3RA6A

Crystal structure of t. celer l30e e62a/k46a variant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIAEDIEYYARLSGIPVYAFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Stabilizing salt-bridge enhances protein thermostability by reducing the heat capacity change of unfolding
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 27
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ra6A00
1VQLF 2KTVA 3CMAF 5A2QM 1GO1A 5GANK 1KQSF 3CCEF 2LBXA 3WXMB 1M90H 2HVYD 5DCVA 1VQ7F 1NMUB 3IR9A 2ALEA 3SIVA 3J7AR 1PXWA 2QEXF 3CC2F 3NVIB 1VQ9F 3CCRF 1K8AH 1YHQF 3PAFA 3RA6A 3CCSF 1VQ8F 5G4VC 1W2BF 3ON1A 1JJ2F 3LWPC 3CD6F 1VQNF 1VQKF 1KC8H 3CCQF 2FC3A 3CCVF 1GO0A 3GYQA 5GINC 3CPQA 3I55F 3CXCF 3CCLF 1QVFF 1ZWZA 3NVKE 5GAPK 4X3MA 1CK2A 1VQ5F 5EWRA 2OTLF 3NK7A 1VQOF 1VQPF 1M1KH 1H7MA 3CG6A 3OW2F 3NMUC 3LWVC 1W3EX 1CN7A 3LFOA 1RA4A 3OBYA 1DT9A 1S72F 3PLAC 3O85A 2BO1A 1W41A 3HAXD 5IT9M 5G4UC 5GIPC 3CC4F 1VQMF 1IPAA 2JNBA 4BW0B 5FJ4C 3LWRC 3CCJF 1VQ6F 3VMFB 3V7QA 2VGMA 2VGNA 5FLXM 1YITF 4X3LA 3G71F 3JCMM 3E1YA 3CPWF 3MCAB 1RLGA 1X7PA 3NK6A 1NJIH 1X7OA 3VI6A 3CMEF 1YJ9F 1E7KA 4C4WC 2KG4A 3E20B 3J81M 1KD1H 3N4ZA 1Q86H 2OZBA 3CC7F 1N8RH 3N4YA 3CCMF 2QI2A 3OBWA 3V7EA 2CZWA 1VQ4F 1K9MH 4NUTA 1K73H 3SIUA 2KTUA 3G4SF 3HJWC 3CCUF 1T0KB 3LWOC 1SDSA 2LBWA 2I6DA 2OHWA 4BY9D 4TZZA 1Q82H 3I56F 2QA4F 1YJNF 4LCKA 3J80M 3FFMA 1X52A 3JAMM 1Q81H 1XBIA 3AGKA 3RA5A 5GIOC 1YI2F 2WALA 3G6EF 1YJWF 1YIJF 1W40A 3LWQC 2OTJF 2AIFA 1QVGF 1W42A 1GZ0A 5EO3A 1Q7YH
chains in the Genus database with same CATH superfamily
2B33A 2KTVA 5LA6A 5HY4A 2VAWA 2VAMA 3WPWA 2EWCA 4X1YB 3CCEF 3CYQA 4X1IB 1VQ7F 3MDOA 3IR9A 4KWEA 2RHOA 3KE1A 3QHDA 2G9IA 1FNKA 5LA6B 3GTZA 4NQ3A 3D01A 3ERNA 2HP3A 1K8AH 3F6MA 3WJRA 1XV2A 3C9UA 4C82A 3RYFB 1VQ8F 2I6RA 1GX1A 5ITZA 4XCQA 1JJ2F 5BMVA 3LWPC 4ZHWA 2Q1YA 1VQKF 3P4EA 1KC8H 4M8IA 2YXZA 4E6EA 4ZK7A 1JY8A 5GINC 3CPQA 4I4TA 3CCLF 5BMVB 3L7QA 3UT5A 1W5AA 3NK7A 2HS4A 1M1KH 1H7MA 3CG6A 2UZHA 3FPIA 3C9SA 3NMUC 4I4TB 5HXUA 1SZQA 5EB1B 1DT9A 2AIZP 4B5CA 2Z1EA 2N48A 1DBFA 3RYHB 4YJ2A 1IPAA 4BW0B 