3RA6A

Crystal structure of t. celer l30e e62a/k46a variant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIAEDIEYYARLSGIPVYAFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L30e
publication title Stabilizing salt-bridge enhances protein thermostability by reducing the heat capacity change of unfolding
pubmed doi rcsb
source organism Thermococcus celer
total genus 27
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ra6A00
3CCEF 1VQ4F 4C4WC 2OTJF 1X7PA 1IPAA 5DCVA 1RLGA 1KC8H 2VGNA 4BY9D 1VQMF 3JCMM 5IT9M 4X3LA 1KQSF 3MCAB 1VQ5F 3HJWC 1NJIH 5G4UC 1GZ0A 1CK2A 3FFMA 1W40A 1W41A 1PXWA 2KTVA 1DT9A 3CCJF 5GIOC 1VQ7F 1NMUB 3NK6A 3CD6F 3CXCF 3CCUF 3N4YA 1YIJF 1YHQF 2HVYD 5FLXM 1ZWZA 3CCMF 3G71F 5GANK 2OHWA 2OZBA 1VQPF 2ALEA 3N4ZA 5A2QM 1M90H 5EWRA 1JJ2F 2QI2A 3GYQA 3VI6A 3CCLF 1K9MH 1RA4A 3I56F 2QA4F 1VQLF 3V7QA 3RA5A 3CCQF 3LWVC 3OW2F 1M1KH 3O85A 3I55F 3IR9A 4BW0B 3G6EF 5GIPC 2LBWA 3J80M 3LWRC 3CMEF 3J7AR 4NUTA 3RA6A 2WALA 3CG6A 2I6DA 5GINC 1VQ9F 3V7EA 3E1YA 1VQOF 3CC2F 1E7KA 3NK7A 1H7MA 1Q7YH 1QVFF 2AIFA 3NVKE 2QEXF 3VMFB 1YI2F 4X3MA 1KD1H 3OBYA 1CN7A 1X52A 3WXMB 1Q81H 1T0KB 1Q82H 2LBXA 3J81M 1K8AH 5EO3A 3NVIB 3PAFA 3LFOA 3NMUC 1XBIA 3CCRF 1VQ8F 1GO0A 2CZWA 1W42A 1YJ9F 3CC4F 1GO1A 1VQNF 3CCSF 2JNBA 5G4VC 1W3EX 3CMAF 5FJ4C 1YITF 4TZZA 2KTUA 2VGMA 2FC3A 3CPWF 3HAXD 1YJWF 4LCKA 3LWPC 1S72F 1VQKF 3AGKA 1SDSA 1X7OA 1N8RH 3LWOC 3CCVF 1QVGF 3SIUA 3LWQC 2OTLF 3G4SF 3CC7F 3CPQA 1W2BF 3JAMM 3ON1A 3OBWA 1YJNF 5GAPK 3SIVA 3E20B 1VQ6F 2BO1A 2KG4A 1K73H 3PLAC 1Q86H
chains in the Genus database with same CATH superfamily
2UYJA 2CHTA 4O4JB 2OTJF 5CA0A 1X7PA 2GZLA 1IPAA 5DCVA 1RLGA 3WGJA 3CYQA 4O2AA 4X1IB 2VGNA 4G4WA 4TV9B 5MN5A 4BY9D 1VQMF 5KMGA 4X3LA 2FGYA 5LXTA 2YYEA 1OFUA 1W40A 1PXWA 1W5EA 1NMUB 1YHQF 2CW4A 2ZOVA 3CCMF 1QU9A 5GANK 2OZBA 1FFXA 1SA0B 3RYHA 4M8IA 3P0ZA 4ZHQB 2Q1XA 3OONA 4O4LB 5LA6A 5EWRA 1VH8A 5IJ9B 3WGLA 1K9MH 2PHNA 3I56F 2QA4F 3RA5A 3ZP4A 5EB1B 3LWVC 4B45A 3CCQF 3S0WA 5LOVB 3IR9A 5ITZA 4I50A 2MQEA 5IYZB 2H6LA 1IV3A 1UFYA 4TV8B 5EZYB 3J7AR 5MN6A 2I6DA 3HTNA 4G4VA 