3RA6A

Crystal structure of t. celer l30e e62a/k46a variant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
b'MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIAEDIEYYARLSGIPVYAFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Stabilizing salt-bridge enhances protein thermostability by reducing the heat capacity change of unfolding
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 27
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ra6A00
1M1KH 3NMUC 3CCVF 1Q86H 2ALEA 1VQNF 1K8AH 3G4SF 1CK2A 3CCLF 5FJ4C 1VQ6F 3OBWA 5EO3A 3G6EF 3CD6F 3NVIB 1GZ0A 1K73H 2I6DA 1VQ7F 3CCQF 1ZWZA 3NK7A 1YI2F 1NJIH 1X52A 3LWOC 2QEXF 1VQMF 4X3MA 3AGKA 3LFOA 4X3LA 5IT9M 1X7OA 3LWPC 1W2BF 1Q82H 3I56F 2QA4F 3LWRC 1VQOF 2JNBA 3CCMF 3J81M 1M90H 3N4ZA 3E1YA 5GANK 1PXWA 1VQ5F 3CC7F 4C4WC 3CC4F 1N8RH 1YIJF 3CCJF 5DCVA 2KG4A 1YHQF 2CZWA 3N4YA 3JCMM 1QVGF 1GO1A 3J80M 2HVYD 3RA5A 3IR9A 5EWRA 1YJNF 1T0KB 3NVKE 3NK6A 1KQSF 1VQKF 1DT9A 2OHWA 1X7PA 3GYQA 3VI6A 3CCEF 1VQ9F 3V7EA 3ON1A 4LCKA 1KC8H 3FFMA 1VQ4F 3E20B 3I55F 3SIUA 5GAPK 5GINC 1E7KA 1GO0A 2LBWA 3WXMB 2FC3A 3OW2F 1JJ2F 4TZZA 5GIOC 1S72F 2OZBA 1YJWF 3CG6A 3PLAC 2AIFA 2OTJF 1YJ9F 2OTLF 2BO1A 4BW0B 3CMEF 1H7MA 3V7QA 1Q7YH 3LWVC 1VQPF 1CN7A 2KTVA 3CPQA 5GIPC 3CCSF 1KD1H 1RA4A 2QI2A 2WALA 1IPAA 3CC2F 3HJWC 1Q81H 5A2QM 3J7AR 3SIVA 3CMAF 1W41A 1W42A 3OBYA 3JAMM 3VMFB 3RA6A 3PAFA 2KTUA 2VGMA 3CCRF 2LBXA 4NUTA 1RLGA 5FLXM 1YITF 1VQ8F 5G4UC 3O85A 1W40A 3G71F 3CPWF 2VGNA 3CCUF 5G4VC 1VQLF 3HAXD 1SDSA 3MCAB 3CXCF 4BY9D 1K9MH 1XBIA 1QVFF 1W3EX 3LWQC 1NMUB
chains in the Genus database with same CATH superfamily
3C9TA 3L7QA 5IJ9B 5HP7A 4I55A 3HWUA 5MN6A 4BT2A 4BT6A 1VQ6F 5FJ4C 5EO3A 4BVSA 3LDTA 3P4EA 1VQ7F 4RQOA 1X52A 3HTNA 4X3MA 1W5AA 1SA0B 3WPWA 3JVHA 5KX5B 5HXUA 1NQ3A 4U39A 3FBAA 5LXTB 1XV2A 1VQOF 3V4DA 3N4ZA 4C8IA 2Q1XA 1PXWA 1VQ5F 4YJ2B 3EORA 2IG8A 4O4JA 3MQWA 4XCQA 1W57A 3JCMM 1QVGF 4E6EA 2DYYA 3RYHA 2RHOA 2L26A 1X25A 4O4LB 3J80M 3TD5A 3IR9A 5GONB 2EWCA 1KQSF 1PF5A 2I6RA 1VQKF 1X7PA 3VI6A 3CCEF 4X20A 3E20B 5C8YB 4EI8A 4FFBB 4C81A 2YYEA 1VH8A 