4X1YB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 144
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1yB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1yB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1yB01
4YJ3A 5EZYB 4O4HA 4O4IB 1W5FA 3M89A 5JH7B 3V3TA 5CA1A 1TUBB 5BMVA 5FNVB 3JAKA 5M7EA 5CA0A 3ZBQA 3ZIDA 2RHOA 1W5BA 1RQ7A 5MN6A 2BTQB 3HKBB 3JATA 4ZOLB 1Z5WA 1SA0B 4X1YA 5CB4A 4I4TA 3WGLA 4HNAB 2Q1YA 5EIBD 5LP6B 5GONB 5IJ9A 5JH7A 1W5EA 1TUBA 3JASB 4I50B 4WBNB 5FNVA 4FFBB 3RYHB 5EYPB 5LXTB 5EIBC 3WGNA 2BTQA 4O4LB 4ZOLA 5J2UB 2BTOA 5KMGA 3CB2A 3HKEB 5LOVB 5ITZB 4X1KA 4IHJB 2RHLA 5C8YA 4O2AB 3JASA 5J2TB 4DRXA 4WBNA 3WGKA 4EB6A 4FFBA 3RYHA 2R751 5LXTA 3N2GB 4IIJB 3RYFB 3RYCB 3JARA 1RLUA 4I55B 4O4JA 4TUYB 5LA6B 2VXYA 4X1IA 3E22B 3JALA 3HKEA 3R4VA 2XKBA 5LOVA 5JVDB 5EZYA 4X20B 4O4IA 5ITZA 5IYZB 5J2TA 4EI8A 3RYIB 1JFFB 4U3JB 3N2KB 4LNUB 3N2GA 3RYFA 3RYCA 1TVKB 4I55A 4B45A 3HKBA 4TUYA 3E22A 2VAMA 1SA0A 5MN4A 2XKAA 4XCQA 4TV9B 2VAWA 3HKCB 4HNAA 4O2BB 3UT5B 5GONA 5LP6A 3RYIA 3JAWB 3HKDB 3N2KA 4I50A 4E6EA 4LNUA 4YJ2B 4F6RB 1FFXB 5EYPA 4ZHQB 1TVKA 5KX5B 4O4LA 5IJ0B 1W581 5J2UA 4ZI7B 1W59A 4TV9A 4O4HB 3HKCA 3UT5A 5MN5A 3JAKB 4IHJA 3HKDA 4O2AA 5CA0B 3ZBPA 4F6RA 5JQGB 1FFXA 5JCOA 3JATB 5CB4B 4X1YB 4IIJA 5KX5A 2RHJA 4I4TB 5LA6A 4ZI7A 4TV8B 3VOBA 4DXDA 3RB8A 3VO9A 5IJ9B 3VPAA 5JVDA 1Z5VA 5IYZA 4X20A 1RQ2A 4U39A 4EI9A 4M8IA 5JQGA 5LYJB 1JFFA 4U3JA 5JCOC 2Q1XA 2R6R1 4EI7A 3C8LA 5KMGB 4B46A 3VOAA 4TV8A 4YJ3B 4X1KB 5C8YB 5LP6C 2GVIA 5CA1B 4DRXB 2RHHA 4O2BA 3WGMA 3M8KA 4EB6B 5BMVB 5LYJA 1OFUA 3JAWA 1FSZA 1W5AA 4YJ2A 4KWEA 3JARB 3VO8A 4O4JB 4ZHQA 4X1IB 3JALB 2VAPA 5IJ0A 3WGJA
chains in the Genus database with same CATH superfamily
1KMHA 2XECA 5KWSA 1Z7GA 4URXR 2OC4A 5E4TA 1IBKO 5IJ9A 1ZA1A 4QGFA 4X41A 5IDQA 4WI1A 1GM7A 3FPSA 5I3CA 3WYEA 1IXSB 2VDVE 5FWDA 2WI8A 1TU0A 4TWJA 4PZZA 2OBXA 1A9XA 2W0SA 3W8EA 5FT9A 4DC1A 1XHLA 3AQIA 2J08A 1E61A 5DP2A 4BTLA 3IFSA 4X8OA 3HK2A 1H2FA 1OFGA 4O02B 1KP2A 4CQMB 1TM4E 4MHOA 2Q7XA 3S3WA 1UZUA 3R6WA 2EGGA 4R1PA 2QQEA 3WR5A 1INLA 4BIUA 3REOA 5FORA 4Z1MA 1CRPA 4B3FX 1OLXB 1YZNA 4N6OA 5AD1A 5I7UA 4NTZA 1GO0A 4D81A 2YV1A 3ZGVA 2QTMA 1WU8A 5KTYA 1Y89A 2CFOA 2XGJA 2GBGA 2OG1A 2LW1A 2X8WA 2J30A 3RVSA 3AP2A 4HRXA 4FN4A 3C74A 4BUCA 4PAGA 2HJSA 2GESA 4Q18A 1LI4A 4EATA 4X93A 1RYBA 1SEVA 2V7BA 4I99A 3CCQF 2Y67A 2PO7A 3ZWQA 2I4NA 1J25A 2PSEA 4OXIA 4ZU6X 2E9SA 2ZRBA 2C94A 5J5VA 1OROA 1TT5B 3DD1A 4CMEA 3ZMTA 3RGGA 4FBMA 3W2GA 5DYGA 2FF5A 4KSBA 4BNGA 4V0ME 4GOLD 2HDHA 3NBYC 4LCBA 1T6YA 1M8FA 2ONZA 3N2EA 2X22A 3U1TA 1KHHA 4FM2A 3V3TA 1MB2A 1Q7TA 1T91A 5IJZA 3TQSA 3T5PA 3ZRVA 3OJCA 4FGLA 2HS4A 1HG0A 2JKZA 2VZ9A 4GXQA 4I4LA 3ZS8A 5CFMA 5TMEA 3P2KA 1BRTA 1Z6GA 1W75A 2GZ3A 4TYQA 3JARA 4JJ7A 4M21A 3SJQC 3QV1A 2FW6A 4PC7A 3B3AA 2CMHA 4MHSA 3UATA 3VYWA 4BKUA 1TQ2A 1UEIA 4X8MA 2C2YA 4D0SA 3IPRA 5LL6P 4CQLA 4IGFA 4J4BA 3PVCA 4YFVA 1GU0A 1AVTA 3RYTC 3E15A 4B3SB 1PR3A 1OIWA 1JQKA 3FDZB 3BRWD 2GDJA 2V7EA 1DXHA 4B08A 2UVDA 2Q7DA 2PKQO 4JLWA 4H7FA 2AUTA 1BCRB 1HFEL 3ZXYA 1GKIA 1ZUHA 4RD0A 3I8XA 2JAOA 3RQIA 1NN1A 4GMXA 2JBWA 4TXLA 2PYDA 4YAIA 4J41A 3TE7A 3VGJA 5C1BA 3TLXA 2UZHA 1JZSA 4GU5A 3ZCSA 3HDYA 2X77A 3QKUA 5DGIA 4DUZB 3RYCB 1V8FA 3LBHA 4OFXA 2GRUA 1U0NA 5CCBA 4G28B 2ZRDA 5TJ9A 4MW8A 3U4MA 4R3NA 3SYAA 2E55A 3GBSA 1N3YA 3DSQA 3DGEC 3U3MA 3O3MB 2DQ4A 4AZVA 3MUOA 3FGPA 2I67A 1R0LA 4IHJA 1N5JA 3M4YA 4MMZB 4BOYA 4F8EA 1PJLA 4B3CA 4BMPB 5C1OA 3PFBA 3GT0A 3ZN2A 3K9CA 1P75A 1CJTC 2JIOA 5TIIA 5ITVA 3SEAA 4RKYA 4N1AA 1PX0A 2Q21A 3VQXA 5CN0A 2XOKA 2EILC 1GPH1 4LYYA 2UYCA 4JJIA 3HB3B 1GZVA 1SZDA 3H84A 4DM4A 3HUEA 3NWBA 4DR5O 1Q0QA 3LGAA 2VQSA 4NJOA 5IDXA 1U6IA 1PSWA 1IDSA 2IYTA 5LMNO 3AM4A 1OXMA 2WE7A 2R9IA 1J09A 2B2XA 5KA5A 4QFBA 4Y3UA 3W3AD 3PF9A 2RHTA 3B36A 3JQ9C 3U6BA 4LYJA 1DC3A 3SC2B 2LBXA 1L7PA 4P38A 3GR6A 1B6SA 3D4PA 5K09A 1XO1A 1PJCA 1AI7A 3DE6X 4X97A 3C8UA 4AULA 2ORED 1H8HG 3ZTYA 1G3QA 2VGNA 2WJJA 2JGRA 3SYCA 5K0BA 5IE9A 4Z0HO 3K0KA 4BNFA 2C07A 5ADWA 3QO7A 3MTAA 1VL1A 3E7DA 1VARA 3FX7A 3LV8A 1HDEA 4NYMR 3I4FA 1Q2XA 1WW2A 1GILA 2C7RA 4CBCA 2HRDA 1ZM2A 4LZAA 3I53A 1OVMA 3CCJV 4RLHA 1R15A 2LGJA 4BN0A 3MTJA 1T4CA 4HDRB 2Q7OE 2BI7A 1B6TA 3ZIUA 2PUVA 4PCLA 2YMMA 4U8GA 3AH8A 4J11A 1R16A 2OV4A 2BLLA 2Z43A 2NV2B 2N74A 2VT6A 4K0RA 1YJ5A 1CLUA 5J43A 2EAUA 3UYKA 5HBGA 4B4OA 1W35A 3JS5A 2Q3HA 3QA9A 5H2FZ 5ARBA 1GA1A 2X9NA 3QEAZ 1WMBA 