5C8YA 3C9UA 4HNAA 3CYPB 3CB2A 1QD9A 4ZHYB 4BT7A 1VQVA 1H7MA 1Q7YH 4NQ3A 2GVIA 4G88A 1YI2F 1CN7A 2CSLA 5IJ0A 1X52A 3WXMB 5CB4A 5HP8A 1K8AH 3C9RA 4ZHWA 3LFOA 2N48A 1UI9A 3NMUC 4X1YB 2UYPA 3LDTA 5EYPA 4ZOLA 3ZO8A 3HKCB 1GO0A 2CZWA 1W42A 5JH7B 5J2TB 1GO1A 1YGYA 3QUWA 2CHSA 3L7QA 2ZVZA 5G4VC 3R0PA 3S0HA 2IAFA 4O4HA 2VGMA 1FSZA 3RYIB 3VOAA 1S72F 1SDSA 3AGKA 3IEQA 5HY2A 3CCVF 4X20A 2RB9A 3S06A 4BT3A 4IHJB 3N2GB 1W2BF 3ON1A 3Q8HA 2IG8A 5GAPK 2RHJA 1JFFB 1OAPA 2HP0B 1VQ6F 4ERHA 3E22A 2IQQA 4IIJB 2OTMA 3QTYA 5BMVA 1RLUA 1COMA 5JQGB 1TUBB 1FNJA 3RYFB 2YXZA 1VQ4F 4C4WC 4I4TA 3VYUC 2I6RA 1PF5A 2HRUA 1JN1A 4FFBB 1ONIA 1CLIA 4U3JB 4EI9A 3JCMM 4TV8A 4LNUA 3S02A 4EB6A 4DRXA 1W41A 1H48A 2KTVA 1DT9A 4WBNB 3ZP7A 1VQ7F 4TUYB 4G4XA 3NK6A 3UT5B 3CD6F 3CCUF 5B8FA 4ZI7B 3DC2A 5FNVA 3JAWB 3U0OA 3HKEB 1T0AA 2OHWA 5HXUA 1VQPF 3K12A 5JVDA 2ALEA 5A2QM 3HKDB 1JJ2F 2QI2A 3CCLF 3MCQA 1KNKA 3VI6A 5HWEA 1RA4A 2RHOA 1VQLF 3WGKA 3VOBA 3ELCA 5EIBC 3KHNA 1RQ7A 5EAZA 3LWRC 3D00A 3LMEA 4I55A 2F9ZC 4O4IA 2Z01A 3I3FA 5GINC 3E1YA 5LYJA 1E7KA 3KIZA 3RYCA 1TVKB 5KX5B 3VMFB 4G4ZA 3JVHA 5HP7A 1Q81H 3JATB 1Q82H 2LBXA 3N2KA 5EO3A 4BVQA 3NVIB 5GONA 3PAFA 3P4EA 3MBMA 2Q1YA 3JAKA 1YJ9F 4X1KA 1W59A 1VK3A 3CC4F 3K14A 3IEWA 3C9SA 5HY4A 3IKEA 5J2UB 3KE1A 4O2BA 1W3EX 3JASA 3HKBA 3JARB 3CPWF 3HAXD 2UYNA 1VQKF 2V9YA 3EORA 3F0DA 3LYBA 1N8RH 3K0TA 3WJRA 3F0GA 2OTLF 2HQSC 3P10A 3G4SF 4C81A 2CWJA 3I7TA 3CPQA 1XHOA 4YJ3B 3HKEA 5CA1B 3SIVA 1IV1A 4O4JA 3E20B 2EWCA 2BO1A 1K73H 3JALB 3PLAC 2H8CA 1Q86H 4X1IA 1KNJA 1GX1A 4TV9A 4F6RB 5JCOC 5LP6B 1J7HA 3TD4A 3ESJA 3KJJA 3V4DA 3VTIC 5EB0A 5HXZA 4BVSA 1IV4A 1ODEA 3WGNA 5CA0B 3WJQA 4RQOA 1VHAA 3MCAB 3HJWC 5G4UC 1NQ3A 4O2AB 1GZ0A 3WPWA 1CK2A 4BT2A 3FFMA 2Z1EA 4B62A 3CCJF 5LP6C 5GIOC 3F0EA 5KMGB 1SA0A 3CXCF 3N4YA 4ZHQA 3VO8A 4O4LA 1ZWZA 5IJ9A 2DYYA 2HS0A 3FD6A 2LBTA 2ZAUA 2VXYA 2VAWA 3N4ZA 3VIUA 1M90H 4BVTA 2HRYA 4DXDA 5LOVA 1FFXB 5IYZA 3RYHB 2UYKA 3V7QA 3OW2F 5EZYA 5LA6B 4BW0B 3G6EF 3M1XA 5GIPC 3S03A 3MQWA 3ERNA 2LBWA 2UZHA 3CMEF 2HP3A 2PMPA 1W55A 2WALA 3D01A 4RHAA 5ITZB 3F0FA 5MN4A 1W5AA 4I50B 