3UT5A 3RYIB 3QHDA 1W5BA 3CYQA 1W5FA 3F0FA 1U3PA 4O2AB 3VO8A 5HWEA 3CG6A 2GLZA 4TV9A 3KE1A 3PLAC 4YJ3A 2BTUA 5MN5A 4IIJB 3F0EA 3S0WA 3VIUA 5HXZA 3S06A 4ZOLA 3F6MA 1ODEA 2ZODA 1GX1A 3FD6A 3K12A 3LMEA 5A2QM 3KJJA 4I55B 2ZF8A 3OBYA 2HRUA 3VYUC 2GZLA 2KTUA 1YITF 5G4UC 2PMPA 3IEWA 2KGWA 1SDSA 2BTOA 1XBIA 3QTYA 1FNJA 2Q1YA 1W3EX 3S0YA 1IV1A 3LWQC 1M1KH 3JATA 3MCQA 3CCVF 1Q86H 2ALEA 3V3TA 4O4JB 1VQNF 3F0DA 3KHNA 4BVTA 1CK2A 3CB2A 3R0PA 2UYJA 2CSLA 5EB0A 5JVDA 2HP3A 4M8IA 4RHAA 3K14A 3RYHB 5EIBD 1K73H 1NJIH 1FFXA 3NK7A 1YI2F 1J7HA 2CHTA 3FD5A 2QEXF 3C8LA 3JAKB 4BT7A 3WJPA 3AGKA 2AMTA 4O4IA 2P6YA 3RYFA 3D54A 4X20B 1W2BF 3I56F 1KNKA 3LWRC 3ERNA 5CA1A 2JNBA 2OTMA 2B33A 3UT5B 3CCMF 4BVQA 5GANK 2NMUA 1VQVA 4C4WC 4ZHVA 3M4SA 3LYBA 1JN1A 3MBMA 4X1IA 4TUYB 1W5EA 2KG4A 5ITZA 3N2KB 5JH7A 3HKDA 2HX0A 2CZWA 3VYSC 3U0OA 2F9ZC 4TV9B 1GO1A 3WGMA 4YJ3B 3RA5A 1YJNF 2IQQA 2CHSA 5CB4A 2QTPA 1DT9A 5JQGA 1T0AA 2PHNA 3RE3A 1VK3A 3MDOA 3T80A 1TVKB 1VQ9F 1KC8H 3FFMA 4WBNA 4ZOLB 3IMPA 3I55F 5GAPK 5LP6C 1GO0A 4ERHA 3IKEA 4R40B 4G4VA 1RQ2A 5CA0A 3S0HA 5EZYA 4ZI7A 3KJKA 2LBWA 3WXMB 2ZAUA 1VHAA 3HKBA 2FC3A 3OW2F 3S03A 1JJ2F 5GIOC 2Z01A 1S72F 5EB1B 4X1YA 1FNKA 1XHOA 1UFYA 3OONA 5LOVA 1IV4A 3CMEF 1DBFA 1Q7YH 3E22A 5KMGA 1IV2A 3LWVC 4O2BA 3CPQA 4BT5A 5BMVA 1Q8RA 4G4ZA 1RA4A 2VAWA 3S02A 1W41A 2K1SA 3GTZA 3JAMM 3HKCA 3N2GB 1KNJA 1FFXB 3K2XA 3I7TA 3WGKA 1VQ8F 3M84A 3O85A 3BYQA 2R751 4O4IB 3RYFB 1VQLF 4NWOB 2R6R1 1W55A 2LCAA 1JFFA 3F0GA 3ZP4A 4G4YA 5CA1B 4HNAA 4NQ3A 1NMUB 2VXYA 2DT4A 5LYJA 2UYKA 5IJ9A 2CW4A 5JH7B 5AVMA 3OBWA 2RHJA 3G6EF 3CD6F 2I6DA 2UYPA 3CCQF 2G9IA 1JY8A 3LWOC 1VQMF 3QUWA 5JQGB 1SA0A 4X3LA 5IJ0A 5IT9M 1X7OA 2Z1FA 3LWPC 3Q8HA 5EAZA 4WBNB 5LXTA 2H6LA 1R1MA 2MQEA 1Z5VA 5CA0B 5EZYB 4ZI7B 3CC4F 4F6RA 2HQSC 3IEQA 4U3JA 3RYCA 5DCVA 3HKBB 4I50A 3VOBA 1CLIA 4KWEA 3JASA 5EIBC 3JARA 4ZHWA 4X1YB 2UYNA 5LOVB 5JCOC 3NVKE 4O4HA 1SZQA 3FPIA 3VOAA 2HS3A 2OHWA 3GYQA 1JD1A 3V7EA 4ZK7A 5KMGB 1TUBA 2ZOVA 1H47A 3ON1A 4O2BB 2V9YA 4EI7A 1Z5WA 3SIUA 4I4TA 3WPXA 4DRXA 1QU9A 2Z1TA 3C9UA 4X1KA 4C82A 2AIZP 4B5CA 2HS4A 2CVLA 3HKCB 