4WINA 1EWTA 5COQA 3PDIB 1EFVA 1ZSPA 4G4GA 1KERA 3EB9A 4OD0A 5JRJA 3COJA 2WD9A 3RC3A 2NADA 2HDOA 4M0DA 3Q1LA 3IKMB 3TQFA 1Q3KA 3L72H 3T3OA 4Y98A 4BGDA 2VNIA 1H9BA 2MSWA 3OT5A 4KQ6A 3LCJA 1P0FA 3LMEA 1UBLS 1Y42X 5IFKA 1Y98A 2JDID 3RU7A 3AW8A 3WRWA 4YRKA 1T0KB 4HH4A 1PJRA 2BE3A 1GTL1 3F96A 3PTAA 3CEJA 1JUDA 2Y92A 3JTMA 4G1UC 1G41A 2BJWA 4HSEA 4GT1A 4AYXA 4BB0A 3EC1A 4CTJA 2R9RB 4ND8A 3QH4A 4JVLA 3K9NA 1IUPA 4FHCA 5TB5A 5FF9A 2H8PC 4ZMBA 3E1SA 2CYCA 3HJGA 5EERA 4HUJA 2P62A 2HK6A 4OXYA 2B35A 4YJ2F 1Z5ZA 1Y3FE 1WCXA 4ZIBA 4BEVA 3DKPA 2R25B 2J59A 3FD8A 1ZN8A 3PGKA 1Y8RA 5CG1A 4TTJA 3SSOA 1GGVA 4FFDA 2IU3A 1GAXA 5L8VA 2R48A 4IO1A 1HKHA 3DONA 2LDBA 2CNKA 1SCDA 4G4VA 4BKPA 4RO0A 1R8XA 3U3ZA 3AP3A 3QI2A 2TMYA 1EZVH 1NBAA 4HYQA 3CPSA 3EJ6A 2HBQA 1HYQA 2WB4A 4MVQA 5BN5B 3E8GA 3HO8A 2C4KA 2QVCA 1JVBA 3EPRA 4DIDA 3K05A 4ZIRB 3ZQJA 4EQ6A 1TTQB 4IJVA 3VR3A 4E88A 2YWBA 1N33B 3AHGA 3L93A 1XMIA 2QTGA 5E2BA 4ZAXA 1TCBA 2BP7B 3UFXB 4FOPA 1BG6A 1RWKA 2C9DA 4F56A 2OLKA 1HLFA 4FGWA 1B3QA 2BGRA 2IHJA 4B17A 3WK7A 4MP6A 3S1SA 3JD0A 3G6EF 4MQ4A 3CS5A 1G4AE 1ZH6A 4S0ZA 5K1ZA 3G89A 1VKHA 2PGGA 5BNIA 1ODFA 3LCVB 1WB4A 5GQSA 2P11A 2PTMA 1P74A 4I0XB 4OJTA 1FP6A 3O0TA 4G1CA 5E3JA 4ZK2A 1EHYA 3HXMA 2OK7A 5B30A 1VP3A 1KC8W 1VQ6V 1JJAA 2EG9A 2HLHA 5IANA 2LO1A 4YJ3A 4QYSA 3G2OA 1NE7A 4BW9A 1MF7A 2G6BA 2Q4TA 4UFPA 5DBHX 5JMTA 2AFIB 4C21A 3UM9A 4B3JA 3WL4A 5CHEA 3ASZA 1FLNA 5JLAA 4QQFA 4CN8A 3K8OE 1CUCA 3KNZA 2NN4A 1RP3B 3I23A 3VZPA 4QRIA 3MJHA 1UJMA 3D3JA 4C88A 5ED0A 2JS3A 3KXIA 3ESZA 3GXBA 1UDAA 2DYSC 5GTHZ 3BABA 4NMXB 2ECFA 1US8B 4DLPA 4NH0A 3U9TA 4RKWA 3ZXSA 1XHXA 2QG4A 3SPIA 2W6JD 1XK7A 3OUFA 4ZZ0A 1FYXA 1FFSA 4F97A 5KQPA 1KETA 2O14A 1B3BA 3R7WB 2WF9A 3TSWA 1HYEA 4OHCA 1MGOA 4D9FA 3FCCA 13PKA 5ADVA 1YQ9A 1QO9A 3OCUA 5JMPA 4RC9A 1GGHA 1BS9A 3L04A 3D3QA 3NDPA 4K6GA 2JHFA 4HDMA 3OP1A 2Z58A 2CLSA 4UU1A 4HAXA 3N5CA 3W1EA 4K1LA 2B36A 4WUVA 1KJJA 3QWFA 1RBZA 3X2FA 4HZGA 4EKWA 2YXNA 2B9EA 4MARA 4R0VA 2XJ9A 3HJFA 1XROA 1MC1A 4ZDKA 1IURA 4M0EA 1D5AA 3I9V1 4HLCA 1PFKA 3PITA 5ETJA 2IS4A 5G3ZA 3UO3A 1ODSA 1IPEA 2QL6A 4LC0A 1KARA 5LWHA 1QIEA 1W581 4MW6A 1R6AA 4L0MA 4GKJB 2QRQA 4FBLA 1IWBB 1OXTA 3RRYA 3BJIC 3PT5A 1QBGA 2RH9B 4F3NA 2F64A 1QZXA 3L41A 5B2ZA 4XX0B 4KE9A 1U2PA 1A8HA 1HEIA 1NVVR 4YUWA 1T9BA 4DM7A 3NORA 3VKGA 3K5IA 1A9QA 5CNMA 3D8RA 2JLQA 4ERXA 3FUWA 1NTMH 2H4HA 3TN7A 3C41J 4TQUS 4K8ZA 3BWXA 5CUQA 5AVRA 2ODNA 5DBIA 1YONA 4KYTA 3HWUA 1MZPA 1NN3A 1E2UA 1XEAA 3OAAG 3E3MA 4NNPA 1V9CA 4ZVKA 3TK1A 1IRIA 4TWBA 2B1JA 3ADCA 1U98A 3RSLA 1MNAA 4HQ0A 2FN4A 1ZUD1 1TQDA 2NM0A 4HNSA 2ZRIA 3LOQA 4Y0VA 2MK3A 1GN3A 1Z5PA 4GPZA 4FYJA 3L0PA 2EZPA 1N8NA 3Q1KA 4WADA 4DA8A 1OSNA 4NMMA 1QVRA 1ISMA 1PR5A 3WLJA 1UBSB 1ODTC 1UANA 1J8QA 5U9CA 3HVJA 4D1YA 4OUDA 2WHPB 3FVVA 4TGLA 3IOYA 3RJMA 3UCEA 1P0QA 4AT1A 1WSBA 2IYWA 3M6FA 2HYDA 4YT2A 3BM5A 4IUYA 3ZV4A 3USES 3C3JA 3MWKA 3LWDA 3PNPA 3BL6A 2IHUA 1Z4LA 5CA0A 1ZIOA 3K0FA 1WAZA 5DBOA 2ZSUA 2W4IA 1I24A 2ZI7A 1LX6A 3CE6A 2HJFC 4RD4A 3WGQA 4DG5A 3TD9A 1NS1A 3FMIA 4DK0A 4Q4AB 4WK6A 8ADHA 5FO1A 1H66A 2W2XA 1LTQA 2JNWA 4JGGA 2E21A 3EVKA 1YZKA 1XDCA 4QSMA 4PYNA 1QWOA 1QIIA 1PNLA 4MT8A 4NY1A 1L8AA 2AW9A 4DC9A 2CV1A 1VPEA 3H19A 3CEIA 4TV9B 5EIFA 3A1EA 3RJ5A 3LUTB 1H2KA 4XUEA 3ILXA 1Z2EA 1XYGA 4R1OA 1DC7A 4DG8A 5L3SA 3MINB 3V32A 2D4AA 4UZFA 4ARZA 2PIAA 4PG6A 4ZO9A 2Q41A 4EVRA 4C6TA 2GTIA 1T5OA 1KC1A 2P6NA 1N0JA 1P2TA 2YOHA 5FUQA 3AG7A 1PW5A 3J7AU 3BXPA 1ISFA 1ZM9A 3C6QA 2EJ7A 4MRAA 3X1KA 3L9WA 3OH8A 2IYSA 4N9WA 3M5PA 1W29A 4GP9A 2P77A 4X3CA 3RYHB 2LKDA 3VYVA 4LQCA 4J9UE 5KUMA 1SPXA 4XCXA 1N4DA 4AJ9A 2QGNA 4CL8A 3DTUB 2BH9A 4J0KA 4GC9A 1Q74A 2Y6UA 1II0A 1N1MA 1W0JA 2WJPA 5EP2A 4C2UA 1IBCA 1K2VN 4IMRA 5AO9A 3JZFA 3I45A 3S8YA 4I7EA 3RBVA 4B31A 1I5EA 1FFHA 3FOFC 3IAEA 1T9DA 4MX8A 3V1LA 4DZTA 4FLXA 3QX8A 4JI4B 4MTFA 4DE5A 5CIWA 1JG7A 1V5IA 4UB6Z 4Z86A 3NVIB 4N6NA 2JBAA 1XAGA 1ZRMA 3U4DA 1FS5A 2DFLA 3AR6A 1WPRA 1CE8A 3JQ6A 3PR1A 3UBTA 2QKSA 1JHVA 3S81A 1AZSC 2IC5A 4U1RA 1A9TA 1NLMA 1QG2A 1K75A 1PTJA 3C8DA 3OEHD 4INJA 4WZBB 1SU7A 1X1AA 1XILA 2Q0QA 3RH0A 3FWNA 3LECA 1DDIA 1X42A 2QXYA 4MVJD 4K03A 3TL6A 3SXUA 3KPUA 3GRVA 2DH6A 1K7XB 4AY6A 2NQ8A 2V98A 5B7PA 3C6MA 2FF7A 1AE1A 3IAM6 3OU7A 3HVKA 5T4HA 2EL7A 1JIQA 1Z6AA 1P4AA 2VDMB 4TMWA 4KYVA 4JYAB 1QIDA 2Y2VA 1ZGCA 1ODLA 3DLTA 1YA8A 1E4EA 3RFFA 4G5SA 2BMJA 2MT9A 2WTMA 4XIJA 3TIIA 4LI3X 2R79A 1W6RA 1KKUA 3ZCVA 3LH5A 4RMHA 