3RA6A

Crystal structure of t. celer l30e e62a/k46a variant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIAEDIEYYARLSGIPVYAFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Stabilizing salt-bridge enhances protein thermostability by reducing the heat capacity change of unfolding
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 27
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ra6A00
2WALA 3RA6A 2KTUA 5A2QM 3MCAB 2KG4A 3CPQA 1Q82H 3G6EF 3N4ZA 3SIUA 1K8AH 2VGMA 5FLXM 5GAPK 3CCQF 1XBIA 1VQNF 2HVYD 3NVKE 3VI6A 5IT9M 1YIJF 3CCJF 1N8RH 3V7EA 1K73H 3G4SF 1Q86H 1VQKF 4BY9D 1VQ5F 1IPAA 3N4YA 4TZZA 1VQ4F 5DCVA 1PXWA 2CZWA 2QI2A 3I55F 2JNBA 2FC3A 3J81M 1VQ6F 1YI2F 5GANK 3NK7A 3I56F 2OTLF 1KD1H 1S72F 3G71F 2OTJF 3CCLF 3PLAC 3CCUF 3OBYA 1CN7A 3CCSF 3CPWF 3OW2F 4BW0B 1GO1A 1CK2A 3LFOA 1W41A 2OZBA 3J7AR 1GZ0A 1X7OA 1K9MH 3NMUC 3JCMM 2AIFA 1T0KB 3HAXD 1SDSA 3CMEF 1RA4A 1RLGA 1VQPF 1M1KH 1VQ8F 3O85A 3ON1A 3V7QA 1KC8H 4NUTA 3E20B 1H7MA 5GIOC 4X3MA 3LWPC 3VMFB 3WXMB 3LWOC 1KQSF 1VQ7F 2QEXF 3CXCF 3CCEF 1QVFF 1Q81H 4X3LA 5G4VC 3CG6A 4C4WC 1W2BF 1DT9A 1W40A 3CCRF 1YJWF 3CCVF 2BO1A 3GYQA 2ALEA 1NJIH 1YJNF 3CC2F 3JAMM 1W3EX 1X52A 5GINC 1YJ9F 3J80M 1YITF 1JJ2F 1QVGF 1ZWZA 3CC4F 1E7KA 1NMUB 3SIVA 1W42A 2I6DA 3E1YA 3CMAF 1YHQF 5GIPC 5G4UC 2LBXA 3PAFA 2LBWA 2VGNA 2KTVA 1Q7YH 1GO0A 1VQOF 3OBWA 3NK6A 3CCMF 3LWQC 1VQMF 1VQ9F 5EO3A 5EWRA 2QA4F 1M90H 3HJWC 1X7PA 3IR9A 3LWVC 3RA5A 1VQLF 3AGKA 3CC7F 3NVIB 5FJ4C 2OHWA 3CD6F 3FFMA 3LWRC 4LCKA
chains in the Genus database with same CATH superfamily
5CA0A 5A2QM 2UYNA 3JASB 5LOVA 2LBTA 3C9TA 4B62A 3S02A 1Q82H 3WPXA 3SIUA 1K8AH 2VGMA 2HVYD 1J7HA 1N8RH 3K0TA 4U3JA 2Q1XA 5EAZA 1K73H 1JN1A 2PMPA 4BY9D 5HXZA 3U0OA 1SA0A 1QU9A 1VQ5F 1IPAA 5BMVA 2G9IA 5EZYB 2HS4A 2ZVZA 2CZWA 2VXYA 4C81A 2JNBA 4TUYA 1VQ6F 1YI2F 3UT5B 3NK7A 3BYQA 3G71F 3CCLF 3I7TA 4EI7A 4ZHWA 1W5EA 2DT4A 3OW2F 5IJ9A 3VYSC 1GO1A 1CK2A 3J7AR 1GZ0A 1Z5VA 1K9MH 5KX5B 3K2XA 2HS3A 1SDSA 4EI8A 3JATB 5EZYA 4C8GA 2RHOA 4NUTA 3E20B 2CWJA 4FFBA 5GIOC 1VQ7F 2H6LA 3UT5A 4ZOLA 2QEXF 4YJ3B 2HX0A 