3B6NA 3TD3A 4C8EA 5FNVA 1OAPA 4O2AA 3CYPB 2OZBA 2AIFA 2OTJF 3VYTC 1YJ9F 2BO1A 1JFFB 5EYPA 1RLUA 1RQ7A 1H7MA 3V7QA 3WGJA 5JCOA 4EB6A 1VQPF 1CN7A 2KTVA 2YXZA 5GIPC 2VAMA 2RHHA 5LYJB 1KD1H 3ZOPA 3D00A 4IHJA 5LA6A 1Q81H 3HKEA 3JAWA 3J7AR 3JALA 3CMAF 1H48A 1W42A 3IKFA 4TV8A 3VMFB 2UZHA 4ZHQA 4NUTA 5FLXM 2RB9A 1COMA 5IYZA 3CPWF 2VGNA 3ELCA 3WGNA 5IJ0B 3HAXD 3P0ZA 5J2TA 2Z1UA 4BY9D 1K9MH 5B8FA 5J2UA 4B46A 2HP0A 3NMUC 3JATB 4F6RB 3ZP7A 1U3LA 3C9RA 4U3JB 3RYCB 1ONIA 3GHZA 4I50B 1K8AH 3I3FA 5HP8A 3JASB 4B62A 3G4SF 5LP6A 3CCLF 5JVDB 1QAHA 3JARB 3NVIB 1GZ0A 2UYNB 4C8GA 1ZWZA 2VAPA 3VTIC 4O4HB 4ZHYB 3JAKA 2CWJA 3LFOA 2BTQB 4PWTA 1TUBB 2ZVZA 3C9SA 1Q82H 1OFUA 4G4XA 2QA4F 4I4TB 4DRXB 5HY2A 4LNUA 4B45A 3J81M 4X1KB 1M90H 3E1YA 3KIZA 4EI9A 2H8CA 3CC7F 3WJQA 1N8RH 2RHLA 3TD4A 3DC2A 1YIJF 5FNVB 3CCJF 3P10A 4X1IB 5ITZB 1IV3A 4TUYA 4G4WA 1YHQF 3HKDB 3N2KA 1UI9A 3N4YA 3DDNA 4G88A 2HRYA 2HVYD 1T0KB 5EWRA 5CB4B 3NK6A 5EYPB 3M1XA 1YGYA 1TVKA 5KX5A 1YQNA 1U40A 4EB6B 1VQ4F 4LCKA 1W581 3ESJA 3VCZA 5GINC 1E7KA 1QD9A 5HY1A 4IHJB 5LA6B 3HKEB 3JAWB 3JALB 4BT4A 4TV8B 4YJ2A 1FSZA 4ZHQB 2H8EA 3WGLA 4BVRA 5IYZB 2N48A 1YJWF 4O4LA 4DXDA 3D01A 2OTLF 2GVIA 5GONA 4BT3A 5J2TB 4BW0B 2ZVYA 1XRGA 3E22B 5J2UB 2HP0B 5C8YA 2LBTA 4FFBA 3CCSF 5BMVB 2FGYA 2Z1EA 5MN4A 1U43A 2QI2A 2WALA 1IPAA 3CC2F 3HJWC 2HS0A 3RYIA 3SIVA 5LP6B 2IAFA 1W59A 3RA6A 3WJRA 3PAFA 3N2GA 2VGMA 3CCRF 2LBXA 5HY4A 1RLGA 1W40A 3G71F 3CCUF 5HY0A 5G4VC 3MCAB 3CXCF 4IIJA 2W8BC 4LNUB 3ZO8A 4HNAB 1QVFF 3K0TA 4TZZA
chains in the Genus database with same CATH topology
1M1KH 3NMUC 3CCVF 1Q86H 2ALEA 3V3TA 1VQNF 1K8AH 3G4SF 4BVTA 1CK2A 3CCLF 5FJ4C 1VQ6F 3OBWA 5EO3A 3G6EF 3CD6F 4BVSA 1GZ0A 3NVIB 1K73H 2I6DA 1VQ7F 3CCQF 1ZWZA 3NK7A 1YI2F 1NJIH 1X52A 3LWOC 2QEXF 1VQMF 4X3MA 3AGKA 3LFOA 4X3LA 5HXUA 5IT9M 1X7OA 3LWPC 1W2BF 1Q82H 3I56F 2QA4F 3LWRC 1VQOF 5HY2A 2JNBA 3CCMF 3J81M 1M90H 4BVQA 3N4ZA 3E1YA 4EI9A 5GANK 1PXWA 1VQ5F 3CC7F 4C4WC 3CC4F 1N8RH 1YIJF 3CCJF 5DCVA 4XCQA 2KG4A 1YHQF 2CZWA 3N4YA 3JCMM 2F9ZC 1QVGF 1GO1A 3J80M 2HVYD 3RA5A 3IR9A 5EWRA 1YJNF 1T0KB 3NVKE 3NK6A 