1IV4A 4G4ZA 4BVQA 3CCJF 4O2BA 3JAWA 2VGMA 5FLXM 1W59A 4YJ2B 3G71F 3JAKA 2AMTA 4EB6A 3C9TA 1W5BA 1RLGA 5LOVA 1X7PA 3ZO8A 3HWUA 5JVDA 3CMEF 4O2BB 5JH7A 3JVHA 3N4ZA 3JAKB 4U39A 3CC7F 4EB6B 3OBWA 5LOVB 2CZWA 5JVDB 1K9MH 2QTPA 5JH7B 4NUTA 1COMA 4TV9B 1T0KB 4BT4A 4EI8A 2OHWA 3BYQA 4BVTA 3N2KA 1Q82H 1PF5A 3JASA 3S0YA 3I56F 2QA4F 3F0DA 4LCKA 4G4VA 5HXZA 3FFMA 3MCQA 1X52A 3JAMM 3AGKA 1W581 2WALA 2W8BC 3C9RA 3N2KB 2MQEA 2PMPA 3JASB 4NWOB 3KHNA 2OTJF 2AIFA 1GZ0A 5EO3A 5J2UA 5CA0A 2RHLA 3CMAF 5A2QM 3WGLA 1RQ7A 1QD9A 5KX5A 4O4IA 3S06A 1Q8RA 5J2UB 5EIBD 3IEQA 5CA0B 2RHJA 5HY2A 2NMUA 2BTQB 3SIVA 1PXWA 1R1MA 5KX5B 4O4IB 2LBTA 2K1SA 3CB2A 3CYPB 2Q1XA 3PAFA 3FD5A 3CCSF 4BT2A 5G4VC 1W2BF 3IKFA 1IV2A 3K12A 3F0FA 1TUBA 4BVSA 1VQNF 3CCQF 2FC3A 3JATA 2ZODA 2H8EA 4R40B 4BT6A 3I55F 3NVKE 1TUBB 4B45A 5GAPK 3JALA 4X3MA 1CK2A 3ELCA 5EWRA 3VCZA 5CB4A 2OTLF 1VH8A 3JATB 4LNUA 1VQOF 5LXTA 4EI7A 2CHTA 2ZAUA 4X1KA 5J2TA 4U3JA 3JALB 3LFOA 1Z5WA 5CB4B 2CW4A 2HRUA 3OBYA 4LNUB 4ZHVA 3PLAC 2BO1A 1W41A 3HAXD 1H47A 4G4WA 5LXTB 5IT9M 4G4XA 4X1KB 5G4UC 3K14A 5J2TB 3CC4F 4TV8A 1VQMF 4U3JB 2CWJA 2R751 1KNJA 1VQ6F 2HS3A 3QTYA 5ITZB 3S02A 2RHHA 1YITF 3GHZA 4TV8B 3M1XA 3JCMM 3CPWF 3MCAB 4RQOA 1U3LA 2CVLA 2VAPA 2UYJA 2KG4A 3E20B 2OZBA 3HKBA 3UT5B 4G88A 4PWTA 3V7EA 1VQ4F 3D00A 3I3FA 2GLZA 1K73H 3SIUA 2L26A 5FNVA 3IKEA 3HKBB 5CA1A 2LBWA 2I6DA 4BY9D 3RYCA 5LYJA 1OAPA 2YYEA 2ZVZA 1TVKA 5FNVB 1Q81H 3RA5A 2UYPA 5CA1B 2RB9A 2P6YA 2DT4A 3EORA 3RYCB 5LYJB 4ZI7A 3JAWB 1XRGA 1TVKB 3LMEA 1U43A 4BT3A 1JFFA 1RA4A 5MN4A 1Q7YH 1RQ2A 2PHNA 2Z1TA 4WBNA 1Z5VA 4F6RA 2R6R1 5GANK 1KQSF 4ZI7B 1UI9A 2LBXA 1M90H 2HVYD 2VXYA 1JFFB 1NMUB 4C81A 2FGYA 3E22A 3M4SA 3TD5A 3VYUC 4F6RB 4EI9A 2QEXF 3CC2F 4O2AA 2V9YA 1VQ9F 5KMGA 3E22B 5GONA 3WPXA 1SA0A 1XHOA 3TD3A 4O2AB 3B6NA 3WJQA 3ON1A 5KMGB 3VIUA 4TUYA 3S0WA 5GONB 1SA0B 3HKCA 3OONA 4B62A 3D54A 3GYQA 4DRXA 3V4DA 1U40A 3DC2A 4TUYB 4BT5A 3F0GA 3HKCB 1VQPF 3OW2F 3IMPA 3VOBA 4DRXB 3LWVC 1W3EX 3I7TA 4I55A 1CN7A 3V3TA 4O4HA 4B46A 4DXDA 1FFXA 3VO8A 1H48A 5HP8A 2HP0A 5GIPC 3DDNA 3WGMA 4I55B 1QU9A 2JNBA 