1KNKA 1UFYA 3IMPA 1DT9A 1W40A 2ZF8A 3E22B 1SZQA 4WBNB 2BTUA 1FFXB 5IJ0A 3CC2F 3JAMM 3LMEA 5LYJB 3HTNA 2ZAUA 3FD6A 5KX5A 1RQ7A 1JJ2F 3MQWA 3JATA 4BT7A 1DBFA 3T80A 3SIVA 2UYKA 4G4VA 4G4YA 1U40A 2I6DA 3P4EA 3CMAF 1W5AA 5G4UC 3HKEB 1VHAA 3R0PA 3F6MA 2KGWA 5EIBC 3RYIB 5LXTA 2CVLA 2HP3A 4O2BB 3WJPA 3P0ZA 3KHNA 3E22A 2CHSA 3I3FA 5EYPB 5JCOA 1X7PA 1FFXA 3IR9A 4BVSA 5MN5A 5LYJA 4NQ3A 5GONA 3HKDB 3CB2A 4TV9A 5FJ4C 4O2AB 4LCKA 2UZHA 1W581 2KTUA 3RE3A 5CA0B 3OONA 1PF5A 5CA1B 2Z1TA 3CYPB 3HKEA 4F6RA 3G6EF 1FNJA 3N4ZA 4LNUB 5FLXM 3CCQF 1XBIA 2Q1YA 2ZOVA 2CW4A 3IKFA 3RYHA 1VQNF 5J2TB 1YIJF 3CCJF 1VH8A 3M84A 3G4SF 1Q86H 3TD4A 4O2AA 3HKBB 3JAKA 3N4YA 1YGYA 1VQ4F 2F9ZC 5BMVB 1PXWA 2HQSC 3FFMA 4EB6A 2BTQB 5CA1A 3J81M 2GLZA 4TUYB 3VTIC 3S0HA 3C8LA 4LNUA 5EB1B 5JCOC 3I56F 1KD1H 3OBYA 2HRYA 5MN4A 2RHHA 3S06A 4BT4A 5J2TA 3CCSF 1QAHA 2ZODA 5IJ9B 2I6RA 1RQ2A 3LFOA 2OZBA 4X1YA 3NMUC 3GTZA 3HKBA 1OFUA 2OTMA 1RA4A 4E6EA 1M1KH 1VQ8F 3V7QA 2H8EA 3CYQA 2R6R1 3ZP7A 2V9YA 1IV4A 4ZHQB 1W5BA 2RB9A 3K12A 4X3MA 1KQSF 3WXMB 3S03A 4FFBB 3IEWA 1XHOA 2Z1EA 4ZOLB 1TUBA 3CCEF 1Q81H 5HXUA 2K1SA 3CG6A 1W2BF 1JD1A 4O4IB 1YJWF 4ZI7B 3WGLA 3CCVF 4PWTA 1X25A 3IEQA 2ALEA 1YJNF 3JAWA 3KJKA 5IJ0B 1W5FA 1YJ9F 3J80M 1YITF 3CC4F 1NMUB 2IAFA 3V4DA 3WJRA 4G4XA 2RHLA 5B8FA 5IYZA 4I50A 4ZHQA 1H47A 5GIPC 1YQNA 2FGYA 2CSLA 1IV3A 3PAFA 5CB4A 2KTVA 1IV2A 2AIZP 3IKEA 5LXTB 5J2UB 3OBWA 3NK6A 5HP8A 5LP6A 1VQ9F 2R751 3DDNA 4O4IA 4ZI7A 2NMUA 3C9SA 2HP0B 3AGKA 5EIBD 4ZHVA 5GONB 3F0EA 3VCZA 4TV9B 4BT3A 3RA6A 1XRGA 4ZK7A 3TD3A 2KG4A 2W8BC 3HWUA 3RYCA 5AVMA 2Z1FA 3VOBA 1IV1A 2DYYA 4F6RB 5FNVA 5GAPK 4IHJB 2L26A 3QHDA 5J2UA 3VI6A 2HS0A 3JVHA 3RYHB 3VIUA 1H48A 3ZO8A 2RHJA 3ELCA 2HP0A 3D01A 5HP7A 3V7EA 4I55B 2IQQA 1VQKF 3WGJA 3M4SA 2HRUA 3JAKB 3C9UA 3GHZA 4G88A 1CLIA 3I55F 4IIJA 2FC3A 3KIZA 5LP6C 4EB6B 3F0DA 4KWEA 3LDTA 1QD9A 4O4HB 4HNAB 4IHJA 3JARA 1S72F 2Z1UA 3S0WA 4R40B 1W57A 4XCQA 3WJQA 2PHNA 3TD5A 2P6YA 2IG8A 4O4LB 4BT2A 3VO8A 1W41A 3JALB 1X7OA 4I55A 4X1YB 3QUWA 3D54A 5JVDB 3HAXD 3CMEF 1NQ3A 4ZHYB 4YJ2B 1RLGA 1VQPF 1TVKB 1COMA 3K14A 