3U4GA 2PHZA 4FN5A 4RHXA 3WLLA 3M82A 4LFCB 4EGSA 3PI6A 4FD3A 4KQFA 2C77A 3JQAB 4CM9D 1BD3A 4DLXA 1UXHA 2ZYGA 4J0JA 4QDKA 1OCRB 5H80A 3H1PA 4Q3EA 2AXEA 3HUDA 3V4DA 1F9AA 3D81A 1M73E 4P80A 1EESA 1SCAA 4A36A 1NBWB 5C31A 3QBEA 4JCOA 3KSRA 5LSAA 5AIBA 3JCUZ 2O8NA 3OIYA 3KUUA 2XDWA 5IM5A 1QCEA 3OX1A 4HDKB 3ZWXA 4XGIA 2Y0EA 4BFSA 5BYJA 1YB1A 4MIYA 3U37A 1G7CA 1QCCA 4Z6KA 2XE4A 1G8GA 5D1NA 4NVRA 3U5TA 3SC4A 1FBTA 1KI6B 1M67A 2AW5A 1WD7A 3EDYA 2AN3A 1Z45A 1GN6A 5KSZA 2I1QA 2RG7A 3UAOA 3BGWA 3A4YA 1QC5B 1GNLA 1NG1A 2AZ2A 4BTEA 4BATA 1V8ZA 1FAFA 3O7WA 5IX8A 1L8QA 3S1AA 5K8CA 1T4BA 4BLPA 1I94B 1OJHA 1V4BA 1LW7A 2JJ8A 4C82A 4PYLA 3ORYA 3AL2A 3REFA 1FOEB 4CV2A 4DR7B 3IBSA 1PPJH 1QRTA 3ZY3A 1YCIA 4OK3A 2KG7A 4YREA 3G2KA 4ZCSA 4K2HA 1GCOA 1POWA 1DDGA 4NC9A 5K0FA 2P27A 2WALA 2CDYA 2P68A 4C29A 3QYPA 1N5IA 1ZAUA 3ILSA 2I65A 1SG9A 3K57A 3P3NA 2AS0A 1XTPA 3OF5A 5JY1A 3OZUA 3QELA 4OYRA 1I6MA 3OZTA 5ITWA 4OCZA 1T25A 5JSUA 1WG8A 1RCTE 4DSZA 4MJLA 4G5GA 1IOVA 3CX5F 4Z4FA 2PUAA 3BCHA 5MN5A 2VTBA 5CAEA 5BT8A 3RUHA 1PL4A 1R0SA 2O8DA 1SXJA 4IG9A 4YAGA 1NHWA 2AG1A 1ORDA 3I73A 4ZRNA 3FDJA 1JKXA 5I9TA 2REXB 2W5UA 3SIWA 1RVDA 1HG1A 2Y1DA 3NBQA 3UG7A 1CF4A 3O9ZA 3T4ZA 5E9JA 4EEKA 4UVAA 3H2ZA 1SFRA 2Y1EA 1ZD3A 4FWTA 1UZNA 2I87A 1NI3A 3R9XA 2AR7A 5F7OA 5DNEA 3D8NA 3NIBA 2XE8A 1CP2A 5ALFA 3KPYA 3K6SB 1KH2A 2F55A 1D8AA 4NDAA 4CTMA 2XF8A 3K0TA 2W2MA 4FB5A 3JSNA 3ISVA 2XT9A 5J9FA 3D4LA 1ZCJA 2DTDA 1X7XA 2O05A 1ORWA 4JBWA 2OTJV 4RUEA 2AD5A 1TYDE 5GONA 4REQB 4HF7A 1G6UA 1FB5A 5SV2A 1V39A 4FZ3A 3OIWA 3OOSA 2I80A 5IMBA 3L43A 3ER6A 4HFRA 3G8YA 4LXIA 5DV9A 4D5GA 1O6GA 3ZRWA 1CK2A 1I6LA 1LFAA 3FKSA 4XR9A 2YXEA 3PC7A 4J4HA 4AB1A 4HXFB 3OTIA 2WKQA 2V6JA 2LCAA 3PUWA 2BMFA 1DF5A 3FJYA 2CNDA 3I5MA 2R8EA 3HPRA 4TSFA 5HS6A 4MR7B 1IN8A 4KUEA 5LXTB 4P1ZA 1M8KA 1NBMD 1SUPA 4LWQA 2HQ1A 2FKXA 2ERYA 1UBTS 4TSKA 4O2AB 3M5WA 1QYRA 3AR8A 3B9BA 2WG1A 1WHTB 3ULKA 2PKXA 3PYLA 4TUYA 3KQYA 1V41E 4KE6A 3UWDA 2B4KA 1RMQA 3LCCA 1KFBB 3M7IA 1V25A 3H2SA 3BAAA 3FF4A 1W40A 3ZKWA 4LCUC 4ND1A 4KQGA 4TVBA 3ZI0A 1YASA 1B2LA 4OXRA 2Y9PB 4ZRMA 1J90A 4P3OA 3ZDQA 4PEVA 4MJ3A 3T3HA 3FKQA 4YMTA 4D9HA 4R05A 1NTKH 4AVYA 2JGAA 2QUHA 5BOSA 3DMGA 4DXAA 2WMYA 2PGOA 3DS8A 3F1KA 1JKJB 3I6ZA 3IC7A 1YDHA 5LU9A 3NX4A 3UKOA 3GU3A 2G5GX 4V0SA 5EKDA 3ZY6A 2RDMA 1VPLA 4Q00A 3UCSC 5LNK6 5T5QA 4BKQA 3EVFA 3IR7A 5L6LB 1TTTA 3OHSX 4LR3A 1YVRA 2WK1A 4B45A 3IX7A 3QQPA 2CCGA 4H3VA 3THYB 1TC1A 3CCUV 3OONA 4IDAA 1KPHA 3HEAA 1LTHR 2GM3A 3EARA 4DV7B 2GYUA 4PIMA 5CD1A 1D3AA 1QVGF 5LJLA 1IHYA 2XYRA 5GZ6A 4BU0A 2RC5A 2OCLA 1FYDA 1GVNB 1GLNA 3UJ6A 3KZCA 4JV5O 2C5FA 2P2SA 3OFVA 2WA1A 3OU2A 3N75A 4H1HA 3I05A 4YRIA 5AUOB 2JIBA 1I4TD 2PN1A 4V1CA 2QR4A 4DBVO 1BGYH 1RHQA 5JFGA 3EVNA 3ID6C 3VKHA 3I2KA 1TYAE 1BHSA 4G0XA 5B3JC 4I6JA 4DV2B 2ZXFA 5ERGB 5JAPA 2ZVPX 5K3FB 2CXQA 2J85A 1D1QA 4NBRA 1B0UA 2HA6A 3T5BA 4QASA 3QBJA 1MEJA 3AXSA 4G8BA 5K7SA 1JFFB 2XAAA 4XPIB 3TIXB 2ALJA 3OZSA 1W87A 3CVVA 1CIPA 3AGPA 3A3YA 1MNQA 2FOXA 2JNBA 3QFTA 2KQXA 1BAPA 1XPOA 1P4SA 4B09A 1JXOA 3IOBA 3COPA 3JQ7A 4J80A 2Q5CA 2QM4A 4YMSA 3CURA 1A32A 2W2QA 4PW0A 4EW2A 4HVLA 4GOND 3MMPA 1O97C 4OK6A 3ZK7A 3WQSB 5K6TA 2X15A 1H2AS 5DECA 2QROA 1SIWA 3QTYA 1E3MA 2CTWA 2EINB 4DILA 2QRNA 5B1IA 4EY3A 4DTCA 4F91B 3JQBC 3LWVC 1E4YA 5AFSA 4W5JA 2QTFA 5B1AB 4F1KA 2CVQA 5IP5A 4MIOA 3AEUA 3VTKA 2VA8A 1R2QA 4QOHA 2J3JA 5DHRA 1SG0A 1GUYA 4N5HX 2VIIA 3VSBA 2AHRA 2VJLA 4M54A 4Q3LA 2FSIA 4O29A 5EIEA 4Q1CA 3N2KB 1ZK4A 1XNQB 3OFNG 2SICE 1E69A 1JHOA 4GF5A 4KYUA 3AF4A 3E89A 4QWMA 4C4PA 4MW4A 3C6ZA 3E0XA 3QJ5A 4PSDA 1XQXA 4LK3A 2F9MA 3AF1A 2Z8XA 1URFA 3ZWKA 1WUTA 4HAOA 4TXNA 3FB8C 2CMGA 1H5NA 1JG6A 2YWJA 5BW4A 1FP4A 1ZLZA 3OC0A 4X1IB 3WRXC 3C24A 2HBRA 4V02A 5BSKA 3ILHA 5BYAA 4DIFA 1TU3A 5HWSA 2J87A 2EWVA 2JZNA 5BVGB 1R1BA 4I4TA 4E15A 3MYRA 4RY0A 2A30A 9ATCA 2Z9BA 3AG4B 3D9QX 4NFYA 3WGKA 4PFQA 2HJGA 3BDAA 3BWBA 4HNHA 3TCKA 5K0TA 4KQEA 3LTNC 2VAWA 1RHMA 4K6HA 2QNIA 2ZYUX 4AZ3B 5AVSA 1UFVA 2JFZA 2PQ2A 2LCQA 1TPYA 1DKRA 1PLKA 1SBHA 2H54A 1Y9JA 2ZT6A 4IZOA 3KJQA 3GRRA 2W8BA 5JYDA 3OURA 1LBSA 2C2MA 5ITSA 1WSWA 3VHLB 4XFKA 1DGQA 2IOQA 2PKEA 2JHAA 4UXHA 1NASA 1ZOIA 3CMAF 4LHYA 4UPEA 1BH6A 1PFWA 4KKVA 3W9BA 5LZ4A 2XYHA 2EIJC 1GQRA 5FBZA 4HAZA 1Z5WA 3VM6A 2WLSA 1GNPA 1ODJA 2ZPTX 1AMOA 3EJWA 4R9SA 5K20A 3D0OA 2OIEA 2JLZA 1XF1A 1VLVA 4UMVA 2OR3A 5KJCA 1W88B 1MO6A 5E3IA 4KNVA 1LPBB 1LY1A 4RPHA 3MS2A 1K0FA 3GGPA 4RCZA 