2OTMA 5EYPA 4O4JA 4O4HB 1IV3A 1FFXB 3KIZA 4FFBA 3VMFB 1W5EA 2VGNA 3P0ZA 4X3LA 1RLUA 2HP0B 3VYSC 1VQVA 5EYPB 4ZHYB 4O4JB 1ODEA 4ERHA 1X7OA 1VHAA 3VI6A 4FFBB 1JD1A 5JCOC 4IHJA 2H8CA 5EZYA 4C4WC 3N4YA 5MN5A 4IHJB 5EZYB 1U3PA 3TD4A 4O4LA 3LWOC 1SDSA 2GZLA 2UYNA 1X25A 3RYFA 1YJNF 2GVIA 3VYTC 3VTIC 1XBIA 4O4LB 3G6EF 3R0PA 1YIJF 2UYNB 3LWQC 1QVGF 1W42A 2H6LA 1YQNA 3C8LA 1VQLF 3FBAA 5C8YA 3VOAA 1GO1A 3M84A 3LDTA 4X20A 3WGJA 3WXMB 5DCVA 2ALEA 2Z01A 1OFUA 5C8YB 3HTNA 3J7AR 4X20B 2LCAA 3NVIB 1YGYA 2CSLA 3RYHA 5AVMA 3CCRF 2Z1UA 1YHQF 3U0OA 5EIBC 3RA6A 5JQGA 2F9ZC 3WJPA 2BTUA 3CD6F 4ZOLA 5HY0A 5IJ9A 3CCVF 3N2GA 1GO0A 1W55A 3ESJA 5JQGB 1VK3A 4G4YA 3KJKA 3CXCF 1QVFF 1ZWZA 4I50A 4WBNB 4ZOLB 1KNKA 1VQ5F 3P10A 5IYZA 1CLIA 5IJ9B 3N2GB 3ZP7A 2CHSA 1FNJA 4I50B 4TV9A 2HQSC 1W5FA 1W57A 5IYZB 2Z1FA 2HX0A 1S72F 3KJJA 3O85A 3IEWA 3S0HA 2ZVYA 4IIJA 1NQ3A 2ZF8A 2HS0A 4C8GA 5LP6A 5EB0A 5FJ4C 3LWRC 4BT7A 1T0AA 5EAZA 3S03A 3V7QA 4C8EA 3QUWA 4IIJB 3HKDA 2HRYA 3E1YA 2IG8A 5MN6A 2KGWA 5B8FA 5LP6B 3Q8HA 3RE3A 3NK6A 1NJIH 5JCOA 5HP7A 1FSZA 1YJ9F 4ZHQA 1E7KA 3MBMA 3K0TA 3K2XA 3HKEA 3J81M 3HKDB 1KD1H 1Q86H 3MQWA 1N8RH 3CCMF 2QI2A 3WGNA 3ZOPA 3FD6A 4HNAA 4BVRA 5IJ0A 3LYBA 4ZHQB 2ZOVA 2KTUA 3HKEB 5HWEA 3G4SF 1JN1A 1UFYA 2UYKA 3CCUF 3HJWC 3WGKA 3RYIA 3T80A 3F0EA 5LP6C 4TZZA 4HNAB 3JARA 3ZP4A 4YJ3A 5IJ0B 2BTOA 3J80M 2IAFA 2IQQA 4RHAA 5GIOC 1J7HA 1YI2F 1IV1A 3RYIB 1YJWF 5HY1A 4X1YA 1W40A 3JARB 4YJ3B 2DYYA 1QAHA 4X1IA 4C8IA 1ONIA
chains in the Genus database with same CATH topology
1VQLF 2KTVA 3CMAF 5A2QM 5HY4A 1GO1A 5GANK 1KQSF 3CCEF 2LBXA 3WXMB 1M90H 2HVYD 5DCVA 1VQ7F 1NMUB 3IR9A 2FGYA 2ALEA 5HY2A 3SIVA 3J7AR 1PXWA 4EI9A 4NQ3A 2QEXF 3CC2F 3NVIB 1VQ9F 3CCRF 1K8AH 1YHQF 3PAFA 3RA6A 3CCSF 1VQ8F 5G4VC 1W2BF 2F9ZC 3ON1A 4XCQA 1JJ2F 3LWPC 4BVSA 3CD6F 1VQNF 1VQKF 5HY0A 3CCQF 1KC8H 2FC3A 3CCVF 1GO0A 3GYQA 5GINC 3CPQA 3I55F 3CXCF 3CCLF 1QVFF 1ZWZA 3NVKE 5GAPK 4X3MA 1CK2A 1VQ5F 5EWRA 2OTLF 3NK7A 1VQOF 1VQPF 1M1KH 1H7MA 3CG6A 4EI7A 3OW2F 3NMUC 3LWVC 1W3EX 5HXUA 1CN7A 3LFOA 3V3TA 1RA4A 3OBYA 1DT9A 1S72F 3PLAC 3O85A 2BO1A 