A 3JALA 2UYJA 1KNKA 5BMVB 4O4HA 1JD1A 2BTUA 5KX5B 3RA6A 3OW2F 1COMA 3F0EA 5HXUA 3TD3A 4BVRA 3VOBA 3CC4F 5CA0A 1TUBB 3E22A 3ZO8A 2CZWA 1JFFB 2DT4A 3RYFB 3ZP4A 1IV1A 1Q7YH 3V4DA 3JASB 4TZZA 2Q1XA 1YJNF 5LYJB 4O4IB 1VQMF 1K8AH 1W5BA 3CG6A 4BW0B 4EI8A 1VQ9F 1SDSA 1SZQA 1W55A 4EB6B 2K1SA 2LCAA 4KWEA 4O4JA 1YJWF 3KHNA 1FNKA 2ZF8A 2CWJA 4O2BB 5HXZA 4R40B 1S72F 3N2KA 3HWUA 3WJRA 3J81M 2QA4F 1Z5VA 3U0OA 3CCVF 3WPWA 4LCKA 2HP0B 5FNVB 5EZYA 4B62A 1VHAA 1FFXA 3DC2A 2AMTA 2Z1TA 3D01A 4TV9A 2UYPA 5J2UB 2ZOVA 3CCEF 3IMPA 3JATA 4YJ3A 2GVIA 3G4SF 3LWPC 2HX0A 4RHAA 4F6RA 4X1IB 1E7KA 2BTQB 3P0ZA 3HAXD 3LYBA 2P6YA 4I55A 3F6MA 1RQ7A 2QEXF 3CC2F 4X1KA 4I50A 2I6DA 3CCUF 4YJ2B 5LOVB 3B6NA 4ZOLA 4G4YA 4TUYA 3CCSF 2CW4A 3FPIA 1W40A 1W3EX 4DRXA 5KMGB 1KC8H 2PMPA 1OAPA 5FLXM 5MN6A 4O4LA 3K12A 4C82A 2VGMA 2UYNA 3HKEA 2ALEA 5BMVA 3S0WA 2MQEA 3CYPB 4BT7A 5JH7A 5KX5A 3VCZA 5LP6A 3I56F 3RYCA 3JAKB 3S02A 1Q86H 4ZHVA 3CCLF 3NVIB 1TUBA 1VH8A 1H48A 2RHOA 3RYFA 3WJQA
chains in the Genus database with same CATH topology
3OBYA 3J7AR 5FJ4C 3NK7A 3NVKE 1RLGA 1GZ0A 2QI2A 2KG4A 5HY2A 3G6EF 1VQ6F 3IR9A 3ON1A 4EI9A 2JNBA 3RA6A 1X52A 3OW2F 3FFMA 1N8RH 5HXUA 5EWRA 3HJWC 3JAMM 4BVRA 1VQ8F 3VMFB 3LWQC 1GO1A 3CC4F 3SIVA 2OTLF 1T0KB 2CZWA 5GIOC 1VQ5F 3O85A 1DT9A 3CCMF 3JCMM 1X7OA 2FGYA 1VQPF 1Q7YH 5HY4A 3CD6F 3J80M 1NJIH 4TZZA 3N4ZA 4BVSA 1YJNF 3CC7F 1QVFF 1VQMF 1KQSF 1YJ9F 1K8AH 3CG6A 4BW0B 4EI8A 5GAPK 1VQ7F 3CMAF 5HY1A 1YI2F 1VQ9F 1KD1H 1SDSA 2OZBA 1QVGF 3CXCF 5DCVA 3CCJF 3LWVC 3V7QA 5GIPC 5HWEA 2HVYD 1YJWF 1YIJF 1Q82H 2OTJF 4NQ3A 1VQKF 1VQLF 3NMUC 5HXZA 1S72F 2QA4F 3J81M 3LWRC 3CCVF 4LCKA 1H7MA 1ZWZA 3NK6A 1X7PA 1M1KH 1VQ4F 3RA5A 1M90H 1W41A 2AIFA 1PXWA 2VGNA 3CCEF 5A2QM 3WXMB 1VQNF 3G4SF 3LWPC 3SIUA 1K9MH 4X3LA 1E7KA 3V3TA 3CCRF 3HAXD 3OBWA 5EO3A 2BO1A 3LFOA 3CPWF 4BY9D 3PAFA 5IT9M 5HY0A 1XBIA 3E20B 2QEXF 3E1YA 3CC2F 2I6DA 3CCUF 5G4UC 3N4YA 2OHWA 3G71F 4EI7A 1VQOF 3V7EA 1W2BF 3CCQF 4XCQA 4C4WC 3CCSF 1YHQF 1JJ2F 1GO0A 1W40A 1W3EX 1KC8H 3PLAC 