1VQOF 2G9IA 3C9TA 5JCOA 1JY8A 1QVFF 4C8GA 1W581 2AIFA 2QEXF 4C8IA 5C8YB 1IV2A 2W8BC 4HNAB 2AIZP 3OBYA 4X3MA 4ZHVA 4X1YA 4YJ2B 4KWEA 1T0KB 4BT6A 3HKCA 2K1SA 5JH7A 5J2TA 1Q8RA 3BYQA 3F6MA 3WGMA 1X25A 3DDNA 1U3PA 5IJ0B 1XBIA 1W5BA 3CCRF 5CB4B 1VQ8F 3RYIA 4U39A 1VQNF 2HS3A 2JNBA 3K2XA 4BT4A 4IHJA 4ZOLB 3N2GA 5EYPB 5FJ4C 2HS4A 2VAMA 4C82A 3SIUA 1X7OA 1QVGF 2VAPA 3D54A 1JFFA 1W57A 5HY1A 3KJKA 1W5FA 2HP0A 3HWUA 4O4HB 3FPIA 4IIJA 4EI7A 3JAMM 3V3TA 2ZVYA 3WPXA 4X20B 4PWTA 3OBWA 1U3LA 5JQGA 1TUBA 2DT4A 2P6YA 3RYFA 3VYTC 3T80A 1QAHA 2B33A 2KG4A 5EIBD 4FFBA 3CCEF 4U3JA 2L26A 3E22B 5BMVB 1KC8H 3VYSC 4C8EA 4E6EA 4NWOB 2RHHA 4WBNA 2QTPA 4I4TB 4TUYA 5IT9M 3UT5A 1KQSF 3B6NA 3TD3A 1VQ5F 3FD5A 4ZI7A 1NJIH 5HY0A 3JAWA 4BVRA 3S0YA 3ZOPA 4LNUB 4EB6B 1Z5VA 1YIJF 4DRXB 1JD1A 1DBFA 2HVYD 1SZQA 5FLXM 3IKFA 3HKDA 2KGWA 3G71F 4YJ2A 4BT5A 2Z1UA 3GTZA 3TD5A 3FBAA 1XRGA 5FNVB 3GYQA 2Z1FA 1U40A 2R751 4R40B 2GLZA 5JVDB 1M1KH 3O85A 3I55F 1XV2A 3C8LA 4G4YA 3J80M 1R1MA 3GHZA 4NUTA 3RA6A 2Z1TA 3CG6A 1TVKA 5AVMA 5KX5A 5LXTB 2R6R1 1VQ9F 3V7EA 2BTOA 3CC2F 2AMTA 3NK7A 1Z5WA 3JATA 4I55B 4O4IB 2NMUA 2BTQB 3NVKE 2RHLA 4B46A 3MDOA 3RE3A 1RQ2A 4XCQA 1KD1H 5LYJB 1YQNA 2LCAA 3IMPA 3RYCB 3M4SA 3J81M 3QHDA 3M84A 4ZK7A 5J2UA 4EI8A 3N2KB 3JARA 5GONB 3CCSF 3VCZA 4B5CA 3CMAF 1U43A 2H8EA 2ZF8A 1YITF 3WJPA 3JAKB 2BTUA 2KTUA 4TZZA 2FC3A 4LCKA 1YJWF 3LWPC 1H47A 4X1KB 4YJ3A 3LWOC 2HX0A 3LWQC 4O2BB 5CA1A 2CVLA 3JASB 3HKBB 3CC7F 2UYNB 3JALA 1YJNF 2ZODA 4F6RA 5LP6A 1FNKA
chains in the Genus database with same CATH topology
3CCEF 1VQ4F 4C4WC 2OTJF 1X7PA 1IPAA 5DCVA 1RLGA 1KC8H 5HXZA 2VGNA 4EI9A 4BVSA 4BY9D 1VQMF 3JCMM 5IT9M 4X3LA 1KQSF 3MCAB 2FGYA 1VQ5F 3HJWC 1NJIH 5G4UC 1GZ0A 1CK2A 5HY0A 3FFMA 1W40A 1W41A 1PXWA 2KTVA 1DT9A 4BVRA 5GIOC 3CCJF 1VQ7F 1NMUB 3NK6A 3CD6F 3CXCF 3CCUF 3N4YA 1YIJF 1YHQF 2HVYD 5FLXM 1ZWZA 3CCMF 3G71F 5GANK 2OHWA 2OZBA 5HXUA 1VQPF 2ALEA 3N4ZA 5A2QM 1M90H 4BVTA 5EWRA 1JJ2F 2QI2A 3GYQA 3VI6A 3CCLF 1K9MH 2GLZA 5HWEA 1RA4A 3I56F 2QA4F 1VQLF 3V7QA 3RA5A 3CCQF 3LWVC 3OW2F 1M1KH 3O85A 3I55F 3IR9A 4BW0B 3G6EF 5GIPC 2LBWA 