1W41A 3HAXD 5IT9M 5G4UC 5GIPC 3CC4F 1VQMF 1IPAA 2JNBA 4BW0B 5FJ4C 3LWRC 4BVQA 3CCJF 1VQ6F 3VMFB 3V7QA 2VGMA 2VGNA 5FLXM 1YITF 4X3LA 3G71F 3JCMM 3E1YA 3CPWF 3MCAB 1RLGA 1X7PA 3NK6A 1NJIH 1X7OA 3VI6A 3CMEF 1YJ9F 1E7KA 4C4WC 2KG4A 3E20B 3J81M 1KD1H 3N4ZA 1Q86H 2OZBA 3CC7F 1N8RH 3N4YA 3CCMF 2QI2A 3OBWA 3V7EA 2CZWA 4BVRA 1VQ4F 3D00A 1K9MH 2GLZA 4NUTA 1K73H 3SIUA 2KTUA 5HWEA 3G4SF 3HJWC 3CCUF 1T0KB 3LWOC 1SDSA 4EI8A 2LBWA 2I6DA 2OHWA 4BY9D 4BVTA 4TZZA 1Q82H 3I56F 2QA4F 1YJNF 4LCKA 5HXZA 3J80M 3FFMA 1X52A 3JAMM 1Q81H 1XBIA 3AGKA 3RA5A 5GIOC 1YI2F 2WALA 3G6EF 1YJWF 1YIJF 5HY1A 1W40A 3LWQC 2OTJF 2AIFA 1QVGF 1W42A 1GZ0A 5EO3A 1Q7YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL F;  2KTV A;  3CMA F;  5A2Q M;  1GO1 A;  5GAN K;  1KQS F;  3CCE F;  2LBX A;  3WXM B;  1M90 H;  2HVY D;  5DCV A;  1VQ7 F;  1NMU B;  3IR9 A;  2ALE A;  3SIV A;  3J7A R;  1PXW A;  2QEX F;  3CC2 F;  3NVI B;  1VQ9 F;  3CCR F;  1K8A H;  1YHQ F;  3PAF A;  3RA6 A;  3CCS F;  1VQ8 F;  5G4V C;  1W2B F;  3ON1 A;  1JJ2 F;  3LWP C;  3CD6 F;  1VQN F;  1VQK F;  1KC8 H;  3CCQ F;  2FC3 A;  3CCV F;  1GO0 A;  3GYQ A;  5GIN C;  3CPQ A;  3I55 F;  3CXC F;  3CCL F;  1QVF F;  1ZWZ A;  3NVK E;  5GAP K;  4X3M A;  1CK2 A;  1VQ5 F;  5EWR A;  2OTL F;  3NK7 A;  1VQO F;  1VQP F;  1M1K H;  1H7M A;  3CG6 A;  3OW2 F;  3NMU C;  3LWV C;  1W3E X;  1CN7 A;  3LFO A;  1RA4 A;  3OBY A;  1DT9 A;  1S72 F;  3PLA C;  3O85 A;  2BO1 A;  1W41 A;  3HAX D;  5IT9 M;  5G4U C;  5GIP C;  3CC4 F;  1VQM F;  1IPA A;  2JNB A;  4BW0 B;  5FJ4 C;  3LWR C;  3CCJ F;  1VQ6 F;  3VMF B;  3V7Q A;  2VGM A;  2VGN A;  5FLX M;  1YIT F;  4X3L A;  3G71 F;  3JCM M;  3E1Y A;  3CPW F;  3MCA B;  1RLG A;  1X7P A;  3NK6 A;  1NJI H;  1X7O A;  3VI6 A;  3CME F;  1YJ9 F;  1E7K A;  4C4W C;  2KG4 A;  3E20 B;  3J81 M;  1KD1 H;  3N4Z A;  1Q86 H;  2OZB A;  3CC7 F;  1N8R H;  3N4Y A;  3CCM F;  2QI2 A;  3OBW A;  3V7E A;  2CZW A;  1VQ4 F;  1K9M H;  4NUT A;  1K73 H;  3SIU A;  2KTU A;  3G4S F;  3HJW C;  3CCU F;  1T0K B;  3LWO C;  1SDS A;  2LBW A;  2I6D A;  2OHW A;  4BY9 D;  4TZZ A;  1Q82 H;  3I56 F;  2QA4 F;  1YJN F;  4LCK A;  3J80 M;  3FFM A;  1X52 A;  3JAM M;  1Q81 H;  1XBI A;  3AGK A;  3RA5 A;  5GIO C;  1YI2 F;  2WAL A;  3G6E F;  1YJW F;  1YIJ F;  1W40 A;  3LWQ C;  2OTJ F;  2AIF A;  1QVG F;  1W42 A;  1GZ0 A;  5EO3 A;  1Q7Y H; 