5FLXM 1IPAA 4X3MA 2KTUA 4NUTA 1K73H 1CN7A 2F9ZC 2FC3A 2VGMA 3AGKA 5GINC 3I55F 1YITF 1Q81H 2GLZA 2ALEA 3GYQA 4BVTA 2LBWA 3CPQA 1RA4A 3LWOC 3MCAB 2WALA 5GANK 3I56F 1W42A 1CK2A 3VI6A 1Q86H 3CCLF 3NVIB 2KTVA 1NMUB 4BVQA 3D00A 2LBXA 3CMEF 5G4VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBY A;  3J7A R;  5FJ4 C;  3NK7 A;  3NVK E;  1RLG A;  1GZ0 A;  2QI2 A;  2KG4 A;  3G6E F;  1VQ6 F;  3IR9 A;  3ON1 A;  2JNB A;  3RA6 A;  1X52 A;  3OW2 F;  3FFM A;  1N8R H;  5EWR A;  3HJW C;  3JAM M;  1VQ8 F;  3VMF B;  3LWQ C;  1GO1 A;  3CC4 F;  2OTL F;  1T0K B;  2CZW A;  5GIO C;  1VQ5 F;  3O85 A;  1DT9 A;  3CCM F;  3JCM M;  1X7O A;  1VQP F;  1Q7Y H;  3CD6 F;  3J80 M;  1NJI H;  4TZZ A;  3N4Z A;  1YJN F;  3CC7 F;  1QVF F;  1VQM F;  1KQS F;  1YJ9 F;  1K8A H;  3CG6 A;  4BW0 B;  5GAP K;  1VQ7 F;  1VQ9 F;  3CMA F;  1YI2 F;  3SIV A;  1KD1 H;  1SDS A;  2OZB A;  1QVG F;  3CXC F;  5DCV A;  3CCJ F;  3LWV C;  3V7Q A;  5GIP C;  2HVY D;  2OTJ F;  1YJW F;  1YIJ F;  1Q82 H;  1VQK F;  1VQL F;  3NMU C;  1S72 F;  2QA4 F;  3J81 M;  3LWR C;  3CCV F;  4LCK A;  1H7M A;  1ZWZ A;  3NK6 A;  1X7P A;  1M1K H;  1VQ4 F;  3RA5 A;  1M90 H;  1W41 A;  2AIF A;  1PXW A;  2VGN A;  3CCE F;  5A2Q M;  3WXM B;  1VQN F;  3G4S F;  3LWP C;  3SIU A;  1K9M H;  4X3L A;  1E7K A;  3CCR F;  3HAX D;  3OBW A;  5EO3 A;  2BO1 A;  3LFO A;  3CPW F;  4BY9 D;  3PAF A;  5IT9 M;  1XBI A;  3E20 B;  2QEX F;  3E1Y A;  3CC2 F;  2I6D A;  3CCU F;  5G4U C;  3N4Y A;  2OHW A;  3G71 F;  1VQO F;  3V7E A;  1W2B F;  3CCQ F;  4C4W C;  3CCS F;  1YHQ F;  1JJ2 F;  1GO0 A;  1W40 A;  1W3E X;  1KC8 H;  3PLA C;  5FLX M;  1IPA A;  4X3M A;  2KTU A;  4NUT A;  1K73 H;  1CN7 A;  2FC3 A;  2VGM A;  3AGK A;  5GIN C;  3I55 F;  1YIT F;  1Q81 H;  2ALE A;  3GYQ A;  2LBW A;  3CPQ A;  1RA4 A;  3LWO C;  3MCA B;  2WAL A;  5GAN K;  3I56 F;  1W42 A;  1CK2 A;  3VI6 A;  1Q86 H;  3CCL F;  3NVI B;  2KTV A;  1NMU B;  2LBX A;  3CME F;  5G4V C; 
#chains in the Genus database with same CATH topology
 3UT5 B;  3FBA A;  3I7T A;  3J7A R;  5FJ4 C;  3JAS A;  5B8F A;  5MN5 A;  3HKB A;  5LYJ A;  1RLG A;  2KG4 A;  1VQ6 F;  1QAH A;  3L7Q A;  5IYZ B;  4EI9 A;  3WGM A;  4B46 A;  3FFM A;  4C8G A;  3WJP A;  5C8Y B;  3JAW B;  3VMF B;  3D54 A;  4O2B A;  3HKD A;  3M1X A;  3MCQ A;  4M8I A;  1VQ5 F;  4NWO B;  4U3J A;  1DT9 A;  3MDO A;  5HP7 A;  1VQP F;  5HY4 A;  5FNV A;  3TD4 A;  3J80 M;  5J2T B;  4BVS A;  5IJ9 B;  3LDT A;  5CB4 B;  3LME A;  5J2U A;  5EB1 B;  3HKC B;  3CMA F;  1XHO A;  1YGY A;  3VO8 A;  1KD1 H;  1QVG F;  5EYP B;  3LWV C;  1Q8R A;  3IEW A;  3T80 A;  5HWE A;  1YIJ F;  1Q82 H;  4NQ3 A;  1VQK F;  4X20 B;  5JQG B;  4X1Y B;  1FNJ A;  3LWR C;  4I4T A;  3WPX A;  3DDN A;  1JY8 A;  1X7P A;  3RA5 A;  4YJ2 A;  3VOA A;  5CA1 B;  2VGN A;  2ZOD A;  5LA6 B;  3WXM B;  1CLI A;  5KMG A;  1K9M H;  4X3L A;  2ZVZ A;  3S03 A;  3V3T A;  3VTI C;  5EO3 A;  1RQ2 A;  2BO1 A;  3LFO A;  4IHJ A;  3CPW F;  4BY9 D;  5ITZ A;  2Q1Y A;  4LNU B;  2YYE A;  2Z1U A;  3FD6 A;  3N4Y A;  4ZHW A;  3G71 F;  4EI7 A;  2AIZ P;  1U3P A;  3HTN A;  2QTP A;  1W5F A;  4TV8 B;  3MBM A;  3CCQ F;  4C4W C;  4U39 A;  4BT6 A;  2H8E A;  3OON A;  3RYI A;  4BT5 A;  1IPA A;  1U40 A;  2KTU A;  4X3M A;  2CHT A;  3TD5 A;  1W58 1;  2FC3 A;  3P10 A;  1YIT F;  3VYU C;  3MQW A;  5IYZ A;  3VIU A;  2LBW A;  3JAR A;  3EOR A;  3CPQ A;  1VQV A;  2V9Y A;  4O2A B;  1W5E A;  1CK2 A;  3VI6 A;  2Z1F A;  5JCO C;  1RLU A;  3S06 A;  1TVK A;  5LXT B;  3F0F A;  3M4S A;  4BVQ A;  1SA0 B;  3D00 A;  2LBX A;  1UI9 A;  4FFB B;  2LBT A;  3N2G B;  5J2T A;  2VXY A;  3NK7 A;  1OFU A;  4IIJ B;  3NVK E;  2HP3 A;  1GZ0 A;  5AVM A;  5CB4 A;  2QI2 A;  3WGJ A;  2YXZ A;  3G6E F;  3IR9 A;  3ON1 A;  3R0P A;  3RYH A;  2Z1E A;  5EIB C;  2JNB A;  5EYP A;  1X52 A;  1N8R H;  2VAW A;  5CA0 B;  5EWR A;  2IG8 A;  3E22 B;  3JAM M;  2HRY A;  1ONI A;  1R1M A;  4ZI7 B;  1GO1 A;  2IAF A;  3QTY A;  5JQG A;  1PF5 A;  2OTL F;  4X1Y A;  1T0K B;  3O85 A;  1W57 A;  3CCM F;  1VK3 A;  2FGY A;  3Q8H A;  3CD6 F;  1KNJ A;  3N4Z