1KQSF 1VQKF 1DT9A 2OHWA 1X7PA 3GYQA 3VI6A 3CCEF 1VQ9F 3V7EA 3ON1A 4LCKA 1KC8H 3FFMA 1VQ4F 3E20B 4EI8A 4EI7A 3I55F 3SIUA 5GAPK 5GINC 1E7KA 5HY1A 1GO0A 2LBWA 3WXMB 2FC3A 3OW2F 1JJ2F 5HWEA 4TZZA 5GIOC 4BVRA 1S72F 2OZBA 1YJWF 3CG6A 2GLZA 2AIFA 3PLAC 2OTJF 1YJ9F 2OTLF 2BO1A 4BW0B 3CMEF 1H7MA 3V7QA 1Q7YH 3LWVC 1VQPF 1CN7A 5HXZA 2KTVA 3CPQA 5GIPC 3CCSF 2FGYA 1KD1H 1RA4A 2QI2A 2WALA 3D00A 1IPAA 3CC2F 3HJWC 1Q81H 5A2QM 3J7AR 3SIVA 3CMAF 1W41A 1W42A 3OBYA 3JAMM 3VMFB 3RA6A 3PAFA 3LWQC 2KTUA 2VGMA 3CCRF 2LBXA 5HY4A 4NUTA 1RLGA 5FLXM 1YITF 1VQ8F 5G4UC 3O85A 1W40A 3G71F 3CPWF 2VGNA 3CCUF 5HY0A 5G4VC 1VQLF 3HAXD 1SDSA 3MCAB 3CXCF 4BY9D 1K9MH 1XBIA 1QVFF 1W3EX 4NQ3A 1NMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K H;  3NMU C;  3CCV F;  1Q86 H;  2ALE A;  1VQN F;  1K8A H;  3G4S F;  1CK2 A;  3CCL F;  5FJ4 C;  1VQ6 F;  3OBW A;  5EO3 A;  3G6E F;  3CD6 F;  3NVI B;  1GZ0 A;  1K73 H;  2I6D A;  1VQ7 F;  3CCQ F;  1ZWZ A;  3NK7 A;  1YI2 F;  1NJI H;  1X52 A;  3LWO C;  2QEX F;  1VQM F;  4X3M A;  3AGK A;  3LFO A;  4X3L A;  5IT9 M;  1X7O A;  3LWP C;  1W2B F;  1Q82 H;  3I56 F;  2QA4 F;  3LWR C;  1VQO F;  2JNB A;  3CCM F;  3J81 M;  1M90 H;  3N4Z A;  3E1Y A;  5GAN K;  1PXW A;  1VQ5 F;  3CC7 F;  4C4W C;  3CC4 F;  1N8R H;  1YIJ F;  3CCJ F;  5DCV A;  2KG4 A;  1YHQ F;  2CZW A;  3N4Y A;  3JCM M;  1QVG F;  1GO1 A;  3J80 M;  2HVY D;  3RA5 A;  3IR9 A;  5EWR A;  1YJN F;  1T0K B;  3NVK E;  3NK6 A;  1KQS F;  1VQK F;  1DT9 A;  2OHW A;  1X7P A;  3GYQ A;  3VI6 A;  3CCE F;  1VQ9 F;  3V7E A;  3ON1 A;  4LCK A;  1KC8 H;  3FFM A;  1VQ4 F;  3E20 B;  3I55 F;  3SIU A;  5GAP K;  5GIN C;  1E7K A;  1GO0 A;  2LBW A;  3WXM B;  2FC3 A;  3OW2 F;  1JJ2 F;  4TZZ A;  5GIO C;  1S72 F;  2OZB A;  1YJW F;  3CG6 A;  3PLA C;  2AIF A;  2OTJ F;  1YJ9 F;  2OTL F;  2BO1 A;  4BW0 B;  3CME F;  1H7M A;  3V7Q A;  1Q7Y H;  3LWV C;  1VQP F;  1CN7 A;  2KTV A;  3CPQ A;  5GIP C;  3CCS F;  1KD1 H;  1RA4 A;  2QI2 A;  2WAL A;  1IPA A;  3CC2 F;  3HJW C;  1Q81 H;  5A2Q M;  3J7A R;  3SIV A;  3CMA F;  1W41 A;  1W42 A;  3OBY A;  3JAM M;  3VMF B;  3RA6 A;  3PAF A;  2KTU A;  2VGM A;  3CCR F;  2LBX A;  4NUT A;  1RLG A;  5FLX M;  1YIT F;  1VQ8 F;  5G4U C;  3O85 A;  1W40 A;  3G71 F;  3CPW F;  2VGN A;  3CCU F;  5G4V C;  1VQL F;  3HAX D;  1SDS A;  3MCA B;  3CXC F;  4BY9 D;  1K9M H;  1XBI A;  1QVF F;  1W3E X;  3LWQ C;  1NMU B; 