#chains in the Genus database with same CATH topology
 2B33 A;  2KTV A;  5LA6 A;  5HY4 A;  2VAW A;  2VAM A;  3WPW A;  2EWC A;  4X1Y B;  3CCE F;  3CYQ A;  4X1I B;  1VQ7 F;  3MDO A;  3IR9 A;  4KWE A;  2RHO A;  3KE1 A;  3QHD A;  2G9I A;  1FNK A;  5LA6 B;  3GTZ A;  4NQ3 A;  3D01 A;  3ERN A;  2HP3 A;  1K8A H;  3F6M A;  3WJR A;  1XV2 A;  3C9U A;  4C82 A;  3RYF B;  1VQ8 F;  2I6R A;  1GX1 A;  5ITZ A;  4XCQ A;  1JJ2 F;  5BMV A;  3LWP C;  4ZHW A;  2Q1Y A;  1VQK F;  3P4E A;  1KC8 H;  4M8I A;  2YXZ A;  4E6E A;  4ZK7 A;  1JY8 A;  5GIN C;  3CPQ A;  4I4T A;  3CCL F;  5BMV B;  3L7Q A;  3UT5 A;  1W5A A;  3NK7 A;  2HS4 A;  1M1K H;  1H7M A;  3CG6 A;  2UZH A;  3FPI A;  3C9S A;  3NMU C;  4I4T B;  5HXU A;  1SZQ A;  5EB1 B;  1DT9 A;  2AIZ P;  4B5C A;  2Z1E A;  2N48 A;  1DBF A;  3RYH B;  4YJ2 A;  1IPA A;  4BW0 B;  1IV4 A;  4G4Z A;  4BVQ A;  3CCJ F;  4O2B A;  3JAW A;  2VGM A;  5FLX M;  1W59 A;  4YJ2 B;  3G71 F;  3JAK A;  2AMT A;  4EB6 A;  3C9T A;  1W5B A;  1RLG A;  5LOV A;  1X7P A;  3ZO8 A;  3HWU A;  5JVD A;  3CME F;  4O2B B;  5JH7 A;  3JVH A;  3N4Z A;  3JAK B;  4U39 A;  3CC7 F;  4EB6 B;  3OBW A;  5LOV B;  2CZW A;  5JVD B;  1K9M H;  2QTP A;  5JH7 B;  4NUT A;  1COM A;  4TV9 B;  1T0K B;  4BT4 A;  4EI8 A;  2OHW A;  3BYQ A;  4BVT A;  3N2K A;  1Q82 H;  1PF5 A;  3JAS A;  3S0Y A;  3I56 F;  2QA4 F;  3F0D A;  4LCK A;  4G4V A;  5HXZ A;  3FFM A;  3MCQ A;  1X52 A;  3JAM M;  3AGK A;  1W58 1;  2WAL A;  2W8B C;  3C9R A;  3N2K B;  2MQE A;  2PMP A;  3JAS B;  4NWO B;  3KHN A;  2OTJ F;  2AIF A;  1GZ0 A;  5EO3 A;  5J2U A;  5CA0 A;  2RHL A;  3CMA F;  5A2Q M;  3WGL A;  1RQ7 A;  1QD9 A;  5KX5 A;  4O4I A;  3S06 A;  1Q8R A;  5J2U B;  5EIB D;  3IEQ A;  5CA0 B;  2RHJ A;  5HY2 A;  2NMU A;  2BTQ B;  3SIV A;  1PXW A;  1R1M A;  5KX5 B;  4O4I B;  2LBT A;  2K1S A;  3CB2 A;  3CYP B;  2Q1X A;  