A;  1JFF A;  3M84 A;  1KQS F;  1YJ9 F;  3IKF A;  3SIV A;  5GAP K;  1VQ7 F;  1YI2 F;  5LA6 A;  4O4I A;  3CXC F;  3V7Q A;  2HVY D;  3GTZ A;  2CHS A;  4EB6 A;  2R75 1;  3ZOP A;  1H47 A;  5EZY B;  1H7M A;  4LNU A;  1ZWZ A;  2RB9 A;  3NK6 A;  4TV9 B;  1M1K H;  1VQ4 F;  1M90 H;  2HP0 A;  3CYQ A;  2B33 A;  4F6R B;  1VQN F;  1U3L A;  1NQ3 A;  3SIU A;  4C81 A;  3CCR F;  3IEQ A;  3CB2 A;  3OBW A;  4X1I A;  5IT9 M;  4X1K B;  3IKE A;  2CVL A;  1W5A A;  4E6E A;  4ERH A;  3BYQ A;  2OHW A;  5MN4 A;  4TUY B;  1JN1 A;  1W2B F;  5EIB D;  5LOV A;  4DRX B;  3K2X A;  1JJ2 F;  5JVD B;  4O4L B;  1Z5W A;  3K0T A;  2UYN B;  3N2G A;  3HKE B;  4IIJ A;  4NUT A;  1CN7 A;  3AGK A;  1QU9 A;  3FD5 A;  1IV3 A;  5JH7 B;  3I55 F;  1Q81 H;  2GLZ A;  4BVT A;  2PHN A;  5LP6 B;  3RYC B;  2HQS C;  3C8L A;  2HS4 A;  3K14 A;  4ZHQ B;  3C9T A;  5GAN K;  2G9I A;  4G4Z A;  4ZI7 A;  1IV2 A;  2H8C A;  2KTV A;  2OTM A;  1NMU B;  2I6R A;  3JAK A;  3KE1 A;  1QD9 A;  3CME F;  2IQQ A;  3VYT C;  3P4E A;  3HKB B;  1GX1 A;  2BTO A;  2ZVY A;  5IJ0 B;  3UT5 A;  4B45 A;  4RQO A;  3C9R A;  4HNA B;  2HRU A;  3WGN A;  2N48 A;  3HKD B;  4ZK7 A;  3HJW C;  1VQ8 F;  3LWQ C;  4U3J B;  5GIO C;  5C8Y A;  3JAW A;  1IV4 A;  2Z01 A;  3JCM M;  1X7O A;  4WBN B;  3KJK A;  4BT2 A;  1NJI H;  3ERN A;  3CC7 F;  5GON B;  3C9U A;  1QVF F;  2GZL A;  2VAP A;  5IJ9 A;  3JAL B;  3VYS C;  5HY1 A;  4O4H B;  4G4X A;  3I3F A;  2OZB A;  1XRG A;  5DCV A;  3HKC A;  3CCJ F;  3ELC A;  5JCO A;  3WGK A;  4BT3 A;  5GIP C;  2OTJ F;  4B5C A;  3JVH A;  4I4T B;  4G4W A;  3S0H A;  1VQL F;  3NMU C;  1J7H A;  1ODE A;  2RHL A;  4X20 A;  1U43 A;  2R6R 1;  1W41 A;  2AIF A;  1PXW A;  2RHJ A;  5LP6 C;  2HS3 A;  4G4V A;  2NMU A;  1YQN A;  2UYK A;  5A2Q M;  2VAM A;  5JVD A;  5CA1 A;  3C9S A;  4C8E A;  2ZAU A;  1FSZ A;  4O4J B;  4PWT A;  4IHJ B;  2EWC A;  5ITZ B;  2W8B C;  2L26 A;  3N2K B;  3QUW A;  3PAF A;  2CSL A;  5HY0 A;  2KGW A;  1XBI A;  3E20 B;  3E1Y A;  3ZP7 A;  4ZHQ A;  1FFX B;  5HP8 A;  5G4U