4PG5A 4KXLA 5AOAA 4BQEA 4V0NA 5JC8A 2EIMC 1B8PA 4H33A 2Q07A 3NMUC 3IESA 3E2IA 4CHTA 3W05A 2CNLA 4GC5A 2RB5A 3L6RA 2YMQA 2WT9A 1EFLA 3RC1A 4WOBA 4JQSA 4YP9A 1JA1A 4WCDA 1XDGA 2CVOA 2AHYA 1NW5A 3I6YA 2BELA 4PLWA 4QM7A 4EAQA 4L4XA 4RADA 1DV1A 1FYVA 4ZAVA 4KI7A 3LDFA 1RRGA 4TYWA 5KTTA 3VKUA 1WMAA 3LY8A 2A79B 2QJRA 1GUZA 5HIMA 2WIBA 2FI1A 3FFBA 2LBPA 2NV6A 3CCEF 3E5HA 4J7JA 1JWBB 2EFYA 1AF4A 4WFGA 3MK31 1T6XA 1E9BA 1KZYC 1IIBA 3MWGA 1QDUA 1PK7A 5CFRA 3K3WA 1YJ9V 4PM4A 3V8QA 3RVPA 5K03A 3R3WA 4AJ4A 5E7IA 3OR6C 1JRLA 3RFUA 4X3MA 2OORA 1KO1A 3HA3A 4DG9A 2J5BA 3O74A 1YJNV 2RHJA 3T9CA 3EF0A 2OVBA 2DEUA 2J7PD 4OA5A 3TINA 2R6ZA 3U7FB 3KTAA 4ZMRA 2Q7EA 3WK6A 2FUG1 1IBMB 2IJIA 4BFLA 1QO7A 1WQ4A 3SSNA 3MCUA 2C4WA 2D54A 2CMDA 3S2IA 9LDBA 3ENWA 4PLTA 4KIWA 4FQ5A 1ODEA 4IP0A 1V1JA 2GEVA 3OQJA 3PV0A 4EMBA 4UV9A 1ORTA 5IBQA 2CEAA 3IE2A 5IXSA 2IITA 1M90H 2FE1A 3NIFB 1PNTA 2FPXA 1D4FA 2VDRB 3HA7A 3PU6A 2ZYRA 4KV9A 4BVHA 3VAAA 2LCFA 3GTZA 3IKTA 5HDBB 4O33A 4B9EA 3ENVA 4IOKA 5A5VA 4TMVA 1PUIA 1I2ZA 2VQFO 4HKTA 3PQEA 4Q24A 4G1EB 4JVOA 1JF8A 3EIUA 5IVPA 5FO0A 3HU3A 2G9ZA 2OXEA 2P1ZA 2ZE6A 3I3SR 2QEXF 3GLHB 1EN5A 3AG1C 2Q5HA 1IWOA 4Z7NB 1JE1A 3H5VA 4UUMA 1BFKA 5EWLB 2ZVYA 2H08A 1ISSA 2GR9A 3O8LA 4CM4A 5IEJA 1UIRA 4R84A 1EBOA 3BJMA 2J5KA 1Y63A 2CF6A 1PVVA 3O47A 4LA4A 3KQUA 3SHFA 3RS8A 2C9CA 4DREA 3NK6A 4V2IA 3TDKA 4GE3A 2LJ2A 2XVYA 3VUFA 3UWSA 1ZH8A 3FTPA 2QPAA 3PFIA 2RE8A 3KG2A 1BX0A 3Q9LA 3FNBA 2ZUBA 4UULA 4KN8A 5ER6A 5HP7A 3I28A 1XZ8A 4LXQA 2EFDB 4EI8A 1Z0IA 1SKVA 4Q3OA 5CNJA 1RC1A 2DKNA 1A27A 4CCWA 1N5RA 2WF6A 2JGLA 2PRIA 5F9MA 3QF4A 1I5XA 4JJEA 3GJ4A 5BQPA 5AP9A 4MMYB 3T1VA 2WU3A 4ZALA 1GUAA 2V7TA 5FI3A 5CW2A 1P1KA 4RETA 1Z82A 3X1XA 3UMCA 1TCCA 1VL8A 3ZPXA 3ECAA 4IJ6A 1FMJA 1IXRC 1RC0A 2F1MA 4CT4B 4YJGB 2IZZA 3SBEA 4LXYA 1JN1A 4F85A 1BRMA 2A8YA 3VOSA 2CVZA 2VJNA 4ZBMA 3GAMA 2QD1A 4INZA 1E59A 2B25A 4B6PA 3VDNB 1BS2A 3IUQA 2XNDA 1N9KA 5CVVA 2YCLA 1ZOSA 3VSAA 2YASA 3DJFA 4DRXA 2OY0A 3W9YA 3UPDA 1PW7A 3LC7O 4GWLA 3A27A 2AF3C 4Q37A 3SZGA 4OMUA 1A2KC 1XK6A 4UQPA 1HDYA 3TCNA 1IEQA 3MS4A 1VMAA 3N58A 3GMIA 5C4IA 4QJFB 5JDIC 3JQGB 3L4JA 3NC0C 2VHJA 5IBCA 1S77D 1HLGA 4XDJA 1D8TA 1VKJA 4PQYA 4YUXA 4PGAA 2Q1XA 2WWIA 3ND8A 5EBWC 4GMDA 4P7BA 1AGPA 4JY7A 1E8MA 3E4CA 4JHLA 4RSHA 2H6LA 3WWOA 5JH7B 3BH7A 4I8XA 1JNYA 5SZJA 4WBNF 4ARVA 3AEIA 1YQUA 4QVIA 1QYCA 5E4YA 3C3CA 5LA6F 4NXMB 4BZZA 2EP7A 1FMFA 4HNVA 1LGYA 4W7IA 3PDUA 2QU8A 4AURA 5BRNA 5CH3A 3U09A 1SD1A 3EQ8A 3HSSA 2QBYA 5EFZA 2GTPA 3L0IB 1YITF 1YE5A 3QOFA 1SXJE 4OI2A 1JDBB 4XLTA 4LZLA 2XVZA 1DP4A 1K8XB 1VKRA 3G79A 3MWDA 4V24A 3R40A 2JC3A 1GKUB 5FBVB 1VL6A 1Z6XA 5FOUA 3E6AA 1RPNA 1NZDA 2WKRA 1EZZA 3DB2A 3ENZA 4CV1A 1B43A 5G41A 1JYEA 3S5JA 3QEKA 1J1IA 2XI4A 3JTEA 4JL6A 4N3GA 3PEWA 2V7QD 1WCV1 4A8HA 3HP4A 4J1TA 4JXXA 2BEWA 1D6NA 1R6BX 4YT5A 1FXKB 3U4AA 2P2DA 1XXHB 3WGTA 1ORRA 4A27A 3EXHC 1HT2E 3GLQA 4FINA 5BYKA 1VB3A 3NJ8A 2A14A 2C7BA 1Z0UA 3BXFA 1U65A 3UWKA 1JIUA 3GA5A 4A5SA 4REMA 3BXZA 2BGTA 2C95A 1GZ7A 3SPCA 1QLEC 3IYLW 1C8KA 1Q90D 2FR8C 2GV9A 4P3YA 4H6PA 2FTKA 3QP9A 5G0SA 3FHTA 1YACA 2JH9A 2I8AA 4D46A 1KKDA 1DIRA 1Y3AA 3VPDA 3GNTA 3WBKA 5F7JA 1HQKA 2HCFA 2ZIZA 1G2IA 1WSAA 2J3KA 3C48A 2H85A 4C1NA 4MV9A 3OAAD 1QK3A 4B48A 2XCLA 2BFCA 4WASA 2G06A 4FC6A 5A2QN 4KXMA 3ZDEA 3I55V 1W5FA 4G23A 4YY3O 2UZ1B 3K92A 1AXRA 1Z6YA 3MWEA 4DZRA 1WPQA 4UTZA 4LE2A 4CLRB 1NDUA 1L1RA 3BWVA 1L5NA 2ZSHA 3PGLA 1YFZA 1RIIA 5F5XA 3WK5A 1AX9A 2VS0A 2OFFA 1ZU4A 3ABKC 1I8TA 3D4NA 4QODA 4YYZA 2VPZA 1J1UA 3K08A 3HQ4O 5JTUA 3OQBA 3A3OA 4RJLA 4MYSA 1L5VA 3FPIA 5F4ZA 1N0VC 1ZNZA 3CR7A 1X94A 1GPAA 1K63A 4AKEA 4DZZA 4FLVA 1NVTA 2HFJA 3AF3A 3QE9Y 4XSGA 3BIFA 3WYCA 2ZKIA 3M6UA 3SHOA 2D59A 4OJKA 1B74A 2VZ0A 3OF2A 2XXBA 4IJMA 3VO1A 4KAJA 1E64A 4JI3B 1PFYA 2JFHA 3BJZA 5G1NA 4KUGA 1F8XA 4A15A 5NLLA 3C14C 4JUFA 5BSRA 3OG9A 1U8TA 2PAFA 4LC9A 1U90A 3FYUC 3ICCA 2D5LA 3RREA 3PRHA 3U26A 3RO7A 1Z5GA 1LH0A 2W6IA 4B6GA 5HJ7A 2WHQA 5J2UF 3L0ZA 1CZRA 6REQA 1E2PA 1IATA 1E2DA 3PT9A 1ZMTA 3OMAB 2O0HA 3RVLA 5GADl 3PWZA 1P1BA 1ZK0A 3DLAA 4N39A 3H5NA 1ONNA 1SBYA 2VJMA 5EZYA 5E8JA 1K92A 4QREA 1GITA 2RGUA 5KQGA 1KI9A 5MN4A 4MDYA 4PHTA 4AG6A 4ZHQF 3HCDA 1DPGA 7REQB 3TD4A 5HM8A 2RK6A 3KJXA 4RTNA 4BECA 4QVKA 3AQ4A 1A7AA 1C1DB 3Q6NA 1K08A 4RGVA 2P5UA 4Q05A 1OLUA 3AVOA 2GAJA 2X23A 4Y0AA 4BWVA 2R47A 1Z0DA 4BZWA 4RZIA 2WVAA 3MD0A 4WCFB 4B46A 2V1UA 4TLEA 4EJ2A 2INGX 4BQNA 1NT2A 3AEKA 