3J80M 3D00A 3LWRC 3CMEF 3J7AR 4NUTA 2F9ZC 3RA6A 2WALA 3CG6A 2I6DA 5GINC 1VQ9F 3V7EA 3E1YA 1VQOF 3CC2F 1E7KA 3NK7A 1H7MA 1Q7YH 1QVFF 4NQ3A 2AIFA 3NVKE 2QEXF 3VMFB 1YI2F 4X3MA 4XCQA 3OBYA 1KD1H 1CN7A 1X52A 3WXMB 1Q81H 1T0KB 1Q82H 2LBXA 3J81M 1K8AH 5EO3A 4BVQA 3NVIB 3PAFA 3LFOA 3NMUC 1XBIA 4EI8A 3CCRF 1VQ8F 1GO0A 2CZWA 1W42A 1YJ9F 3CC4F 1GO1A 1VQNF 3CCSF 5HY4A 2JNBA 5G4VC 1W3EX 3CMAF 5FJ4C 1YITF 4TZZA 2KTUA 2VGMA 2FC3A 3CPWF 3HAXD 1YJWF 4LCKA 3LWPC 1S72F 1VQKF 3AGKA 1SDSA 1X7OA 5HY2A 3LWOC 3CCVF 1N8RH 1QVGF 3SIUA 3LWQC 2OTLF 5HY1A 3G4SF 3CC7F 3CPQA 1W2BF 4EI7A 3JAMM 3V3TA 3ON1A 3OBWA 1YJNF 5GAPK 3SIVA 3E20B 1VQ6F 2BO1A 2KG4A 1K73H 3PLAC 1Q86H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE F;  1VQ4 F;  4C4W C;  2OTJ F;  1X7P A;  1IPA A;  5DCV A;  1RLG A;  1KC8 H;  2VGN A;  4BY9 D;  1VQM F;  3JCM M;  5IT9 M;  4X3L A;  1KQS F;  3MCA B;  1VQ5 F;  3HJW C;  1NJI H;  5G4U C;  1GZ0 A;  1CK2 A;  3FFM A;  1W40 A;  1W41 A;  1PXW A;  2KTV A;  1DT9 A;  3CCJ F;  5GIO C;  1VQ7 F;  1NMU B;  3NK6 A;  3CD6 F;  3CXC F;  3CCU F;  3N4Y A;  1YIJ F;  1YHQ F;  2HVY D;  5FLX M;  1ZWZ A;  3CCM F;  3G71 F;  5GAN K;  2OHW A;  2OZB A;  1VQP F;  2ALE A;  3N4Z A;  5A2Q M;  1M90 H;  5EWR A;  1JJ2 F;  2QI2 A;  3GYQ A;  3VI6 A;  3CCL F;  1K9M H;  1RA4 A;  3I56 F;  2QA4 F;  1VQL F;  3V7Q A;  3RA5 A;  3CCQ F;  3LWV C;  3OW2 F;  1M1K H;  3O85 A;  3I55 F;  3IR9 A;  4BW0 B;  3G6E F;  5GIP C;  2LBW A;  3J80 M;  3LWR C;  3CME F;  3J7A R;  4NUT A;  3RA6 A;  2WAL A;  3CG6 A;  2I6D A;  5GIN C;  1VQ9 F;  3V7E A;  3E1Y A;  1VQO F;  3CC2 F;  1E7K A;  3NK7 A;  1H7M A;  1Q7Y H;  1QVF F;  2AIF A;  3NVK E;  2QEX F;  3VMF B;  1YI2 F;  4X3M A;  1KD1 H;  3OBY A;  1CN7 A;  1X52 A;  3WXM B;  1Q81 H;  1T0K B;  1Q82 H;  2LBX A;  3J81 M;  1K8A H;  5EO3 A;  3NVI B;  3PAF A;  3LFO A;  3NMU C;  1XBI A;  3CCR F;  1VQ8 F;  1GO0 A;  2CZW A;  1W42 A;  1YJ9 F;  3CC4 F;  1GO1 A;  1VQN F;  3CCS F;  2JNB A;  5G4V C;  1W3E X;  3CMA F;  5FJ4 C;  1YIT F;  4TZZ A;  2KTU A;  2VGM A;  2FC3 A;  3CPW F;  3HAX D;  1YJW F;  4LCK A;  3LWP C;  1S72 F;  1VQK F;  3AGK A;  1SDS A;  1X7O A;  1N8R H;  3LWO C;  3CCV F;  1QVG F;  3SIU A;  3LWQ C;  2OTL F;  3G4S F;  3CC7 F;  3CPQ A;  1W2B F;  3JAM M;  3ON1 A;  3OBW A;  1YJN F;  5GAP K;  3SIV A;  3E20 B;  1VQ6 F;  2BO1 A;  2KG4 A;  1K73 H;  3PLA C;  1Q86 H; 