3PAF A;  3FD5 A;  3CCS F;  4BT2 A;  5G4V C;  1W2B F;  3IKF A;  1IV2 A;  3K12 A;  3F0F A;  1TUB A;  4BVS A;  1VQN F;  3CCQ F;  2FC3 A;  3JAT A;  2ZOD A;  2H8E A;  4R40 B;  4BT6 A;  3I55 F;  3NVK E;  1TUB B;  4B45 A;  5GAP K;  3JAL A;  4X3M A;  1CK2 A;  3ELC A;  5EWR A;  3VCZ A;  5CB4 A;  2OTL F;  1VH8 A;  3JAT B;  4LNU A;  1VQO F;  5LXT A;  4EI7 A;  2CHT A;  2ZAU A;  4X1K A;  5J2T A;  4U3J A;  3JAL B;  3LFO A;  1Z5W A;  5CB4 B;  2CW4 A;  2HRU A;  3OBY A;  4LNU B;  4ZHV A;  3PLA C;  2BO1 A;  1W41 A;  3HAX D;  1H47 A;  4G4W A;  5LXT B;  5IT9 M;  4G4X A;  4X1K B;  5G4U C;  3K14 A;  5J2T B;  3CC4 F;  4TV8 A;  1VQM F;  4U3J B;  2CWJ A;  2R75 1;  1KNJ A;  1VQ6 F;  2HS3 A;  3QTY A;  5ITZ B;  3S02 A;  2RHH A;  1YIT F;  3GHZ A;  4TV8 B;  3M1X A;  3JCM M;  3CPW F;  3MCA B;  4RQO A;  1U3L A;  2CVL A;  2VAP A;  2UYJ A;  2KG4 A;  3E20 B;  2OZB A;  3HKB A;  3UT5 B;  4G88 A;  4PWT A;  3V7E A;  1VQ4 F;  3D00 A;  3I3F A;  2GLZ A;  1K73 H;  3SIU A;  2L26 A;  5FNV A;  3IKE A;  3HKB B;  5CA1 A;  2LBW A;  2I6D A;  4BY9 D;  3RYC A;  5LYJ A;  1OAP A;  2YYE A;  2ZVZ A;  1TVK A;  5FNV B;  1Q81 H;  3RA5 A;  2UYP A;  5CA1 B;  2RB9 A;  2P6Y A;  2DT4 A;  3EOR A;  3RYC B;  5LYJ B;  4ZI7 A;  3JAW B;  1XRG A;  1TVK B;  3LME A;  1U43 A;  4BT3 A;  1JFF A;  1RA4 A;  5MN4 A;  1Q7Y H;  1RQ2 A;  2PHN A;  2Z1T A;  4WBN A;  1Z5V A;  4F6R A;  2R6R 1;  5GAN K;  1KQS F;  4ZI7 B;  1UI9 A;  2LBX A;  1M90 H;  2HVY D;  2VXY A;  1JFF B;  1NMU B;  4C81 A;  2FGY A;  3E22 A;  3M4S A;  3TD5 A;  3VYU C;  4F6R B;  4EI9 A;  2QEX F;  3CC2 F;  4O2A A;  2V9Y A;  1VQ9 F;  5KMG A;  3E22 B;  5GON A;  3WPX A;  1SA0 A;  1XHO A;  3TD3 A;  4O2A B;  3B6N A;  3WJQ A;  3ON1 A;  5KMG B;  3VIU A;  4TUY A;  3S0W A;  5GON B;  1SA0 B;  3HKC A;  3OON A;  4B62 A;  3D54 A;  3GYQ A;  4DRX A;  3V4D A;  1U40 A;  3DC2 A;  4TUY B;  4BT5 A;  3F0G A;  3HKC B;  1VQP F;  3OW2 F;  3IMP A;  3VOB A;  4DRX B;  3LWV C;  1W3E X;  3I7T A;  4I55 A;  1CN7 A;  3V3T A;  4O4H A;  4B46 A;  4DXD A;  1FFX A;  3VO8 A;  1H48 A;  5HP8 A;  2HP0 A;  5GIP C;  3DDN A;  3WGM