2QMUA 1FXHA 4MICA 2EKZA 1U7DA 1P2GA 1NC1A 3UG6A 1FQKA 1GGFA 3P9YA 4KPEC 4L2IB 1YDEA 1CZLA 1L2TA 3LM8A 5LP6B 2VYVA 1R6DA 4NU5A 3INNA 5CFPA 4PWYA 4MWEA 3AVQA 4HZUA 2IEBA 3FBWA 3MMXA 4PQEA 1YTFD 3HJCA 3EGOA 4MS1B 3CTMA 1KEVA 4KACA 3THOA 1L7QA 3RVJA 1UFIA 4HQRA 2H5IA 3N9IA 3K53A 2OECA 5BRAA 1CV2A 1J5EO 2FPGB 2SCUA 2IBZH 3AESA 3QNMA 1HA3A 3QUAA 1Z06A 4WXMA 3H2JA 1MU0A 5A5EA 3VTIC 3ZVMA 4Y6LA 2AD1A 1FUYB 4N0QA 1XZGA 2VQEB 3U0VA 4R68A 4JQYA 4HYEA 3IKLA 3WGZA 4BBJA 4HUTA 4P81A 3RG2A 2PT5A 3N74A 2P69A 4MKHA 1QORA 4LF5B 1SUWA 1KK3A 3O93A 4MCAA 1UAAA 3IB6A 1H9CA 4DR1O 2IL1A 3LAWA 1G8KA 1P2BA 4CYMA 1EFPB 3SYNA 5ESXA 3F7TA 2GPAA 4I55F 2X58A 1M2HA 4O1IA 4Y30A 3OE1A 1LBIA 2C9BA 3NJRA 4F38A 5F76A 3AEYA 1HTTA 2WNHA 2I2CA 3PL5A 1XMJA 1SF9A 1MW8X 4CN9A 4KU4A 5IJ0B 1RPAA 4F6EA 3M0EA 2YZKA 1H48A 1SUCA 1EA5A 4XFDA 4L8WB 3SLKA 1TIBA 4MTCA 3CX8A 1BMDA 2D6FA 4L85A 4YRNA 4DR3B 1R7RA 3S29A 2RD2A 4X64O 3QUBA 1SQSA 3O03A 4P4SB 3ADPA 2OO5C 2NU7B 4WBXC 2ZAOA 4C07A 3RCBA 5BP7A 5IJWA 4MQMA 2BUBA 3DDWA 3LX8A 2PL9A 1EFRG 1WXWA 3H04A 2HO4A 1J24A 4I9GA 1BIFA 1GPWB 4MVUA 3AETB 1U8XX 3B1ZA 2X0DA 1TAUA 4V0QA 3JALA 1KZ1A 5JS7A 1L0BA 2DKOA 4OQLA 2FWNA 1GZ4A 4DMLA 4JYYA 2L42A 4KXXA 3M84A 3VCZA 2DWPA 3STUA 1YZYA 3KJJA 4ZU3A 3E58A 3SKVA 3IAS1 1YC5A 2JJMA 4IRUB 2LE0A 1LNQA 4OY3A 1VB5A 3S7TA 3PJRA 4X65B 1LEHA 1Y1RA 4MR9B 5EUQB 2VRCD 4ZAGA 2ATCA 3HM9A 2J9YB 1JGTA 3VYUC 2QV7A 5DTEA 5A4AA 1U8YA 1ACJA 4LOKA 3WGHA 1RZRD 4PC3A 2OOSA 1GZ6A 4LPKA 4AUNA 3T3IA 1EVIA 4UVIA 2PUFA 4L15A 4XM0A 3MTGA 5GIPC 2FP4B 4NQZA 1E2NA 2OCXA 1QBKC 3NVMB 5CT9A 4F2HA 3C8MA 4WZAA 2Y3IA 3CRAA 1V3TA 3WJ7A 1AJEA 1Q92A 1I2AA 4KBYA 2RH5A 1O7JA 3S2ZA 3AK1A 1V1RB 1JQ0A 2QJTA 3N8KA 3ZV3A 4ZT2A 3HS3A 5M04A 4P33A 3GJYA 1FNMA 1EVZA 4XIIA 4LUCA 4BAGA 3ACBA 3VR6H 4JLOA 1VQKF 4KGZA 1Y3IA 2R00A 2ZUVA 4PCAA 1DKMA 1RR6A 2WFAA 3K9BA 1ZUIA 4RABA 1EJ6A 2C2XA 1X7WA 2EZ4A 4BNDB 3A11A 3AM5A 3EC7A 4NE7A 4ECEA 4UCQA 4HWPA 5A3VA 2QWPB 2F3QA 5JSKA 3M89A 5JO0A 2MIIA 1U0JA 2PWBA 4V1CI 2H1CA 2PMKA 3V4VB 4CMKA 3OOHA 2EIKB 4Z9XA 1PNQA 3FPKA 4LISA 4DV6B 1N6NA 5BN1A 1EXMA 3HEBA 1WCYA 4UAUA 2GJ9A 3MRXA 5ICFA 3R4VA 4F4JA 1VIMA 1P6UA 3B6NA 4REOA 4KYIB 1DINA 1TQ6A 1SGWA 2B33A 1O96A 4B3GA 5ICGA 5IBRA 4LF9B 2GN0A 1JFSA 1J2UA 3TNJA 1O5OA 1LVHA 1E3WA 1X8XA 3GIDA 5CEEA 4RS3A 4PA3A 3OM9A 5DWQA 3UC5A 1YI2V 3P8ZA 4P4TA 4RLQA 4MRMB 2CXOA 1AQNA 1E6CA 3FJ1A 1K4CC 1T29A 4NYJQ 4AL4A 3D3EA 4KSCA 3C97A 3DMYA 6CHYA 5JYBA 1ICIA 2Z2IA 2HP0A 2Z01A 4NESA 2EFEB 3NTVA 1PU2A 4NYIR 2YZ7A 1IHPA 4URWR 2XUQA 3CF6R 4JASA 5KNDH 4DNQA 1P44A 1DAOA 1E2GA 2QR3A 3NBAA 4ED9A 1G21A 1KVSA 1JIIA 4IG4A 4UVGA 2KQUA 1NZ6A 4L4ZA 2YFKA 1Z29A 4ZT4A 4AJIA 1WXEA 4I5DA 3OIVA 2Y93A 1SC6A 1TVKA 2CJWA 1VL5A 3LRXA 2F66C 4G24A 2G5CA 4ZQBA 2DMXA 4UCUA 1AS3A 1HEUA 5LN1A 3ANMA 3NMUF 1WXGA 1E2IA 4QXMA 1NDHA 1X74A 4INPA 1VZ3A 1G5QA 1XEFA 1MRNA 1P60A 3PNYA 3R66A 4TSRA 3C70A 3HR8A 1NLUA 5LGUA 1OWNA 2A5GA 4HRVA 3WC4A 2W83A 1CS0A 3WAKA 4KN5A 4MWOA 2KM1A 2QMHA 2H92A 1U9YA 3ODGA 3HMQA 3C6BA 2V7UA 1WF6A 4BVBA 3LUPA 2X6QA 4TTTS 4NWIA 1KMMA 2Q9LA 4KI0A 5CT6A 2Y27A 2ZB3A 3OZ7A 1W46A 2L35A 1PUJA 3H86A 4ZGGA 2OV6A 2BF4A 1MQ9A 1QU2A 4J75A 4P2GA 4JLMA 2C7VA 1QP0A 3NTXA 4FFSA 4PLHA 2PMWB 1L4UA 3CNLA 4YJFB 1THTA 2GUZA 1T3SA 1HP8A 1PF5A 4P3NA 5H9WA 1PZFA 1PFGA 1Y5IA 2CY0A 3PX2A 2PGXA 1WU7A 5IT9A 2ZCUA 3FSGA 3EZLA 2CHTA 3OTOO 3VOUA 4Y9DA 8ABPA 2GVDC 2QVYX 5DTQA 1VG1A 2NUPB 1VZ2A 2PH5A 1VF6A 3ZIAD 3FHLA 3LXMA 5LQDA 5CEJA 1KPIA 4DAOA 2JI4A 2A5FA 1L8LA 4XLZA 4UJ5A 4HQNA 1Y34E 3DHEA 5IPFA 2GCIA 4LEIA 5EHNA 5C5CA 2FSHA 3FD9A 4EENA 2CH7B 5BURA 3CPHA 4EUEA 4CIVA 4OHBA 4CUZA 1N34O 2OFWA 3CWZA 1OFVA 3BJEA 3DE2X 1WKBA 1QIMA 2YS6A 5DISB 3AIOA 2AB0A 1S0UA 2CWJA 2YJ3A 1C0IA 1V96A 3R7DA 3W77A 2ODEA 2ZCVA 5IABA 4X62O 3NV9A 3PPYA 1KU9A 1YDGA 2HK9A 3BMNB 1HUQA 1KYZA 1K6JA 3W4IA 3R9WA 1TO6A 2Z95A 5LZ9A 3B13B 5JSQA 3DCIA 4LDZA 2WSSG 3VJRA 1YS9A 1BGXT 5HZKA 3P0RA 1Z37A 5TQVA 1LJ8A 3WAJA 3K9GA 4IFEA 1M2WA 2J9FB 3DQQA 4PLZA 4O4IB 3D6AA 3JRXA 2X5OA 2GO7A 4DMUB 4RO2A 3IE0A 1N5KA 4HK4A 4LNHA 2FNAA 1CXZA 4RY8A 5LOVB 4GZRB 4NU8X 2HRUA 5C8YA 3CCLV 2QMQA 3IIMA 4U8HA 3F8TA 4H3HB 3M1YA 4LJ6A 4IILA 4Z4EA 1JHXA 2PWYA 4CKCB 1Y1LA 4G3XA 3H6GA 1VQPV 1THMA 2N46A 2GTHA 4WXHA 1NVPD 3IVXA 3ZRXA 4YXWD 1PSZA 3SYMA 4MGZR 2IPNA 1JHZA 1V6AA 3QNUA 3SSAA 1O97D 4R40B 2CLFB 4TZTA 2FPKA 1NVWQ 2Z9CA 4XWAA 1JPUA 2KG4A 1TM2A 4C6SA 2ONKA 3UK2A 5FOSA 4I81A 4LXTA 3G4SF 