2VAWA 3DC2A 1H7MA 3MBMA 3VMFB 3RYFA 4O4HA 3MDOA 4HNAA 1XV2A 1OAPA 4I4TB 2AMTA 1QVFF 1TUBB 4O4JA 1ONIA 4X1KA 3GYQA 1ODEA 4O4LA 4B46A 1NJIH 3QTYA 1W3EX 5EB0A 3JALA 3JAWB 3ZP4A 3D00A 2GVIA 4DXDA 1ZWZA 4BVQA 5JVDA 1RLUA 3M1XA 4YJ2A 3Q8HA 1TVKA 4RQOA 3E1YA 5LA6A 1UI9A 4BT6A 3N2GB 5IYZB 4I50B 3WGMA 5CB4B 1KNJA 1Q7YH 1Z5WA 3F0GA 1JFFA 1GO0A 4I4TA 3CCMF 3FBAA 5LP6B 1W59A 5EO3A 3ZOPA 5JQGB 4DRXA 2BTOA 3RA5A 5HY2A 3WGKA 3CD6F 4RHAA 1Q8RA 3LWRC 3P10A 2MQEA 2VAPA 2WALA 2H8CA 3JASA 5HY4A 3ERNA 3MCAB 4TV8B 3N2GA 3CPQA 3RYCB 5HY0A 1R1MA 5FNVB 2YYEA 3NVKE 3VYTC 1U43A 4X1IB 5IT9M 3L7QA 5JQGA 5KMGB 3MCQA 3ESJA 1VK3A 5C8YB 1W55A 2LCAA 3EORA 4TZZA 5DCVA 4NWOB 3LYBA 4B45A 2QI2A 4TV8A 4IIJB 5JH7B 5GANK 3WPWA 2OTLF 4G4WA 2ZVYA 2QTPA 4M8IA 3JARB 2OTJF 3PLAC 3CCUF 3N2KB 4U39A 5HY1A 4X1IA 1CN7A 2UYJA 3CPWF 4BVTA 3WGNA 5KMGA 4BW0B 5ITZB 3C9RA 2YXZA 1SA0B 3JCMM 2AIFA 5C8YA 2EWCA 3VYUC 4C8IA 3FPIA 1T0KB 4G4ZA 1U3LA 3O85A 3ON1A 4BVRA 1KC8H 3LWPC 5JH7A 3LWOC 4YJ3A 3RYFB 3CXCF 3KJJA 5MN6A 4ERHA 4X3LA 5G4VC 4C4WC 2GZLA 4O4JB 1JY8A 3N2KA 3CCRF 4X1KB 2BO1A 4WBNA 2VAMA 4X20B 3V3TA 1T0AA 5ITZA 1X52A 2N48A 3VOAA 5GINC 4C82A 5HWEA 3HKCB 2Z01A 1QVGF 1E7KA 4EI9A 1W42A 2UYNB 5LOVB 1FNKA 3S0YA 5LA6B 1VQVA 1YHQF 2LBXA 2LBWA 2VGNA 3RYIA 4O2BA 4B5CA 1VQOF 3F0FA 1JFFB 3LWQC 4C8EA 1VQMF 1GX1A 1M90H 5EWRA 5EYPA 2QA4F 3HJWC 4X20A 1U3PA 3B6NA 2CHTA 4U3JB 3HKDA 4DRXB 3LWVC 2UYPA 1VQLF 3CC7F 1FSZA 3NVIB 2OHWA 3HKCA 3KE1A 2B33A 3FD5A 4BT5A
chains in the Genus database with same CATH topology
2WALA 3RA6A 2KTUA 5A2QM 5HY4A 3MCAB 2KG4A 3CPQA 1Q82H 3G6EF 5HY0A 3N4ZA 3SIUA 1K8AH 2VGMA 5FLXM 5GAPK 3CCQF 1XBIA 1VQNF 2HVYD 3NVKE 3VI6A 5IT9M 1YIJF 3CCJF 1N8RH 3V7EA 1K73H 3G4SF 1Q86H 1VQKF 4BY9D 5HXZA 1VQ5F 1IPAA 3N4YA 4TZZA 1VQ4F 5DCVA 2F9ZC 1PXWA 2CZWA 2QI2A 3I55F 2JNBA 2FC3A 3J81M 1VQ6F 2GLZA 1YI2F 5GANK 3NK7A 3I56F 2OTLF 1KD1H 1S72F 3G71F 2OTJF 3CCLF 3PLAC 3CCUF 3OBYA 4EI7A 5HY1A 1CN7A 3CCSF 4XCQA 3CPWF 3OW2F 4BVTA 4BW0B 1GO1A 1CK2A 3LFOA 1W41A 2OZBA 3J7AR 1GZ0A 1X7OA 1K9MH 3NMUC 3JCMM 2AIFA 1T0KB 3HAXD 1SDSA 3CMEF 1RA4A 4EI8A 