#chains in the Genus database with same CATH topology
 3C9T A;  3L7Q A;  5IJ9 B;  5HP7 A;  4I55 A;  3HWU A;  5MN6 A;  4BT2 A;  4BT6 A;  1VQ6 F;  5FJ4 C;  5EO3 A;  4BVS A;  3LDT A;  3P4E A;  1VQ7 F;  4RQO A;  1X52 A;  3HTN A;  4X3M A;  1W5A A;  1SA0 B;  3WPW A;  3JVH A;  5KX5 B;  5HXU A;  1NQ3 A;  4U39 A;  3FBA A;  5LXT B;  1XV2 A;  1VQO F;  3V4D A;  3N4Z A;  4C8I A;  2Q1X A;  1PXW A;  1VQ5 F;  4YJ2 B;  3EOR A;  2IG8 A;  4O4J A;  3MQW A;  4XCQ A;  1W57 A;  3JCM M;  1QVG F;  4E6E A;  2DYY A;  3RYH A;  2RHO A;  2L26 A;  1X25 A;  4O4L B;  3J80 M;  3TD5 A;  3IR9 A;  5GON B;  2EWC A;  1KQS F;  1PF5 A;  2I6R A;  1VQK F;  1X7P A;  3VI6 A;  3CCE F;  4X20 A;  3E20 B;  5C8Y B;  4EI8 A;  4FFB B;  4C81 A;  2YYE A;  1VH8 A;  3UT5 A;  3RYI B;  3QHD A;  1W5B A;  3CYQ A;  1W5F A;  3F0F A;  1U3P A;  4O2A B;  3VO8 A;  5HWE A;  3CG6 A;  2GLZ A;  4TV9 A;  3KE1 A;  3PLA C;  4YJ3 A;  2BTU A;  5MN5 A;  4IIJ B;  3F0E A;  3S0W A;  3VIU A;  5HXZ A;  3S06 A;  4ZOL A;  3F6M A;  1ODE A;  2ZOD A;  1GX1 A;  3FD6 A;  3K12 A;  3LME A;  5A2Q M;  3KJJ A;  4I55 B;  2ZF8 A;  3OBY A;  2HRU A;  3VYU C;  2GZL A;  2KTU A;  1YIT F;  5G4U C;  2PMP A;  3IEW A;  2KGW A;  1SDS A;  2BTO A;  1XBI A;  3QTY A;  1FNJ A;  2Q1Y A;  1W3E X;  3S0Y A;  1IV1 A;  3LWQ C;  1M1K H;  3JAT A;  3MCQ A;  3CCV F;  1Q86 H;  2ALE A;  3V3T A;  4O4J B;  1VQN F;  3F0D A;  3KHN A;  4BVT A;  1CK2 A;  3CB2 A;  3R0P A;  2UYJ A;  2CSL A;  5EB0 A;  5JVD A;  2HP3 A;  4M8I A;  4RHA A;  3K14 A;  3RYH B;  5EIB D;  1K73 H;  1NJI H;  1FFX A;  3NK7 A;  1YI2 F;  1J7H A;  2CHT A;  3FD5 A;  2QEX F;  3C8L A;  3JAK B;  4BT7 A;  3WJP A;  3AGK A;  2AMT A;  4O4I A;  2P6Y A;  3RYF A;  3D54 A;  4X20 B;  1W2B F;  3I56 F;  1KNK A;  3LWR C;  3ERN A;  5CA1 A;  2JNB A;  2OTM A;  2B33 A;  3UT5 B;  3CCM F;  4BVQ A;  5GAN K;  2NMU A;  1VQV A;  4C4W C;  4ZHV A;  3M4S A;  3LYB A;  1JN1 A;  3MBM A;  4X1I A;  4TUY B;  1W5E A;  2KG4 A;  5ITZ A;  3N2K B;  5JH7 A;  3HKD A;  2HX0 A;  2CZW A;  3VYS C;  3U0O A;  2F9Z C;  4TV9 B;  1GO1 A;  3WGM A;  4YJ3 B;  3RA5 A;  1YJN F;  2IQQ A;  2CHS A;  5CB4 A;  2QTP A;  1DT9 A;  5JQG A;  1T0A A;  2PHN A;  3RE3 A;  1VK3 A;  3MDO A;  3T80 A;  1TVK B;  1VQ9 F;  1KC8 H;  3FFM A;  4WBN A;  4ZOL B;  3IMP A;  3I55 F;  5GAP K;  5LP6 C;  1GO0 A;  4ERH A;  3IKE A;  4R40 B;  4G4V A;  1RQ2 A;  5CA0 A;  3S0H A;  5EZY A;  4ZI7 A;  3KJK A;  2LBW A;  3WXM B;  2ZAU A;  1VHA A;  3HKB A;  2FC3 A;  3OW2 F;  3S03 A;  1JJ2 F;  5GIO C;  2Z01 A;  1S72 F;  5EB1 B;  4X1Y A;  1FNK A;  1XHO A;  1UFY A;  3OON A;  5LOV A;  1IV4 A;  3CME F;  1DBF A;  1Q7Y H;  3E22 A;  5KMG A;  1IV2 A;  3LWV C;  4O2B A;  3CPQ A;  4BT5 A;  5BMV A;  1Q8R A;  4G4Z A;  1RA4 A;  2VAW A;  3S02 A;  1W41 A;  2K1S A;  3GTZ A;  3JAM M;  3HKC A;  3N2G B;  1KNJ A;  1FFX B;  3K2X A;  3I7T A;  3WGK A;  1VQ8 F;  3M84 A;  3O85 A;  3BYQ A;  2R75 1;  4O4I B;  3RYF B;  1VQL F;  4NWO B;  2R6R 1;  1W55 A;  2LCA A;  1JFF A;  3F0G A;  3ZP4 A;  4G4Y A;  5CA1 B;  4HNA A;  4NQ3 A;  1NMU B;  2VXY A;  2DT4 A;  5LYJ A;  2UYK A;  5IJ9 A;  2CW4 A;  5JH7 B;  5AVM A;  3OBW A;  2RHJ A;  3G6E F;  3CD6 F;  2I6D A;  2UYP A;  3CCQ F;  2G9I A;  1JY8 A;  3LWO C;  1VQM F;  3QUW A;  5JQG B;  1SA0 A;  4X3L A;  5IJ0 A;  5IT9 M;  1X7O A;  2Z1F A;  3LWP C;  3Q8H A;  5EAZ A;  4WBN B;  5LXT A;  2H6L A;  1R1M A;  2MQE A;  1Z5V A;  5CA0 B;  5EZY B;  4ZI7 B;  3CC4 F;  4F6R A;  2HQS C;  3IEQ A;  4U3J A;  3RYC A;  5DCV A;  3HKB B;  4I50 A;  3VOB A;  1CLI A;  4KWE A;  3JAS A;  5EIB C;  3JAR A;  4ZHW A;  4X1Y B;  2UYN A;  5LOV B;  5JCO C;  3NVK E;  4O4H A;  1SZQ A;  3FPI A;  3VOA A;  2HS3 A;  2OHW A;  3GYQ A;  1JD1 A;  3V7E A;  4ZK7 A;  5KMG B;  1TUB A;  2ZOV A;  1H47 A;  3ON1 A;  4O2B B;  2V9Y A;  4EI7 A;  1Z5W A;  3SIU A;  4I4T A;  3WPX A;  4DRX A;  1QU9 A;  2Z1T A;  3C9U A;  4X1K A;  4C82 A;  2AIZ P;  4B5C A;  2HS4 A;  2CVL A;  3HKC B;  3B6N A;  3TD3 A;  