2KLHA 4YR9A 4QE9A 3VI3B 2WLKA 1M90W 5BUZA 4BFZA 3ZCUA 1XWWA 1GRCA 2GTSA 1QGYA 1BKSB 4Z3DA 3PJSK 2GD6A 3OPVA 3X0DA 2JJ2G 2C2WA 4EB6A 2YR0A 8LDHA 2W6QA 3DJYA 1P1HA 3NW9A 2RKBA 1NMZA 3G9XA 4OGQB 1Y80A 4BPRA 2XX3A 4WN9B 1ARZA 2XVAA 4LBEC 4DSOA 3GELA 2X42A 1XTTA 5F1OA 3D6FA 2YXLA 3HB7A 3K8ZA 3C9SA 5KSOA 3UK7A 3UXMA 4PNEA 1C80A 3O8QB 3VVMA 3CCCA 1TMGE 4Z0NA 3PGXA 4E2LA 5AK0A 1W4RA 2E4UA 5AVOA 1QD9A 5B1NA 1AG9A 3DV0B 1E9SA 1G8AA 5IVDA 1TZ2A 1YVUA 2JCXA 2KTVA 3WFIA 2QN1A 4BVGA 5H4GA 2O3TA 4KFRA 3TSZA 3FB4A 1UWKA 1ZI8A 2QZZA 5KAIZ 1A4UA 3BHJA 4E5VA 1XRRA 5EPEA 3SIVA 4ALIA 4G86A 1NF9A 3I04M 4X1OA 4RENA 1JN0A 3B3QA 3PHLA 3DVRX 3VISA 2OFPA 5AM0A 3AR5A 1J8VA 2AOUA 1NKVA 4FW8A 3SE7A 3NHPA 1Q19A 2RARA 1EVJA 4K9LA 2XBUA 3B78A 3DVQX 4UXIA 1KKCA 1ZNQO 2CYBA 2C7OA 3ORHA 3HDGA 4Z3OA 1W0KA 2ANCA 3LKZA 1WCIB 5JT1A 2E3CA 4DBLC 4TZZA 4NABA 3A9SA 1W3EX 2WPNA 5KZMB 2OO7A 5AI8A 4PYJA 4ENPA 4OB8A 3AG3B 4UD6A 2KS6A 3HYRA 3IL2A 4BWYA 1BW9A 3GZNB 1MKYA 4HYTA 3TR5A 4HCJA 1DCMA 3K2XA 4U9UA 3V7WA 5AJZA 2CE7A 3TBFA 2BGGA 3IEWA 2QNRA 1NXWA 4Q4HA 3Q4HB 2R7LA 3A1TA 3SIXA 1B0AA 5SZKB 3SD7A 1CJUC 3QRWA 3U39A 5I8PA 3JW8A 4N47A 4O4LB 3BPZA 3FYCA 3QJGA 2RN9A 3CXRA 1NKSA 2XEDA 2ZTLA 1WDLA 1TU4A 4AMYA 5JTTA 4YRGA 1JIXA 1SHJA 3N0RA 1IPAA 1IXKA 3OE7D 3EXFA 5A05A 1B26A 3K06A 3K1AA 1S7GA 4ZTZB 4MB0A 4MUIA 4YRDA 4IH1A 4PYMA 5EQJB 5WRFA 1EBFA 3T61A 3DO8A 4ESEA 5DLYA 1GNTA 1LSUA 1DKPA 1EAMA 2W37A 5SICE 4HQKA 2BF7A 2NQ2C 2QP3A 1SY7A 3R3ZA 1LRJA 2NZVG 3D02A 3T38A 2W8ZA 3O0DA 2X5XA 1F5NA 2WAMA 1GXSB 2LFRA 4MUBA 4MULA 1H0KA 2EBOA 4YLYA 2BFDB 2GERA 1ECGA 4YP6A 4IIFA 3B7PA 1QLWA 4Q9NA 3M6MD 4EB3A 2F2TA 2NPIA 4GPIB 3L0DA 2HUNA 4D8VA 3U48A 2A78A 1ULZA 1EN4A 4RGYA 3OCZA 2LD4A 3KPWA 2B4AA 4AJNA 5AOVA 2Q6VA 1XREA 1U3LA 1OLSA 3UAYA 3OTFA 3RJTA 3KHNA 1PJBA 2QN7A 4C0QC 5HXZA 2VP0A 4IF6A 1ULSA 4OUKX 2FZCA 2AUNA 3RK0A 3ZGXA 2AI1A 1JILA 4I5GA 3CYFA 4BO3A 1YZFA 1TYEB 1VQMF 5B1BB 4Q7LA 2M6SA 4EF4A 3VR4A 1SRQA 2D1SA 1U8CB 3K09C 4NR1A 2O3QA 2XNSA 4U7NA 4PHHA 3AI2A 2Q4OA 3PC2A 4K81B 2PPVA 3GJRA 1YB2A 4OF4A 3O4JA 3P2YA 4XVQA 3O8OA 1YRQA 3AR4A 1GN4A 2VDKB 4EJ6A 2E37A 2NZWA 3CF4A 3IQIX 1JSLA 2C5SA 3GLRA 1S7CA 1LLQA 3JASB 4LMBA 3MRSA 1FTSA 4JROA 4EUNA 2BR4A 1HETA 1VL2A 1A7UA 3GROA 3LYUA 4X20B 3ETGA 5K8JB 3ZWNA 3KPJA 4XM2A 4MGHA 5EFOA 2AJCA 3GBVA 3O1HB 3CVOA 1D7OA 3B40A 2I3DA 3DV9A 2ZDIA 4CM1A 1J0BA 2Q46A 1E6KA 2EJRA 4ZI7A 2C8LA 3K16A 4DJFC 1B93A 4GW3A 1VQ9F 4FM0A 2O8CB 2QKCA 1TZMA 3A6DA 3FDXA 3VR2D 1RWXA 2JRLA 1YIJV 4GZLA 3ESCA 1RRKA 1AURA 1ZJJA 3CC2V 2ORYA 3ZMSA 4X7MA 3I56V 3DDNA 1FYWA 3G7UA 3WX0A 1WV0A 4IJKA 4FNMA 3A31A 3K5NA 4U7FA 3TOVA 3MWFA 1DCFA 3A26A 1RI4A 4A0QA 3OI7A 1TW3A 1KJYA 3UMYA 1FDOA 3D7KA 4LHEA 3EIEA 1BHO1 2DFPA 2NYVA 4D82A 1RLUA 2QGZA 2EIXA 4G37A 4R1MA 3QVSA 2HMTA 4J7UA 4GIBA 4LXGA 1LC3A 1F23A 1FNNA 2OMKA 2IP4A 3TMYA 5HUQA 1WW3A 3CNNA 3RRXA 5GOTA 3SOZA 3CS3A 3B89A 1AQUA 5FPOA 1M2OA 4IDPA 1ZRHA 5EUCA 2ZIWB 3IP9A 4A3SA 4OQ4A 4JL8A 3G23A 1DAMA 3G82C 2B5VA 1P72A 1TLTA 3KP1A 3MMNA 3KVOA 1M1XB 1H6CA 3O91A 5IAAA 2TMDA 2LWIA 3ZN0A 5FBLB 1ISJA 5KWJA 2HIMA 5HX7A 1TGYA 5C5IA 5ALNA 4D3XA 1BE1A 3KHTA 3H5WA 1NTZH 3VVCA 2MSCB 2PBZA 2WBLC 3P10A 1W1IA 2YVLA 3G1TA 2GK7A 3D2AA 4WZAE 3CD6F 3HBJA 4EJSA 1AQ6A 3L6UA 2GWRA 1ECFA 1Q3HA 2NO7A 2I3ZA 3ITDA 3CTPA 2QRLA 4I2VA 3G6BA 2HWUA 4QKQA 4BKMA 1W25A 2ZBDA 2I34A 1GFWA 2GEBA 1H1LA 4JUCA 2VYCA 2RJ3A 2OHXA 4KLZA 5FBHA 1YR2A 1M72A 4WX2B 3OKAA 3PJDA 1YC2A 2D0IA 4LECA 2MINB 2FOLA 4UNNA 2PK3A 2EULA 3WTCA 4RKQA 1CUDA 1U5BB 4DIKA 5IYZA 1DX9A 4HEA1 3OZWA 1R66A 3SEZA 4DDTA 2VHVA 3P9QA 1Z6PA 5KHAA 2XWBF 3DYBA 5F9FA 5LYYA 3GLIA 3WS7A 2EYUA 2FFBA 5J58A 1NF8A 4AY5A 1MO3A 4M6WA 4EECA 1W4BA 1OHHG 4XQ0A 4BP9A 4I36A 4DV0B 1ATZA 1QHFA 3GDFA 3PZBA 4ND5A 1PP4A 2AXPA 3T52A 2O3SA 5IF9A 2QTWB 4Q3DA 1OBFO 2H1IA 1HOTA 5AXBA 3T1YO 1GG2A 3BXHA 4O6VA 4CQLB 3KVVA 4F93B 2KB1A 2ZUCA 3V4PB 2QQGA 2P2LA 5E38A 1N8SA 2C8KA 3T1HB 1CUSA 3X2SA 3ZP7A 1U2GC 2QVXX 5BY2A 1E7MA 1M2GA 4TKVB 2BSAA 4MVSA 2CLDX 1I7DA 3P9ZA 2PR7A 5AH0A 2V9PA 5CNKA 5D87A 5EJIA 1FY2A 4Y2YA 1W52X 4O4HA 3KLOA 2WLLB 4Y6RA 5DHTA 1U2DA 4DADA 2NP7A 1I08A 3AI1A 2X6AA 2CHEA 3ITEA 1BQEA 3QM1A 2B94A 5EVJA 1RM0A 4IXDA 2Q69A 1ML4A 5BVHA 1I10A 2A4MA 1Y0BA 1OX6A 4BVTA 1TCUA 3IP5A 3TEJA 3E48A 4OXKA 3UQYS 4JB0A 4BQPA 4AQDA 1DAPA 4I9WA 3ED1A 1UXJA 3EEIA 2CVPA 1XNJA 3STLC 2QM8A 2RJNA 3H8SA 4F86A 2XPCA 1JPJA 2GF0A 5C8VA 1NZJA 4G1FA 1Z4MA 5FTNA 4Y2UA 