A;  4I55 B;  1QU9 A;  2JNB A;  2OTM A;  5EYP A;  4O4J A;  4O4H B;  1IV3 A;  1FFX B;  3KIZ A;  4FFB A;  3VMF B;  1W5E A;  2VGN A;  3P0Z A;  4X3L A;  1RLU A;  2HP0 B;  3VYS C;  1VQV A;  5EYP B;  4ZHY B;  4O4J B;  1ODE A;  4ERH A;  1X7O A;  1VHA A;  3VI6 A;  4FFB B;  1JD1 A;  5JCO C;  4IHJ A;  2H8C A;  5EZY A;  4C4W C;  3N4Y A;  5MN5 A;  4IHJ B;  5EZY B;  1U3P A;  3TD4 A;  4O4L A;  3LWO C;  1SDS A;  2GZL A;  2UYN A;  1X25 A;  3RYF A;  1YJN F;  2GVI A;  3VYT C;  3VTI C;  1XBI A;  4O4L B;  3G6E F;  3R0P A;  1YIJ F;  2UYN B;  3LWQ C;  1QVG F;  1W42 A;  2H6L A;  1YQN A;  3C8L A;  1VQL F;  3FBA A;  5C8Y A;  3VOA A;  1GO1 A;  3M84 A;  3LDT A;  4X20 A;  3WGJ A;  3WXM B;  5DCV A;  2ALE A;  2Z01 A;  1OFU A;  5C8Y B;  3HTN A;  3J7A R;  4X20 B;  2LCA A;  3NVI B;  1YGY A;  2CSL A;  3RYH A;  5AVM A;  3CCR F;  2Z1U A;  1YHQ F;  3U0O A;  5EIB C;  3RA6 A;  5JQG A;  2F9Z C;  3WJP A;  2BTU A;  3CD6 F;  4ZOL A;  5HY0 A;  5IJ9 A;  3CCV F;  3N2G A;  1GO0 A;  1W55 A;  3ESJ A;  5JQG B;  1VK3 A;  4G4Y A;  3KJK A;  3CXC F;  1QVF F;  1ZWZ A;  4I50 A;  4WBN B;  4ZOL B;  1KNK A;  1VQ5 F;  3P10 A;  5IYZ A;  1CLI A;  5IJ9 B;  3N2G B;  3ZP7 A;  2CHS A;  1FNJ A;  4I50 B;  4TV9 A;  2HQS C;  1W5F A;  1W57 A;  5IYZ B;  2Z1F A;  2HX0 A;  1S72 F;  3KJJ A;  3O85 A;  3IEW A;  3S0H A;  2ZVY A;  4IIJ A;  1NQ3 A;  2ZF8 A;  2HS0 A;  4C8G A;  5LP6 A;  5EB0 A;  5FJ4 C;  3LWR C;  4BT7 A;  1T0A A;  5EAZ A;  3S03 A;  3V7Q A;  4C8E A;  3QUW A;  4IIJ B;  3HKD A;  2HRY A;  3E1Y A;  2IG8 A;  5MN6 A;  2KGW A;  5B8F A;  5LP6 B;  3Q8H A;  3RE3 A;  3NK6 A;  1NJI H;  5JCO A;  5HP7 A;  1FSZ A;  1YJ9 F;  4ZHQ A;  1E7K A;  3MBM A;  3K0T A;  3K2X A;  3HKE A;  3J81 M;  3HKD B;  1KD1 H;  1Q86 H;  3MQW A;  1N8R H;  3CCM F;  2QI2 A;  3WGN A;  3ZOP A;  3FD6 A;  4HNA A;  4BVR A;  5IJ0 A;  3LYB A;  4ZHQ B;  2ZOV A;  2KTU A;  3HKE B;  5HWE A;  3G4S F;  1JN1 A;  1UFY A;  2UYK A;  3CCU F;  3HJW C;  3WGK A;  3RYI A;  3T80 A;  3F0E A;  5LP6 C;  4TZZ A;  4HNA B;  3JAR A;  3ZP4 A;  4YJ3 A;  5IJ0 B;  2BTO A;  3J80 M;  2IAF A;  2IQQ A;  4RHA A;  5GIO C;  1J7H A;  1YI2 F;  1IV1 A;  3RYI B;  1YJW F;  5HY1 A;  4X1Y A;  1W40 A;  3JAR B;  4YJ3 B;  2DYY A;  1QAH A;  4X1I A;  4C8I A;  1ONI A; 