4C8E A;  5FNV A;  1OAP A;  4O2A A;  3CYP B;  2OZB A;  2AIF A;  2OTJ F;  3VYT C;  1YJ9 F;  2BO1 A;  1JFF B;  5EYP A;  1RLU A;  1RQ7 A;  1H7M A;  3V7Q A;  3WGJ A;  5JCO A;  4EB6 A;  1VQP F;  1CN7 A;  2KTV A;  2YXZ A;  5GIP C;  2VAM A;  2RHH A;  5LYJ B;  1KD1 H;  3ZOP A;  3D00 A;  4IHJ A;  5LA6 A;  1Q81 H;  3HKE A;  3JAW A;  3J7A R;  3JAL A;  3CMA F;  1H48 A;  1W42 A;  3IKF A;  4TV8 A;  3VMF B;  2UZH A;  4ZHQ A;  4NUT A;  5FLX M;  2RB9 A;  1COM A;  5IYZ A;  3CPW F;  2VGN A;  3ELC A;  3WGN A;  5IJ0 B;  3HAX D;  3P0Z A;  5J2T A;  2Z1U A;  4BY9 D;  1K9M H;  5B8F A;  5J2U A;  4B46 A;  2HP0 A;  3NMU C;  3JAT B;  4F6R B;  3ZP7 A;  1U3L A;  3C9R A;  4U3J B;  3RYC B;  1ONI A;  3GHZ A;  4I50 B;  1K8A H;  3I3F A;  5HP8 A;  3JAS B;  4B62 A;  3G4S F;  5LP6 A;  3CCL F;  5JVD B;  1QAH A;  3JAR B;  3NVI B;  1GZ0 A;  2UYN B;  4C8G A;  1ZWZ A;  2VAP A;  3VTI C;  4O4H B;  4ZHY B;  3JAK A;  2CWJ A;  3LFO A;  2BTQ B;  4PWT A;  1TUB B;  2ZVZ A;  3C9S A;  1Q82 H;  1OFU A;  4G4X A;  2QA4 F;  4I4T B;  4DRX B;  5HY2 A;  4LNU A;  4B45 A;  3J81 M;  4X1K B;  1M90 H;  3E1Y A;  3KIZ A;  4EI9 A;  2H8C A;  3CC7 F;  3WJQ A;  1N8R H;  2RHL A;  3TD4 A;  3DC2 A;  1YIJ F;  5FNV B;  3CCJ F;  3P10 A;  4X1I B;  5ITZ B;  1IV3 A;  4TUY A;  4G4W A;  1YHQ F;  3HKD B;  3N2K A;  1UI9 A;  3N4Y A;  3DDN A;  4G88 A;  2HRY A;  2HVY D;  1T0K B;  5EWR A;  5CB4 B;  3NK6 A;  5EYP B;  3M1X A;  1YGY A;  1TVK A;  5KX5 A;  1YQN A;  1U40 A;  4EB6 B;  1VQ4 F;  4LCK A;  1W58 1;  3ESJ A;  3VCZ A;  5GIN C;  1E7K A;  1QD9 A;  5HY1 A;  4IHJ B;  5LA6 B;  3HKE B;  3JAW B;  3JAL B;  4BT4 A;  4TV8 B;  4YJ2 A;  1FSZ A;  4ZHQ B;  2H8E A;  3WGL A;  4BVR A;  5IYZ B;  2N48 A;  1YJW F;  4O4L A;  4DXD A;  3D01 A;  2OTL F;  2GVI A;  5GON A;  4BT3 A;  5J2T B;  4BW0 B;  2ZVY A;  1XRG A;  3E22 B;  5J2U B;  2HP0 B;  5C8Y A;  2LBT A;  4FFB A;  3CCS F;  5BMV B;  2FGY A;  2Z1E A;  5MN4 A;  1U43 A;  2QI2 A;  2WAL A;  1IPA A;  3CC2 F;  3HJW C;  2HS0 A;  3RYI A;  3SIV A;  5LP6 B;  2IAF A;  1W59 A;  3RA6 A;  3WJR A;  3PAF A;  3N2G A;  2VGM A;  3CCR F;  2LBX A;  5HY4 A;  1RLG A;  1W40 A;  3G71 F;  3CCU F;  5HY0 A;  5G4V C;  3MCA B;  3CXC F;  4IIJ A;  2W8B C;  4LNU B;  3ZO8 A;  4HNA B;  1QVF F;  3K0T A;  4TZZ A; 