C;  5EAZ A;  1VQO F;  3V7E A;  3JAT B;  2H6L A;  4XCQ A;  4YJ3 B;  3RYI B;  1X25 A;  1YHQ F;  1GO0 A;  4TV8 A;  1XV2 A;  4DXD A;  2UZH A;  3PLA C;  4ZHY B;  3F0G A;  1DBF A;  2RHH A;  5IJ0 A;  1K73 H;  2F9Z C;  5GIN C;  3JAR B;  4HNA A;  3GYQ A;  3RE3 A;  4I55 B;  1UFY A;  1RA4 A;  1TVK B;  3MCA B;  4I50 B;  2HS0 A;  2WAL A;  3LWO C;  4ZOL B;  1W42 A;  3KIZ A;  3F0D A;  2DYY A;  4O2A A;  4BT4 A;  3ESJ A;  3KJJ A;  4G88 A;  3GHZ A;  3QHD A;  1W59 A;  5G4V C;  5LXT A;  4WBN A;  3OBY A;  1SA0 A;  1T0A A;  5EB0 A;  3WGL A;  4FFB A;  5GON A;  3RYH B;  3S0Y A;  4C8I A;  5HY2 A;  3JAL A;  2UYJ A;  1KNK A;  5BMV B;  4O4H A;  1JD1 A;  2BTU A;  5KX5 B;  3RA6 A;  3OW2 F;  1COM A;  3F0E A;  5HXU A;  3TD3 A;  4BVR A;  3VOB A;  3CC4 F;  5CA0 A;  1TUB B;  3E22 A;  3ZO8 A;  2CZW A;  1JFF B;  2DT4 A;  3RYF B;  3ZP4 A;  1IV1 A;  1Q7Y H;  3V4D A;  3JAS B;  4TZZ A;  2Q1X A;  1YJN F;  5LYJ B;  4O4I B;  1VQM F;  1K8A H;  1W5B A;  3CG6 A;  4BW0 B;  4EI8 A;  1VQ9 F;  1SDS A;  1SZQ A;  1W55 A;  4EB6 B;  2K1S A;  2LCA A;  4KWE A;  4O4J A;  1YJW F;  3KHN A;  1FNK A;  2ZF8 A;  2CWJ A;  4O2B B;  5HXZ A;  4R40 B;  1S72 F;  3N2K A;  3HWU A;  3WJR A;  3J81 M;  2QA4 F;  1Z5V A;  3U0O A;  3CCV F;  3WPW A;  4LCK A;  2HP0 B;  5FNV B;  5EZY A;  4B62 A;  1VHA A;  1FFX A;  3DC2 A;  2AMT A;  2Z1T A;  3D01 A;  4TV9 A;  2UYP A;  5J2U B;  2ZOV A;  3CCE F;  3IMP A;  3JAT A;  4YJ3 A;  2GVI A;  3G4S F;  3LWP C;  2HX0 A;  4RHA A;  4F6R A;  4X1I B;  1E7K A;  2BTQ B;  3P0Z A;  3HAX D;  3LYB A;  2P6Y A;  4I55 A;  3F6M A;  1RQ7 A;  2QEX F;  3CC2 F;  4X1K A;  4I50 A;  2I6D A;  3CCU F;  4YJ2 B;  5LOV B;  3B6N A;  4ZOL A;  4G4Y A;  4TUY A;  3CCS F;  2CW4 A;  3FPI A;  1W40 A;  1W3E X;  4DRX A;  5KMG B;  1KC8 H;  2PMP A;  1OAP A;  5FLX M;  5MN6 A;  4O4L A;  3K12 A;  4C82 A;  2VGM A;  2UYN A;  3HKE A;  2ALE A;  5BMV A;  3S0W A;  2MQE A;  3CYP B;  4BT7 A;  5JH7 A;  5KX5 A;  3VCZ A;  5LP6 A;  3I56 F;  3RYC A;  3JAK B;  3S02 A;  1Q86 H;  4ZHV A;  3CCL F;  3NVI B;  1TUB A;  1VH8 A;  1H48 A;  2RHO A;  3RYF A;  3WJQ A; 