1RLGA 1VQPF 1M1KH 1VQ8F 3O85A 3ON1A 3V7QA 4BVRA 1KC8H 4NUTA 3E20B 1H7MA 5GIOC 4X3MA 3LWPC 3VMFB 3WXMB 3LWOC 1KQSF 1VQ7F 2QEXF 3CXCF 3CCEF 1QVFF 1Q81H 5HXUA 4X3LA 5G4VC 3CG6A 4C4WC 1W2BF 1DT9A 1W40A 3CCRF 1YJWF 3CCVF 2BO1A 3GYQA 3V3TA 2ALEA 1NJIH 1YJNF 3CC2F 3JAMM 1W3EX 1X52A 5GINC 1YJ9F 3D00A 5HWEA 3J80M 1YITF 1JJ2F 1QVGF 1ZWZA 4BVQA 3CC4F 1E7KA 1NMUB 4EI9A 3SIVA 1W42A 2I6DA 3E1YA 3CMAF 1YHQF 5GIPC 5G4UC 2LBXA 2FGYA 3PAFA 2LBWA 2VGNA 2KTVA 1Q7YH 1GO0A 1VQOF 3OBWA 3NK6A 3CCMF 3LWQC 1VQMF 1VQ9F 5EO3A 5EWRA 2QA4F 1M90H 3HJWC 1X7PA 4BVSA 3IR9A 3LWVC 3RA5A 1VQLF 4NQ3A 3AGKA 5HY2A 3CC7F 3NVIB 5FJ4C 2OHWA 3CD6F 3FFMA 3LWRC 4LCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAL A;  3RA6 A;  2KTU A;  5A2Q M;  3MCA B;  2KG4 A;  3CPQ A;  1Q82 H;  3G6E F;  3N4Z A;  3SIU A;  1K8A H;  2VGM A;  5FLX M;  5GAP K;  3CCQ F;  1XBI A;  1VQN F;  2HVY D;  3NVK E;  3VI6 A;  5IT9 M;  1YIJ F;  3CCJ F;  1N8R H;  3V7E A;  1K73 H;  3G4S F;  1Q86 H;  1VQK F;  4BY9 D;  1VQ5 F;  1IPA A;  3N4Y A;  4TZZ A;  1VQ4 F;  5DCV A;  1PXW A;  2CZW A;  2QI2 A;  3I55 F;  2JNB A;  2FC3 A;  3J81 M;  1VQ6 F;  1YI2 F;  5GAN K;  3NK7 A;  3I56 F;  2OTL F;  1KD1 H;  1S72 F;  3G71 F;  2OTJ F;  3CCL F;  3PLA C;  3CCU F;  3OBY A;  1CN7 A;  3CCS F;  3CPW F;  3OW2 F;  4BW0 B;  1GO1 A;  1CK2 A;  3LFO A;  1W41 A;  2OZB A;  3J7A R;  1GZ0 A;  1X7O A;  1K9M H;  3NMU C;  3JCM M;  2AIF A;  1T0K B;  3HAX D;  1SDS A;  3CME F;  1RA4 A;  1RLG A;  1VQP F;  1M1K H;  1VQ8 F;  3O85 A;  3ON1 A;  3V7Q A;  1KC8 H;  4NUT A;  3E20 B;  1H7M A;  5GIO C;  4X3M A;  3LWP C;  3VMF B;  3WXM B;  3LWO C;  1KQS F;  1VQ7 F;  2QEX F;  3CXC F;  3CCE F;  1QVF F;  1Q81 H;  4X3L A;  5G4V C;  3CG6 A;  4C4W C;  1W2B F;  1DT9 A;  1W40 A;  3CCR F;  1YJW F;  3CCV F;  2BO1 A;  3GYQ A;  2ALE A;  1NJI H;  1YJN F;  3CC2 F;  3JAM M;  1W3E X;  1X52 A;  5GIN C;  1YJ9 F;  3J80 M;  1YIT F;  1JJ2 F;  1QVG F;  1ZWZ A;  3CC4 F;  1E7K A;  1NMU B;  3SIV A;  1W42 A;  2I6D A;  3E1Y A;  3CMA F;  1YHQ F;  5GIP C;  5G4U C;  2LBX A;  3PAF A;  2LBW A;  2VGN A;  2KTV A;  1Q7Y H;  1GO0 A;  1VQO F;  3OBW A;  3NK6 A;  3CCM F;  3LWQ C;  1VQM F;  1VQ9 F;  5EO3 A;  5EWR A;  2QA4 F;  1M90 H;  3HJW C;  1X7P A;  3IR9 A;  3LWV C;  3RA5 A;  1VQL F;  3AGK A;  3CC7 F;  3NVI B;  5FJ4 C;  2OHW A;  3CD6 F;  3FFM A;  3LWR C;  4LCK A; 