#chains in the Genus database with same CATH topology
 2UYJ A;  2CHT A;  4O4J B;  2OTJ F;  5CA0 A;  1X7P A;  2GZL A;  1IPA A;  5DCV A;  1RLG A;  3WGJ A;  3CYQ A;  4O2A A;  4X1I B;  2VGN A;  4G4W A;  4TV9 B;  5MN5 A;  4BY9 D;  1VQM F;  5KMG A;  4X3L A;  2FGY A;  5LXT A;  2YYE A;  1OFU A;  1W40 A;  1PXW A;  1W5E A;  1NMU B;  1YHQ F;  2CW4 A;  2ZOV A;  3CCM F;  1QU9 A;  5GAN K;  2OZB A;  1FFX A;  1SA0 B;  3RYH A;  4M8I A;  3P0Z A;  4ZHQ B;  2Q1X A;  3OON A;  4O4L B;  5LA6 A;  5EWR A;  1VH8 A;  5IJ9 B;  3WGL A;  1K9M H;  2PHN A;  3I56 F;  2QA4 F;  3RA5 A;  3ZP4 A;  5EB1 B;  3LWV C;  4B45 A;  3CCQ F;  3S0W A;  5LOV B;  3IR9 A;  5ITZ A;  4I50 A;  2MQE A;  5IYZ B;  2H6L A;  1IV3 A;  1UFY A;  4TV8 B;  5EZY B;  3J7A R;  5MN6 A;  2I6D A;  3HTN A;  4G4V A;  5C8Y A;  3C9U A;  4HNA A;  3CYP B;  3CB2 A;  1QD9 A;  4ZHY B;  4BT7 A;  1VQV A;  1H7M A;  1Q7Y H;  4NQ3 A;  2GVI A;  4G88 A;  1YI2 F;  1CN7 A;  2CSL A;  5IJ0 A;  1X52 A;  3WXM B;  5CB4 A;  5HP8 A;  1K8A H;  3C9R A;  4ZHW A;  3LFO A;  2N48 A;  1UI9 A;  3NMU C;  4X1Y B;  2UYP A;  3LDT A;  5EYP A;  4ZOL A;  3ZO8 A;  3HKC B;  1GO0 A;  2CZW A;  1W42 A;  5JH7 B;  5J2T B;  1GO1 A;  1YGY A;  3QUW A;  2CHS A;  3L7Q A;  2ZVZ A;  5G4V C;  3R0P A;  3S0H A;  2IAF A;  4O4H A;  2VGM A;  1FSZ A;  3RYI B;  3VOA A;  1S72 F;  1SDS A;  3AGK A;  3IEQ A;  5HY2 A;  3CCV F;  4X20 A;  2RB9 A;  3S06 A;  4BT3 A;  4IHJ B;  3N2G B;  1W2B F;  3ON1 A;  3Q8H A;  2IG8 A;  5GAP K;  2RHJ A;  1JFF B;  1OAP A;  2HP0 B;  1VQ6 F;  4ERH A;  3E22 A;  2IQQ A;  4IIJ B;  2OTM A;  3QTY A;  5BMV A;  1RLU A;  1COM A;  5JQG B;  1TUB B;  1FNJ A;  3RYF B;  2YXZ A;  1VQ4 F;  4C4W C;  4I4T A;  3VYU C;  2I6R A;  1PF5 A;  2HRU A;  1JN1 A;  4FFB B;  1ONI A;  1CLI A;  4U3J B;  4EI9 A;  3JCM M;  4TV8 A;  4LNU A;  3S02 A;  4EB6 A;  4DRX