1CJBA 2GYVA 3A4MA 1P9OA 3H7IA 3CG6A 2A94A 3A3PA 4BYMA 2QXUA 5L53A 2H94A 2HQSC 4JJAA 4ZEOA 1ZISA 3H1FA 2GOYA 5ER9A 2QEQA 4RDXA 4D9JA 3T8YA 3C6YA 1HOXA 1EBUA 4PINA 2ROQA 2B8TA 1T6NA 3OFKA 1Z17A 4BGVA 1ZDMA 1NMUB 2G1AA 4KRGA 4MPRA 4CMIA 1C3VA 3O2NA 4YUZA 5GMOA 2WMDA 3S40A 1LSJA 2YX1A 3NHWA 1Y1SA 1KAEA 3HEMA 3E03A 4FFBA 4AFNA 1DWOA 4OFBA 4R2WA 1YKGA 3SKYA 2CC2A 5DI3A 4AO7A 2O2IA 4QT4A 2CT8A 2ZR7A 3SPJA 4YRQA 1ISHA 3ZP4A 2IS2A 3WG7B 2VZ8A 1IV2A 4ZGBA 2V9YA 1T4GA 1V7PC 2Z8YA 3WP1B 4B6OA 4ZO6A 4CEHA 3DPSA 2PI4A 4JD5A 2XKJE 2UUBB 1VKNA 4JI0B 3QVGA 2HWKA 3GEBA 5HJ5A 2O3JA 5LP1A 4LSZA 5A3SA 2WTXA 4HN4B 3OZRA 1ZD4A 3P19A 1D03A 4G84A 1SUBA 1H8HD 4NQRA 2QLMA 1A9YA 4O2LA 4ARBA 3QMPA 1FU8A 1QE0A 4Q1AA 3T7TA 2O5CA 1ZOLA 2BR3A 3WICA 4LMRA 1QCDA 4LV8B 4BMVA 1E1QA 1JTVA 4CCYA 5JJIA 1JSXA 4PYQA 3DZCA 5E2AA 3TTSA 4LYDA 4BDSA 1WZIA 3GZ4A 3IAFA 2O48X 3X1YA 3Q9SA 4PA4A 1TQ4A 1PN3A 2X4IA 1G17A 3L84A 5FR2A 3OEYA 1YQXA 1GM9A 2P9QA 4YRJA 1O03A 2WILA 1XG5A 1XT6A 1Y7LA 2BGKA 4M46A 1E66A 5FL7A 5AVUA 5K6RA 3H3XA 5ECYA 4J03A 3A0RA 4RY9A 5FTMA 1GNRA 2G0TA 5E4JA 4IIJA 4G6ZA 3EVBA 3EXIA 1B8VA 1V95A 5A9RA 3PHGA 5KHKA 3HCFA 3KSDO 3LZDA 1XZFA 3T9DA 5FAXA 2YJ5A 3G6KA 1L3CA 1RYFA 1V3QE 1OQAA 1MPXA 1CY4A 2XEXA 3MSXA 3SEQA 5I7HA 8ATCA 4DT1A 3KSMA 3I9MA 4DCCA 4OQZA 4I3GA 2NAFA 1T2AA 2AN4A 1AB5A 1CUEA 3EZ7A 1G7SA 4NI5A 5K9ZA 3O8CA 3ECCA 3HB4X 1O8BA 1QKIA 2DPXA 5F23A 4ENUA 1I1OA 2Z1UA 1L4NA 4G4JA 1Y8RB 1JEEA 5CXXA 4X60A 4A2PA 4L8FA 3BA6A 5I6DA 3S2FA 2QTBA 3N76A 1IUNA 4LF7O 1ID1A 2WICA 1M2KA 2QDXA 3GJ7A 4MW7A 2R1TB 1XMXA 3AUTA 2JFPA 4AMBA 1Q6UA 1SCQA 3NC4A 3HH8A 3JQFC 4K6OA 2A0YA 2HT1A 2AIRA 5DO9A 3O8NA 2WC1A 4EQ6B 3QA3E 2YY7A 2WHYA 3AF0A 1JVNA 1RBQA 5DYWA 2HLDA 2NU8B 3WGLA 4ND4A 1XZKA 3A04A 1TCAA 2IH4A 3ZHSA 5CVJA 4CLXA 1P1IA 2I2XB 1MJ5A 1Z4PX 3V7EA 1CERA 4FR0A 1MD9A 1GT6A 4ISCA 1Z38A 1R8SA 2CK3A 2VPWA 5JLJA 2IQIA 4JP2A 1BN7A 1NP6A 5IK2D 2C7PA 3TD3A 4OHFA 4D9IA 4UBLA 4C05A 1PZHA 3SFTA 3UENA 3I1FA 5K0LA 3VZCA 1NNEA 5T6BA 1JPNA 4P34A 3AY6A 4LJKA 2Q5EA 2NU6A 5F2EA 4OGWA 2HY7A 3KRTA 1RLIA 2PSJA 2SKCA 1RAIA 1NDQA 4FUQA 3ASNB 4YJ3B 1C14A 5JJKA 3PE4A 3OQ6A 2NZYA 1OJ7A 2VNJA 3DE3X 3I2FA 2Z5GA 5J23A 4FD2A 2PYLA 5CGQB 4F4LA 1IZ9A 4UOQA 2CW5A 4B3RB 2WVGA 4BLVA 3VDRA 2W2LA 2WFMA 1C1XA 2YWHA 3HB0A 2NQTA 1WSDA 2QKAA 1M1NB 2IY8A 1LVUA 3DOHA 4K2AA 3FTQA 4TKUB 1U99A 3LZ6A 4R8VA 1QFMA 5LUAA 5HFNA 4HLUA 1FXWA 3GV0A 4E12A 1E7QA 4YBRA 1X15A 2W70A 3EBPA 5JXIA 1N0NA 1US6A 1XGKA 3IMGA 1ZIYA 1QF7A 4GOXA 1NUTA 3HR0A 1XNRB 4JT9A 1R6KA 3L4SO 2C2ZA 4W6QA 1E99A 1XDWA 3KB6A 1LBEA 3PPWA 3LUJA 2O8VA 3U3DA 1C0EA 2XADA 1EXVA 3ONEA 2NSLA 4HX5A 1T36B 1SD2A 4XYGA 1HRKA 3TX2A 1JBQA 4P2BA 4HDMB 4IRXA 4RYDA 2HN9A 3GHHA 3L1VA 2CFTA 1UPGA 5D2CA 4XUDA 2ZJBA 3TI9A 2PFGA 3H9JA 3G2PA 1U7UA 2OKCA 2AWOA 4EITA 3FX2A 5EC2C 3C98A 2RH4A 5JR3A 3UKDA 3OVMA 5HZHA 1VM6A 3I4CA 5FNVA 2FEXA 5KYXA 1SQPH 4NHEA 2D1QA 1RWBA 4X94A 1LW6E 1ND5A 4DV1B 2ATEA 4E5SA 2CKDA 2OE2A 5AM1A 5TQJA 4RX1A 1TYCA 3WYAA 5FA6A 1ECLA 3IJEB 1N32B 3EX7C 1ZL8A 1FRVA 5F2VO 3OQMA 1O0SA 4LYFA 1KL7A 2VK8A 2KMLA 4N12A 4MR8A 3PHIA 1MO4A 5KCMA 3OJLA 5EPOA 1VMEA 5I7EA 1C7ZA 4DA4A 1HT0A 1JVMA 4EAAA 3F1LA 1B00A 4DV5B 2ARHA 4FC7A 4M8SA 1WPBA 4DARA 1KNQA 3CBGA 2Y76A 3PGVA 2GXUA 4RE5A 1JEOA 2ZWOA 4FGUA 5JY6A 2QUZA 4M9SA 3UH0A 4ZCQA 4CODB 1T3LA 5H3LA 1ADBA 2BFEA 3BIJA 4IDOA 4J1QA 2A3RA 2Q8NA 3MW8A 4PX5A 1CX9B 4PBRA 1Y5NA 4WFBV 3P5BA 3QSGA 3TI7A 2M9MA 1MPTA 2O6HA 1SXQA 4OA8A 2FMXA 3G2QA 1O0CA 2VDNB 1OYVA 4J16C 4I9UA 3IP3A 5I47A 5IT9M 5TQ2A 5A5GA 2GJAA 5DNYB 4QNHB 1C4XA 1TTHA 5EZQA 4Q3BA 2O8EA 2EF0A 3LIIA 1OUMA 2PEZA 1FK8A 1CPYA 2JFOA 3C16C 4KMRA 5KQMA 5K8IA 2VYNA 1GPDG 2Y9MB 1SULA 1KYQA 3U7QA 2VWGA 4YRSA 3RT3C 3LDDA 4WFIA 2F4VO 4OUDB 3UMJA 4A10A 1ISIA 1AV7A 2SNIE 3QE0A 1YTUA 4IEIA 4R2KA 1OY1A 2OG2A 1YK0A 1YXMA 4Y7DA 4OXXA 3I5AA 3R3HA 4TV8A 1RWMA 1XVAA 2D5CA 5LIRA 3ASYA 2JEZA 1CFJA 4LY6A 1YZTA 4OTZA 4PZUA 521PA 2GD1O 1CQJB 4G2NA 3T9EA 5BPFA 4BO4A 1GAEO 4Q1FA 5EOVA 3JAKA 4UZEA 1FNSA 4RH3A 4YPFA 2PAAA 3ABRB 1WLEA 5TGZA 1JX9A 2PLWA 4KK4A 5IAJA 3P4UA 5IKXA 2F8MA 2WAYA 1FDVA 3U61B 3ASVA 2GN9A 1KO5A 5K6AC 1DOAA 2E5WA 3UUWA 2NXWA 2IGBA 1TEHA 1XP8A 5DBFA 3LWBA 3ZQ4A 2VWHA 3BMXA 5KSWB 1IJEA 3E3NA 4EYEA 2CHVA 1V54B 5KQLA 1VMGA 4KVZA 2X3FA 3K9HA 1Q5PA 1R8QA 2FX3A 4G5RA 1E0AA 3WIOA 2JCBA 4CKEA 5IDVA 3UGJA 5CM8B 5C8DA 2WPDA 1U0HC 4EI7A 1GOTA 3FKJA 3VHXA 1N1EA 4X1KB 5DWVA 5TE9A 2ODWA 3QXJA 