#chains in the Genus database with same CATH topology
 5CA0 A;  5A2Q M;  2UYN A;  3JAS B;  5LOV A;  2LBT A;  3C9T A;  4B62 A;  3S02 A;  1Q82 H;  3WPX A;  3SIU A;  1K8A H;  2VGM A;  2HVY D;  1J7H A;  1N8R H;  3K0T A;  4U3J A;  2Q1X A;  5EAZ A;  1K73 H;  1JN1 A;  2PMP A;  4BY9 D;  5HXZ A;  3U0O A;  1SA0 A;  1QU9 A;  1VQ5 F;  1IPA A;  5BMV A;  2G9I A;  5EZY B;  2HS4 A;  2ZVZ A;  2CZW A;  2VXY A;  4C81 A;  2JNB A;  4TUY A;  1VQ6 F;  1YI2 F;  3UT5 B;  3NK7 A;  3BYQ A;  3G71 F;  3CCL F;  3I7T A;  4EI7 A;  4ZHW A;  1W5E A;  2DT4 A;  3OW2 F;  5IJ9 A;  3VYS C;  1GO1 A;  1CK2 A;  3J7A R;  1GZ0 A;  1Z5V A;  1K9M H;  5KX5 B;  3K2X A;  2HS3 A;  1SDS A;  4EI8 A;  3JAT B;  5EZY A;  4C8G A;  2RHO A;  4NUT A;  3E20 B;  2CWJ A;  4FFB A;  5GIO C;  1VQ7 F;  2H6L A;  3UT5 A;  4ZOL A;  2QEX F;  4YJ3 B;  2HX0 A;  1KNK A;  1UFY A;  3IMP A;  1DT9 A;  1W40 A;  2ZF8 A;  3E22 B;  1SZQ A;  4WBN B;  2BTU A;  1FFX B;  5IJ0 A;  3CC2 F;  3JAM M;  3LME A;  5LYJ B;  3HTN A;  2ZAU A;  3FD6 A;  5KX5 A;  1RQ7 A;  1JJ2 F;  3MQW A;  3JAT A;  4BT7 A;  1DBF A;  3T80 A;  3SIV A;  2UYK A;  4G4V A;  4G4Y A;  1U40 A;  2I6D A;  3P4E A;  3CMA F;  1W5A A;  5G4U C;  3HKE B;  1VHA A;  3R0P A;  3F6M A;  2KGW A;  5EIB C;  3RYI B;  5LXT A;  2CVL A;  2HP3 A;  4O2B B;  3WJP A;  3P0Z A;  3KHN A;  3E22 A;  2CHS A;  3I3F A;  5EYP B;  5JCO A;  1X7P A;  1FFX A;  3IR9 A;  4BVS A;  5MN5 A;  5LYJ A;  4NQ3 A;  5GON A;  3HKD B;  3CB2 A;  4TV9 A;  5FJ4 C;  4O2A B;  4LCK A;  2UZH A;  1W58 1;  2KTU A;  3RE3 A;  5CA0 B;  3OON A;  1PF5 A;  5CA1 B;  2Z1T A;  3CYP B;  3HKE A;  4F6R A;  3G6E F;  1FNJ A;  3N4Z A;  4LNU B;  5FLX M;  3CCQ F;  1XBI A;  2Q1Y A;  2ZOV A;  2CW4 A;  3IKF A;  3RYH A;  1VQN F;  5J2T B;  1YIJ F;  3CCJ F;  1VH8 A;  3M84 A;  3G4S F;  1Q86 H;  3TD4 A;  4O2A A;  3HKB B;  3JAK A;  3N4Y A;  