A;  1W41 A;  1H48 A;  2KTV A;  1DT9 A;  4WBN B;  3ZP7 A;  1VQ7 F;  4TUY B;  4G4X A;  3NK6 A;  3UT5 B;  3CD6 F;  3CCU F;  5B8F A;  4ZI7 B;  3DC2 A;  5FNV A;  3JAW B;  3U0O A;  3HKE B;  1T0A A;  2OHW A;  5HXU A;  1VQP F;  3K12 A;  5JVD A;  2ALE A;  5A2Q M;  3HKD B;  1JJ2 F;  2QI2 A;  3CCL F;  3MCQ A;  1KNK A;  3VI6 A;  5HWE A;  1RA4 A;  2RHO A;  1VQL F;  3WGK A;  3VOB A;  3ELC A;  5EIB C;  3KHN A;  1RQ7 A;  5EAZ A;  3LWR C;  3D00 A;  3LME A;  4I55 A;  2F9Z C;  4O4I A;  2Z01 A;  3I3F A;  5GIN C;  3E1Y A;  5LYJ A;  1E7K A;  3KIZ A;  3RYC A;  1TVK B;  5KX5 B;  3VMF B;  4G4Z A;  3JVH A;  5HP7 A;  1Q81 H;  3JAT B;  1Q82 H;  2LBX A;  3N2K A;  5EO3 A;  4BVQ A;  3NVI B;  5GON A;  3PAF A;  3P4E A;  3MBM A;  2Q1Y A;  3JAK A;  1YJ9 F;  4X1K A;  1W59 A;  1VK3 A;  3CC4 F;  3K14 A;  3IEW A;  3C9S A;  5HY4 A;  3IKE A;  5J2U B;  3KE1 A;  4O2B A;  1W3E X;  3JAS A;  3HKB A;  3JAR B;  3CPW F;  3HAX D;  2UYN A;  1VQK F;  2V9Y A;  3EOR A;  3F0D A;  3LYB A;  1N8R H;  3K0T A;  3WJR A;  3F0G A;  2OTL F;  2HQS C;  3P10 A;  3G4S F;  4C81 A;  2CWJ A;  3I7T A;  3CPQ A;  1XHO A;  4YJ3 B;  3HKE A;  5CA1 B;  3SIV A;  1IV1 A;  4O4J A;  3E20 B;  2EWC A;  2BO1 A;  1K73 H;  3JAL B;  3PLA C;  2H8C A;  1Q86 H;  4X1I A;  1KNJ A;  1GX1 A;  4TV9 A;  4F6R B;  5JCO C;  5LP6 B;  1J7H A;  3TD4 A;  3ESJ A;  3KJJ A;  3V4D A;  3VTI C;  5EB0 A;  5HXZ A;  4BVS A;  1IV4 A;  1ODE A;  3WGN A;  5CA0 B;  3WJQ A;  4RQO A;  1VHA A;  3MCA B;  3HJW C;  5G4U C;  1NQ3 A;  4O2A B;  1GZ0 A;  3WPW A;  1CK2 A;  4BT2 A;  3FFM A;  2Z1E A;  4B62 A;  3CCJ F;  5LP6 C;  5GIO C;  3F0E A;  5KMG B;  1SA0 A;  3CXC F;  3N4Y A;  4ZHQ A;  3VO8 A;  4O4L A;  1ZWZ A;  5IJ9 A;  2DYY A;  2HS0 A;  3FD6 A;  2LBT A;  2ZAU A;  2VXY A;  2VAW A;  3N4Z A;  3VIU A;  1M90 H;  4BVT A;  2HRY A;  4DXD A;  5LOV A;  1FFX B;  5IYZ A;  3RYH B;  2UYK A;  3V7Q A;  3OW2 F;  5EZY A;  5LA6 B;  4BW0 B;  3G6E F;  3M1X A;  5GIP C;  3S03 A;  3MQW A;  3ERN A;  2LBW A;  2UZH A;  3CME F;  2HP3 A;  2PMP A;  1W55 A;  2WAL A;  3D01 A;  4RHA A;  5ITZ B;  3F0F A;  5MN4 A;  1W5A A;  4I50 