#chains in the Genus database with same CATH homology
 3OBY A;  3J7A R;  5FJ4 C;  3NK7 A;  3NVK E;  1RLG A;  1GZ0 A;  2QI2 A;  2KG4 A;  5HY2 A;  3G6E F;  1VQ6 F;  3IR9 A;  3ON1 A;  4EI9 A;  2JNB A;  3RA6 A;  1X52 A;  3OW2 F;  3FFM A;  1N8R H;  5HXU A;  5EWR A;  3HJW C;  3JAM M;  4BVR A;  1VQ8 F;  3VMF B;  3LWQ C;  1GO1 A;  3CC4 F;  3SIV A;  2OTL F;  1T0K B;  2CZW A;  5GIO C;  1VQ5 F;  3O85 A;  1DT9 A;  3CCM F;  3JCM M;  1X7O A;  2FGY A;  1VQP F;  1Q7Y H;  5HY4 A;  3CD6 F;  3J80 M;  1NJI H;  4TZZ A;  3N4Z A;  4BVS A;  1YJN F;  3CC7 F;  1QVF F;  1VQM F;  1KQS F;  1YJ9 F;  1K8A H;  3CG6 A;  4BW0 B;  4EI8 A;  5GAP K;  1VQ7 F;  3CMA F;  5HY1 A;  1YI2 F;  1VQ9 F;  1KD1 H;  1SDS A;  2OZB A;  1QVG F;  3CXC F;  5DCV A;  3CCJ F;  3LWV C;  3V7Q A;  5GIP C;  5HWE A;  2HVY D;  1YJW F;  1YIJ F;  1Q82 H;  2OTJ F;  4NQ3 A;  1VQK F;  1VQL F;  3NMU C;  5HXZ A;  1S72 F;  2QA4 F;  3J81 M;  3LWR C;  3CCV F;  4LCK A;  1H7M A;  1ZWZ A;  3NK6 A;  1X7P A;  1M1K H;  1VQ4 F;  3RA5 A;  1M90 H;  1W41 A;  2AIF A;  1PXW A;  2VGN A;  3CCE F;  5A2Q M;  3WXM B;  1VQN F;  3G4S F;  3LWP C;  3SIU A;  1K9M H;  4X3L A;  1E7K A;  3V3T A;  3CCR F;  3HAX D;  3OBW A;  5EO3 A;  2BO1 A;  3LFO A;  3CPW F;  4BY9 D;  3PAF A;  5IT9 M;  5HY0 A;  1XBI A;  3E20 B;  2QEX F;  3E1Y A;  3CC2 F;  2I6D A;  3CCU F;  5G4U C;  3N4Y A;  2OHW A;  3G71 F;  4EI7 A;  1VQO F;  3V7E A;  1W2B F;  3CCQ F;  4XCQ A;  4C4W C;  3CCS F;  1YHQ F;  1JJ2 F;  1GO0 A;  1W40 A;  1W3E X;  1KC8 H;  3PLA C;  5FLX M;  1IPA A;  4X3M A;  2KTU A;  4NUT A;  1K73 H;  1CN7 A;  2F9Z C;  2FC3 A;  2VGM A;  3AGK A;  5GIN C;  3I55 F;  1YIT F;  1Q81 H;  2GLZ A;  2ALE A;  3GYQ A;  4BVT A;  2LBW A;  3CPQ A;  1RA4 A;  3LWO C;  3MCA B;  2WAL A;  5GAN K;  3I56 F;  1W42 A;  1CK2 A;  3VI6 A;  1Q86 H;  3CCL F;  3NVI B;  2KTV A;  1NMU B;  4BVQ A;  3D00 A;  2LBX A;  3CME F;  5G4V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...