1YGY A;  1VQ4 F;  2F9Z C;  5BMV B;  1PXW A;  2HQS C;  3FFM A;  4EB6 A;  2BTQ B;  5CA1 A;  3J81 M;  2GLZ A;  4TUY B;  3VTI C;  3S0H A;  3C8L A;  4LNU A;  5EB1 B;  5JCO C;  3I56 F;  1KD1 H;  3OBY A;  2HRY A;  5MN4 A;  2RHH A;  3S06 A;  4BT4 A;  5J2T A;  3CCS F;  1QAH A;  2ZOD A;  5IJ9 B;  2I6R A;  1RQ2 A;  3LFO A;  2OZB A;  4X1Y A;  3NMU C;  3GTZ A;  3HKB A;  1OFU A;  2OTM A;  1RA4 A;  4E6E A;  1M1K H;  1VQ8 F;  3V7Q A;  2H8E A;  3CYQ A;  2R6R 1;  3ZP7 A;  2V9Y A;  1IV4 A;  4ZHQ B;  1W5B A;  2RB9 A;  3K12 A;  4X3M A;  1KQS F;  3WXM B;  3S03 A;  4FFB B;  3IEW A;  1XHO A;  2Z1E A;  4ZOL B;  1TUB A;  3CCE F;  1Q81 H;  5HXU A;  2K1S A;  3CG6 A;  1W2B F;  1JD1 A;  4O4I B;  1YJW F;  4ZI7 B;  3WGL A;  3CCV F;  4PWT A;  1X25 A;  3IEQ A;  2ALE A;  1YJN F;  3JAW A;  3KJK A;  5IJ0 B;  1W5F A;  1YJ9 F;  3J80 M;  1YIT F;  3CC4 F;  1NMU B;  2IAF A;  3V4D A;  3WJR A;  4G4X A;  2RHL A;  5B8F A;  5IYZ A;  4I50 A;  4ZHQ A;  1H47 A;  5GIP C;  1YQN A;  2FGY A;  2CSL A;  1IV3 A;  3PAF A;  5CB4 A;  2KTV A;  1IV2 A;  2AIZ P;  3IKE A;  5LXT B;  5J2U B;  3OBW A;  3NK6 A;  5HP8 A;  5LP6 A;  1VQ9 F;  2R75 1;  3DDN A;  4O4I A;  4ZI7 A;  2NMU A;  3C9S A;  2HP0 B;  3AGK A;  5EIB D;  4ZHV A;  5GON B;  3F0E A;  3VCZ A;  4TV9 B;  4BT3 A;  3RA6 A;  1XRG A;  4ZK7 A;  3TD3 A;  2KG4 A;  2W8B C;  3HWU A;  3RYC A;  5AVM A;  2Z1F A;  3VOB A;  1IV1 A;  2DYY A;  4F6R B;  5FNV A;  5GAP K;  4IHJ B;  2L26 A;  3QHD A;  5J2U A;  3VI6 A;  2HS0 A;  3JVH A;  3RYH B;  3VIU A;  1H48 A;  3ZO8 A;  2RHJ A;  3ELC A;  2HP0 A;  3D01 A;  5HP7 A;  3V7E A;  4I55 B;  2IQQ A;  1VQK F;  3WGJ A;  3M4S A;  2HRU A;  3JAK B;  3C9U A;  3GHZ A;  4G88 A;  1CLI A;  3I55 F;  4IIJ A;  2FC3 A;  3KIZ A;  5LP6 C;  4EB6 B;  3F0D A;  4KWE A;  3LDT A;  1QD9 A;  4O4H B;  4HNA B;  4IHJ A;  3JAR A;  1S72 F;  2Z1U A;  3S0W A;  4R40 B;  1W57 A;  4XCQ A;  3WJQ A;  2PHN A;  3TD5 A;  2P6Y A;  2IG8 A;  4O4L B;  4BT2 A;  3VO8 A;  1W41 A;  3JAL B;  1X7O A;  4I55 A;  4X1Y B;  3QUW A;  3D54 A;  5JVD B;  3HAX D;  3CME F;  1NQ3 A;  4ZHY B;  4YJ2 B;  1RLG A;  1VQP