B;  1VQO F;  2G9I A;  3C9T A;  5JCO A;  1JY8 A;  1QVF F;  4C8G A;  1W58 1;  2AIF A;  2QEX F;  4C8I A;  5C8Y B;  1IV2 A;  2W8B C;  4HNA B;  2AIZ P;  3OBY A;  4X3M A;  4ZHV A;  4X1Y A;  4YJ2 B;  4KWE A;  1T0K B;  4BT6 A;  3HKC A;  2K1S A;  5JH7 A;  5J2T A;  1Q8R A;  3BYQ A;  3F6M A;  3WGM A;  1X25 A;  3DDN A;  1U3P A;  5IJ0 B;  1XBI A;  1W5B A;  3CCR F;  5CB4 B;  1VQ8 F;  3RYI A;  4U39 A;  1VQN F;  2HS3 A;  2JNB A;  3K2X A;  4BT4 A;  4IHJ A;  4ZOL B;  3N2G A;  5EYP B;  5FJ4 C;  2HS4 A;  2VAM A;  4C82 A;  3SIU A;  1X7O A;  1QVG F;  2VAP A;  3D54 A;  1JFF A;  1W57 A;  5HY1 A;  3KJK A;  1W5F A;  2HP0 A;  3HWU A;  4O4H B;  3FPI A;  4IIJ A;  4EI7 A;  3JAM M;  3V3T A;  2ZVY A;  3WPX A;  4X20 B;  4PWT A;  3OBW A;  1U3L A;  5JQG A;  1TUB A;  2DT4 A;  2P6Y A;  3RYF A;  3VYT C;  3T80 A;  1QAH A;  2B33 A;  2KG4 A;  5EIB D;  4FFB A;  3CCE F;  4U3J A;  2L26 A;  3E22 B;  5BMV B;  1KC8 H;  3VYS C;  4C8E A;  4E6E A;  4NWO B;  2RHH A;  4WBN A;  2QTP A;  4I4T B;  4TUY A;  5IT9 M;  3UT5 A;  1KQS F;  3B6N A;  3TD3 A;  1VQ5 F;  3FD5 A;  4ZI7 A;  1NJI H;  5HY0 A;  3JAW A;  4BVR A;  3S0Y A;  3ZOP A;  4LNU B;  4EB6 B;  1Z5V A;  1YIJ F;  4DRX B;  1JD1 A;  1DBF A;  2HVY D;  1SZQ A;  5FLX M;  3IKF A;  3HKD A;  2KGW A;  3G71 F;  4YJ2 A;  4BT5 A;  2Z1U A;  3GTZ A;  3TD5 A;  3FBA A;  1XRG A;  5FNV B;  3GYQ A;  2Z1F A;  1U40 A;  2R75 1;  4R40 B;  2GLZ A;  5JVD B;  1M1K H;  3O85 A;  3I55 F;  1XV2 A;  3C8L A;  4G4Y A;  3J80 M;  1R1M A;  3GHZ A;  4NUT A;  3RA6 A;  2Z1T A;  3CG6 A;  1TVK A;  5AVM A;  5KX5 A;  5LXT B;  2R6R 1;  1VQ9 F;  3V7E A;  2BTO A;  3CC2 F;  2AMT A;  3NK7 A;  1Z5W A;  3JAT A;  4I55 B;  4O4I B;  2NMU A;  2BTQ B;  3NVK E;  2RHL A;  4B46 A;  3MDO A;  3RE3 A;  1RQ2 A;  4XCQ A;  1KD1 H;  5LYJ B;  1YQN A;  2LCA A;  3IMP A;  3RYC B;  3M4S A;  3J81 M;  3QHD A;  3M84 A;  4ZK7 A;  5J2U A;  4EI8 A;  3N2K B;  3JAR A;  5GON B;  3CCS F;  3VCZ A;  4B5C A;  3CMA F;  1U43 A;  2H8E A;  2ZF8 A;  1YIT F;  3WJP A;  3JAK B;  2BTU A;  2KTU A;  4TZZ A;  2FC3 A;  4LCK A;  1YJW F;  3LWP C;  1H47 A;  4X1K B;  4YJ3 A;  3LWO C;  2HX0 A;  3LWQ C;  4O2B B;  5CA1 A;  2CVL A;  3JAS B;  3HKB B;  3CC7 F;  2UYN B;  3JAL A;  1YJN F;  2ZOD A;  4F6R A;  5LP6 A;  1FNK A; 