#chains in the Genus database with same CATH homology
 1VQL F;  2KTV A;  3CMA F;  5A2Q M;  5HY4 A;  1GO1 A;  5GAN K;  1KQS F;  3CCE F;  2LBX A;  3WXM B;  1M90 H;  2HVY D;  5DCV A;  1VQ7 F;  1NMU B;  3IR9 A;  2FGY A;  2ALE A;  5HY2 A;  3SIV A;  3J7A R;  1PXW A;  4EI9 A;  4NQ3 A;  2QEX F;  3CC2 F;  3NVI B;  1VQ9 F;  3CCR F;  1K8A H;  1YHQ F;  3PAF A;  3RA6 A;  3CCS F;  1VQ8 F;  5G4V C;  1W2B F;  2F9Z C;  3ON1 A;  4XCQ A;  1JJ2 F;  3LWP C;  4BVS A;  3CD6 F;  1VQN F;  1VQK F;  5HY0 A;  3CCQ F;  1KC8 H;  2FC3 A;  3CCV F;  1GO0 A;  3GYQ A;  5GIN C;  3CPQ A;  3I55 F;  3CXC F;  3CCL F;  1QVF F;  1ZWZ A;  3NVK E;  5GAP K;  4X3M A;  1CK2 A;  1VQ5 F;  5EWR A;  2OTL F;  3NK7 A;  1VQO F;  1VQP F;  1M1K H;  1H7M A;  3CG6 A;  4EI7 A;  3OW2 F;  3NMU C;  3LWV C;  1W3E X;  5HXU A;  1CN7 A;  3LFO A;  3V3T A;  1RA4 A;  3OBY A;  1DT9 A;  1S72 F;  3PLA C;  3O85 A;  2BO1 A;  1W41 A;  3HAX D;  5IT9 M;  5G4U C;  5GIP C;  3CC4 F;  1VQM F;  1IPA A;  2JNB A;  4BW0 B;  5FJ4 C;  3LWR C;  4BVQ A;  3CCJ F;  1VQ6 F;  3VMF B;  3V7Q A;  2VGM A;  2VGN A;  5FLX M;  1YIT F;  4X3L A;  3G71 F;  3JCM M;  3E1Y A;  3CPW F;  3MCA B;  1RLG A;  1X7P A;  3NK6 A;  1NJI H;  1X7O A;  3VI6 A;  3CME F;  1YJ9 F;  1E7K A;  4C4W C;  2KG4 A;  3E20 B;  3J81 M;  1KD1 H;  3N4Z A;  1Q86 H;  2OZB A;  3CC7 F;  1N8R H;  3N4Y A;  3CCM F;  2QI2 A;  3OBW A;  3V7E A;  2CZW A;  4BVR A;  1VQ4 F;  3D00 A;  1K9M H;  2GLZ A;  4NUT A;  1K73 H;  3SIU A;  2KTU A;  5HWE A;  3G4S F;  3HJW C;  3CCU F;  1T0K B;  3LWO C;  1SDS A;  4EI8 A;  2LBW A;  2I6D A;  2OHW A;  4BY9 D;  4BVT A;  4TZZ A;  1Q82 H;  3I56 F;  2QA4 F;  1YJN F;  4LCK A;  5HXZ A;  3J80 M;  3FFM A;  1X52 A;  3JAM M;  1Q81 H;  1XBI A;  3AGK A;  3RA5 A;  5GIO C;  1YI2 F;  2WAL A;  3G6E F;  1YJW F;  1YIJ F;  5HY1 A;  1W40 A;  3LWQ C;  2OTJ F;  2AIF A;  1QVG F;  1W42 A;  1GZ0 A;  5EO3 A;  1Q7Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...