F;  1TVK B;  1COM A;  3K14 A;  2VAW A;  3DC2 A;  1H7M A;  3MBM A;  3VMF B;  3RYF A;  4O4H A;  3MDO A;  4HNA A;  1XV2 A;  1OAP A;  4I4T B;  2AMT A;  1QVF F;  1TUB B;  4O4J A;  1ONI A;  4X1K A;  3GYQ A;  1ODE A;  4O4L A;  4B46 A;  1NJI H;  3QTY A;  1W3E X;  5EB0 A;  3JAL A;  3JAW B;  3ZP4 A;  3D00 A;  2GVI A;  4DXD A;  1ZWZ A;  4BVQ A;  5JVD A;  1RLU A;  3M1X A;  4YJ2 A;  3Q8H A;  1TVK A;  4RQO A;  3E1Y A;  5LA6 A;  1UI9 A;  4BT6 A;  3N2G B;  5IYZ B;  4I50 B;  3WGM A;  5CB4 B;  1KNJ A;  1Q7Y H;  1Z5W A;  3F0G A;  1JFF A;  1GO0 A;  4I4T A;  3CCM F;  3FBA A;  5LP6 B;  1W59 A;  5EO3 A;  3ZOP A;  5JQG B;  4DRX A;  2BTO A;  3RA5 A;  5HY2 A;  3WGK A;  3CD6 F;  4RHA A;  1Q8R A;  3LWR C;  3P10 A;  2MQE A;  2VAP A;  2WAL A;  2H8C A;  3JAS A;  5HY4 A;  3ERN A;  3MCA B;  4TV8 B;  3N2G A;  3CPQ A;  3RYC B;  5HY0 A;  1R1M A;  5FNV B;  2YYE A;  3NVK E;  3VYT C;  1U43 A;  4X1I B;  5IT9 M;  3L7Q A;  5JQG A;  5KMG B;  3MCQ A;  3ESJ A;  1VK3 A;  5C8Y B;  1W55 A;  2LCA A;  3EOR A;  4TZZ A;  5DCV A;  4NWO B;  3LYB A;  4B45 A;  2QI2 A;  4TV8 A;  4IIJ B;  5JH7 B;  5GAN K;  3WPW A;  2OTL F;  4G4W A;  2ZVY A;  2QTP A;  4M8I A;  3JAR B;  2OTJ F;  3PLA C;  3CCU F;  3N2K B;  4U39 A;  5HY1 A;  4X1I A;  1CN7 A;  2UYJ A;  3CPW F;  4BVT A;  3WGN A;  5KMG A;  4BW0 B;  5ITZ B;  3C9R A;  2YXZ A;  1SA0 B;  3JCM M;  2AIF A;  5C8Y A;  2EWC A;  3VYU C;  4C8I A;  3FPI A;  1T0K B;  4G4Z A;  1U3L A;  3O85 A;  3ON1 A;  4BVR A;  1KC8 H;  3LWP C;  5JH7 A;  3LWO C;  4YJ3 A;  3RYF B;  3CXC F;  3KJJ A;  5MN6 A;  4ERH A;  4X3L A;  5G4V C;  4C4W C;  2GZL A;  4O4J B;  1JY8 A;  3N2K A;  3CCR F;  4X1K B;  2BO1 A;  4WBN A;  2VAM A;  4X20 B;  3V3T A;  1T0A A;  5ITZ A;  1X52 A;  2N48 A;  3VOA A;  5GIN C;  4C82 A;  5HWE A;  3HKC B;  2Z01 A;  1QVG F;  1E7K A;  4EI9 A;  1W42 A;  2UYN B;  5LOV B;  1FNK A;  3S0Y A;  5LA6 B;  1VQV A;  1YHQ F;  2LBX A;  2LBW A;  2VGN A;  3RYI A;  4O2B A;  4B5C A;  1VQO F;  3F0F A;  1JFF B;  3LWQ C;  4C8E A;  1VQM F;  1GX1 A;  1M90 H;  5EWR A;  5EYP A;  2QA4 F;  3HJW C;  4X20 A;  1U3P A;  3B6N A;  2CHT A;  4U3J B;  3HKD A;  4DRX B;  3LWV C;  2UYP A;  1VQL F;  3CC7 F;  1FSZ A;  3NVI B;  2OHW A;  3HKC A;  3KE1 A;  2B33 A;  3FD5 A;  4BT5 A; 