#chains in the Genus database with same CATH homology
 1M1K H;  3NMU C;  3CCV F;  1Q86 H;  2ALE A;  3V3T A;  1VQN F;  1K8A H;  3G4S F;  4BVT A;  1CK2 A;  3CCL F;  5FJ4 C;  1VQ6 F;  3OBW A;  5EO3 A;  3G6E F;  3CD6 F;  4BVS A;  1GZ0 A;  3NVI B;  1K73 H;  2I6D A;  1VQ7 F;  3CCQ F;  1ZWZ A;  3NK7 A;  1YI2 F;  1NJI H;  1X52 A;  3LWO C;  2QEX F;  1VQM F;  4X3M A;  3AGK A;  3LFO A;  4X3L A;  5HXU A;  5IT9 M;  1X7O A;  3LWP C;  1W2B F;  1Q82 H;  3I56 F;  2QA4 F;  3LWR C;  1VQO F;  5HY2 A;  2JNB A;  3CCM F;  3J81 M;  1M90 H;  4BVQ A;  3N4Z A;  3E1Y A;  4EI9 A;  5GAN K;  1PXW A;  1VQ5 F;  3CC7 F;  4C4W C;  3CC4 F;  1N8R H;  1YIJ F;  3CCJ F;  5DCV A;  4XCQ A;  2KG4 A;  1YHQ F;  2CZW A;  3N4Y A;  3JCM M;  2F9Z C;  1QVG F;  1GO1 A;  3J80 M;  2HVY D;  3RA5 A;  3IR9 A;  5EWR A;  1YJN F;  1T0K B;  3NVK E;  3NK6 A;  1KQS F;  1VQK F;  1DT9 A;  2OHW A;  1X7P A;  3GYQ A;  3VI6 A;  3CCE F;  1VQ9 F;  3V7E A;  3ON1 A;  4LCK A;  1KC8 H;  3FFM A;  1VQ4 F;  3E20 B;  4EI8 A;  4EI7 A;  3I55 F;  3SIU A;  5GAP K;  5GIN C;  1E7K A;  5HY1 A;  1GO0 A;  2LBW A;  3WXM B;  2FC3 A;  3OW2 F;  1JJ2 F;  5HWE A;  4TZZ A;  5GIO C;  4BVR A;  1S72 F;  2OZB A;  1YJW F;  3CG6 A;  2GLZ A;  2AIF A;  3PLA C;  2OTJ F;  1YJ9 F;  2OTL F;  2BO1 A;  4BW0 B;  3CME F;  1H7M A;  3V7Q A;  1Q7Y H;  3LWV C;  1VQP F;  1CN7 A;  5HXZ A;  2KTV A;  3CPQ A;  5GIP C;  3CCS F;  2FGY A;  1KD1 H;  1RA4 A;  2QI2 A;  2WAL A;  3D00 A;  1IPA A;  3CC2 F;  3HJW C;  1Q81 H;  5A2Q M;  3J7A R;  3SIV A;  3CMA F;  1W41 A;  1W42 A;  3OBY A;  3JAM M;  3VMF B;  3RA6 A;  3PAF A;  3LWQ C;  2KTU A;  2VGM A;  3CCR F;  2LBX A;  5HY4 A;  4NUT A;  1RLG A;  5FLX M;  1YIT F;  1VQ8 F;  5G4U C;  3O85 A;  1W40 A;  3G71 F;  3CPW F;  2VGN A;  3CCU F;  5HY0 A;  5G4V C;  1VQL F;  3HAX D;  1SDS A;  3MCA B;  3CXC F;  4BY9 D;  1K9M H;  1XBI A;  1QVF F;  1W3E X;  4NQ3 A;  1NMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...