#chains in the Genus database with same CATH homology
 3CCE F;  1VQ4 F;  4C4W C;  2OTJ F;  1X7P A;  1IPA A;  5DCV A;  1RLG A;  1KC8 H;  5HXZ A;  2VGN A;  4EI9 A;  4BVS A;  4BY9 D;  1VQM F;  3JCM M;  5IT9 M;  4X3L A;  1KQS F;  3MCA B;  2FGY A;  1VQ5 F;  3HJW C;  1NJI H;  5G4U C;  1GZ0 A;  1CK2 A;  5HY0 A;  3FFM A;  1W40 A;  1W41 A;  1PXW A;  2KTV A;  1DT9 A;  4BVR A;  5GIO C;  3CCJ F;  1VQ7 F;  1NMU B;  3NK6 A;  3CD6 F;  3CXC F;  3CCU F;  3N4Y A;  1YIJ F;  1YHQ F;  2HVY D;  5FLX M;  1ZWZ A;  3CCM F;  3G71 F;  5GAN K;  2OHW A;  2OZB A;  5HXU A;  1VQP F;  2ALE A;  3N4Z A;  5A2Q M;  1M90 H;  4BVT A;  5EWR A;  1JJ2 F;  2QI2 A;  3GYQ A;  3VI6 A;  3CCL F;  1K9M H;  2GLZ A;  5HWE A;  1RA4 A;  3I56 F;  2QA4 F;  1VQL F;  3V7Q A;  3RA5 A;  3CCQ F;  3LWV C;  3OW2 F;  1M1K H;  3O85 A;  3I55 F;  3IR9 A;  4BW0 B;  3G6E F;  5GIP C;  2LBW A;  3J80 M;  3D00 A;  3LWR C;  3CME F;  3J7A R;  4NUT A;  2F9Z C;  3RA6 A;  2WAL A;  3CG6 A;  2I6D A;  5GIN C;  1VQ9 F;  3V7E A;  3E1Y A;  1VQO F;  3CC2 F;  1E7K A;  3NK7 A;  1H7M A;  1Q7Y H;  1QVF F;  4NQ3 A;  2AIF A;  3NVK E;  2QEX F;  3VMF B;  1YI2 F;  4X3M A;  4XCQ A;  3OBY A;  1KD1 H;  1CN7 A;  1X52 A;  3WXM B;  1Q81 H;  1T0K B;  1Q82 H;  2LBX A;  3J81 M;  1K8A H;  5EO3 A;  4BVQ A;  3NVI B;  3PAF A;  3LFO A;  3NMU C;  1XBI A;  4EI8 A;  3CCR F;  1VQ8 F;  1GO0 A;  2CZW A;  1W42 A;  1YJ9 F;  3CC4 F;  1GO1 A;  1VQN F;  3CCS F;  5HY4 A;  2JNB A;  5G4V C;  1W3E X;  3CMA F;  5FJ4 C;  1YIT F;  4TZZ A;  2KTU A;  2VGM A;  2FC3 A;  3CPW F;  3HAX D;  1YJW F;  4LCK A;  3LWP C;  1S72 F;  1VQK F;  3AGK A;  1SDS A;  1X7O A;  5HY2 A;  3LWO C;  3CCV F;  1N8R H;  1QVG F;  3SIU A;  3LWQ C;  2OTL F;  5HY1 A;  3G4S F;  3CC7 F;  3CPQ A;  1W2B F;  4EI7 A;  3JAM M;  3V3T A;  3ON1 A;  3OBW A;  1YJN F;  5GAP K;  3SIV A;  3E20 B;  1VQ6 F;  2BO1 A;  2KG4 A;  1K73 H;  3PLA C;  1Q86 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...