#chains in the Genus database with same CATH homology
 2WAL A;  3RA6 A;  2KTU A;  5A2Q M;  5HY4 A;  3MCA B;  2KG4 A;  3CPQ A;  1Q82 H;  3G6E F;  5HY0 A;  3N4Z A;  3SIU A;  1K8A H;  2VGM A;  5FLX M;  5GAP K;  3CCQ F;  1XBI A;  1VQN F;  2HVY D;  3NVK E;  3VI6 A;  5IT9 M;  1YIJ F;  3CCJ F;  1N8R H;  3V7E A;  1K73 H;  3G4S F;  1Q86 H;  1VQK F;  4BY9 D;  5HXZ A;  1VQ5 F;  1IPA A;  3N4Y A;  4TZZ A;  1VQ4 F;  5DCV A;  2F9Z C;  1PXW A;  2CZW A;  2QI2 A;  3I55 F;  2JNB A;  2FC3 A;  3J81 M;  1VQ6 F;  2GLZ A;  1YI2 F;  5GAN K;  3NK7 A;  3I56 F;  2OTL F;  1KD1 H;  1S72 F;  3G71 F;  2OTJ F;  3CCL F;  3PLA C;  3CCU F;  3OBY A;  4EI7 A;  5HY1 A;  1CN7 A;  3CCS F;  4XCQ A;  3CPW F;  3OW2 F;  4BVT A;  4BW0 B;  1GO1 A;  1CK2 A;  3LFO A;  1W41 A;  2OZB A;  3J7A R;  1GZ0 A;  1X7O A;  1K9M H;  3NMU C;  3JCM M;  2AIF A;  1T0K B;  3HAX D;  1SDS A;  3CME F;  1RA4 A;  4EI8 A;  1RLG A;  1VQP F;  1M1K H;  1VQ8 F;  3O85 A;  3ON1 A;  3V7Q A;  4BVR A;  1KC8 H;  4NUT A;  3E20 B;  1H7M A;  5GIO C;  4X3M A;  3LWP C;  3VMF B;  3WXM B;  3LWO C;  1KQS F;  1VQ7 F;  2QEX F;  3CXC F;  3CCE F;  1QVF F;  1Q81 H;  5HXU A;  4X3L A;  5G4V C;  3CG6 A;  4C4W C;  1W2B F;  1DT9 A;  1W40 A;  3CCR F;  1YJW F;  3CCV F;  2BO1 A;  3GYQ A;  3V3T A;  2ALE A;  1NJI H;  1YJN F;  3CC2 F;  3JAM M;  1W3E X;  1X52 A;  5GIN C;  1YJ9 F;  3D00 A;  5HWE A;  3J80 M;  1YIT F;  1JJ2 F;  1QVG F;  1ZWZ A;  4BVQ A;  3CC4 F;  1E7K A;  1NMU B;  4EI9 A;  3SIV A;  1W42 A;  2I6D A;  3E1Y A;  3CMA F;  1YHQ F;  5GIP C;  5G4U C;  2LBX A;  2FGY A;  3PAF A;  2LBW A;  2VGN A;  2KTV A;  1Q7Y H;  1GO0 A;  1VQO F;  3OBW A;  3NK6 A;  3CCM F;  3LWQ C;  1VQM F;  1VQ9 F;  5EO3 A;  5EWR A;  2QA4 F;  1M90 H;  3HJW C;  1X7P A;  4BVS A;  3IR9 A;  3LWV C;  3RA5 A;  1VQL F;  4NQ3 A;  3AGK A;  5HY2 A;  3CC7 F;  3NVI B;  5FJ4 C;  2OHW A;  3CD6 F;  3FFM A;  3LWR C;  4LCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...