2J3MA 1OXSC 4GP7A 5REQA 4WFHA 2OILA 3OP4A 1H5UA 2H3HA 4NICA 1LLFA 1R8YA 3H1JH 4GLLA 2ZJOA 1OWMA 3BXGA 4GNKA 1CHDA 5EI5A 2XMDA 3K0CC 1KMCA 2QJWA 4ZHWA 3VNBA 3VVBA 3LQYA 2B99A 2CGNA 2HPZA 3W2TA 4AN0A 1YS4A 3L4BC 2ZWAA 4U2CA 2YVAA 4G88A 3HI4A 1MH1A 4R2JA 1GTOA 3EPLA 1JHMA 4FMTA 4EHJA 2HU2A 1CE8B 4QUEA 4LFAB 1XWIA 1CUVA 4QTUB 4EHLA 5LDGA 4C04A 2PJZA 3UJ3X 2P2CA 4MS3B 1YGPA 3D3WB 1ECPA 5LKRA 4PI0A 1XNHA 4G4SO 1KY2A 3IEXA 2I66A 3L4KA 3SXUB 3DMTA 3L8DA 5CFNA 1B16A 5JWHA 2K1SA 4BNYA 4MB2A 4H7EA 2MSLA 1E1RG 2JAWA 2E4YA 3WJ2A 3F78A 2VYFA 1OZ0A 1BGVA 4JENA 1VHJA 1Z5NA 1BT8A 1IV3A 2Y6VA 2FUNB 4DLZA 2BUAA 2I2DA 2YZGA 1VYUA 3UJDA 1RRMA 1M0WA 3WPWA 2DQKA 1NIJA 5DHQA 1COWG 3E8HA 4XIYA 1EUCB 2YMPA 1MP0A 3BZBA 1SCKA 4RVGA 1E77A 4QHTA 4ROTA 4E14A 5AXCA 5T57A 2BKUA 2V5UA 4E2WA 1M66A 4U7GA 1SCNE 5JCOA 4YMHA 4DDWA 2J7KA 1IG3A 4XDGA 3H6HA 4HO1X 3A4LA 4C7OB 5KNCD 4M8IA 3V4OA 1UKBA 2PFKA 4LJ8A 2DWDC 5KOJA 3A37A 3GLIE 3KAPA 2EJVA 4JT2A 2AR0A 4DR6B 1U8ZA 4JVSB 2DUMA 4ZV4A 3TD5A 1KSFX 2D00A 3HFGA 1YGYA 1W85A 1C0PA 2HR3A 4BEJA 4AWXA 1Z22A 4R81A 1WXDA 4O8CA 3TKAA 3WBJA 4HNAB 1SB9A 2HSJA 2GRAA 4RBNA 3I9LA 1L4EA 2G4CA 4LF6O 1K7FB 4QDOA 4GPBA 2QJOA 3OZDA 5JHGB 1G3UA 2LR0A 2P9BA 4L27A 1SKBA 1UKVY 2PKYX 2VXOA 2R7NA 2CSUA 3ZDXB 1ZN7A 2XCTB 1E3TA 1JSCA 1S4QA 2QA4V 2R44A 2NP6A 5CG2A 4CU5A 2HQBA 3KJEA 3KR2A 4WCFC 1KEEA 2VJKA 4EX6A 4JI5O 4IH9A 1J20A 5HZGA 4EGCB 1C41A 2SECE 3ZCCA 2OHHA 3EGIA 3KZKA 1GYQA 5JS8A 2HF7A 3PIIA 3NH9A 4M89A 4QAQA 2RGRA 1BX1A 3TLBA 5LP6C 4PWZA 2KSQA 3R76A 2CXXA 3ZX6A 2Z0MA 2A0LA 4ABTA 3DF7A 4MI3A 1L4KA 4EG7A 1EQAA 3K0HA 3PQFA 2ASVA 1W19A 2P2ZA 2GLXA 5ALVA 4KKXB 2GBLA 3AEZA 4PO1A 5A5FA 3P2IA 4O2AF 4PIVA 2XZOA 1RM1B 1JR3A 4FEEA 4N54A 4I5FA 1I6KA 4BZXA 4D8XA 2O54A 1XUQA 2OT3B 1NFRA 1UMKA 4FR5A 4F2GA 3O21A 4FP9A 4CMJA 2IF2A 3WV4A 1BCSA 4MA0A 1MJFA 2WIJA 3ZV7A 4C5CA 1K8AH 1Q20A 4K5QA 4A0GA 2O8DB 1SXJB 5EJ5A 1K8QA 4LI0A 2Y4OA 5H1YA 3P2EA 2V3VA 5FBKA 3T1QA 1BE3H 1XTSA 4P35A 2FVXA 5EJMA 4WOCA 2WKSA 2DLDA 3BL5A 5HTOA 3GEPA 3PXDA 2ADPA 4Y18A 1F12A 2GF9A 5KKAA 3W06A 2D3WA 3WSVA 2FJ0A 2OZKA 3R9XB 1G5TA 2YVQA 3NM6B 2X7RB 4GM0A 4WVLA 4K35A 4D43A 2VFAA 5ILGA 1E7YA 3B12A 4KO3S 4M1KA 3BA9A 2P4EA 4JUBA 3LVRE 4F4FA 3NM5A 5I7FA 2ZRHA 1GL7A 4CNQA 2BGJA 3ABTA 3D8HA 5EXXA 1UBUS 3EASA 2BKVA 2B3DA 1GZ3A 2WZDA 1KOFA 2Z1NA 4HFNA 4E94A 3ZU4A 2HT6A 1FFEA 2BFFA 2QL9A 2VJDA 3HCNA 4WBSA 2W43A 2WTEA 2GH1A 2R6CA 4D92A 2BBWA 4XVRA 3WL5A 5KWIA 1JLKA 3HCBA 1UXOA 4F6LA 2PG3A 4EHFA 3H9QA 1RS0A 3E2PA 4X1YB 2PVSA 5B1DA 4C03A 2I9KA 4UCTA 3SEFA 3V7YA 2DHRA 1HFKA 2R6R1 4KQ1A 2O2CA 1SUDA 2V6GA 4JTDB 2CJPA 2QN6A 2GEFA 3S6JA 2M6RA 4DV4O 2JA1A 4IBOA 4XEHA 5HWEA 4TYNA 3CMEV 3BN3A 2UUCO 1WBDA 4QUJA 2XE6A 3I30X 3BKWA 4YWJA 3SCZA 3GEGA 3NGMA 4RZXA 5DTMA 3ZH2A 1R9MA 2AT1A 4C2TA 1C30A 3JR3A 3KTDA 4LGVA 2P2GA 2QN3A 4EMSA 4NHOA 1RKQA 1R0CA 1F7VA 2HK8A 4TUYB 1MB3A 3UMRA 1EUZA 3R6DA 3JQAD 3MZ0A 1V71A 1SOWA 1Z2GA 2O2HA 2EBHX 1JLHA 5AI4A 4AIIA 1N6OA 1HDOA 1KJWA 2GJSA 3GNLA 1SKAA 5FPPA 3RYIA 1N6LA 2P6MA 1U2TA 3P32A 1MABA 3OCCA 4MP8A 1SHKA 4GGPA 1JHUA 2WV9A 5K4AA 4MHTA 1NURA 1KEPA 1Y4AE 2ATKC 3DEHA 3V8PA 1RAHA 3QLUC 3D1LA 2P67A 3DXFA 4PGFA 1QH9A 4OIMA 4Q1VA 4KB5A 1QK4A 5FTLA 1BSVA 5AMXA 5BOSB 3FHCB 2GCPA 4FNOA 4B32A 1Q7GA 3TRIA 3HN6A 1SA0B 4CFSA 3G0IA 1N9GA 2IPMA 2PRKA 2ODAA 5AVVA 3FAVB 3KTFA 3EZGA 1N36B 2GVNA 4LFBO 3QPAA 3TM4A 1Q6HA 1L5SA 1QYIA 2J46A 1UR5A 4L16A 1QGDA 3TZHA 1TKAA 4OI0A 2ZYVX 3CWCA 4PFJA 1Z4OA 3OMNB 1T8SA 5JC1A 3ZVNA 3E35A 1ZBQA 4PONA 3DE1X 3SS7X 4JC8A 4L8VA 2ONCA 1PZNA 1QFSA 4LNAA 3E8BA 1MB4A 1CNMA 1SZQA 5KOHA 1RYHA 4QL3A 1K5SA 2H2IA 5HF6A 4YIKA 4GHWA 1Z39A 1EDEA 4H7KA 2F6RA 5M3BA 2YWCA 2XQGA 3DNPA 4ZXFA 1C7JA 1NN5A 1MXFA 2NXNA 2WLIB 2BZ0A 1R10A 1MB9A 4CC5A 3JYHA 2HB6A 2PD6A 4V1CB 1YFJA 1Y4SA 2I71A 3KDAA 5FUVA 1FFYA 1K4MA 2W6PA 3EHEA 3DG9A 4K26A 2A9HA 3RLIA 3DE7X 4NYKA 3TRFA 2VWQA 1R0KA 3K30A 1XBIA 4IRMA 2FPIB 1RYNA 5FI1B 1ZVQA 3CB4A 4JXKA 3V2IA 5AIAA 1ES9A 2CUKA 2B7LA 3HXQA 2RKOA 1FTWA 1HL3A 3R3JA 3EF3A 1GGEA 5EHXA 2YINC 4TXMA 4CLDA 4TRNA 4IYRA 2GXQA 2NO1A 4BCBA 2RI0A 3LPAA 4JI1O 3EUEA 4CDNA 3MSCA 2HU5A 3NHLA 2ZCEA 3T1OA 5FV4A 4KX5A 2EFHB 1X3SA 1JLLA 1ECCA 5DHUA 1Y6RA 1YI1A 4HQOA 1XP5A 2XUIA 1USIA 2BOVA 3IMKA 4RF4A 1L4BA 3CCSV 3I2HA 2F3PA 4B3XA 1Q15A 2WYHA 3EVEA 1M1UA 3KXDA 4RLFA 5J4LA 4CL3A 1VG8A 3ETCA 5DN6G 4CDMA 3F9CA 5MFPA 2A9FA 1DLBA 1PZMA 4DUPA 3DQZA 2O0LA 1NXSA 1GKLA 1Y9AA 4PQRA 4PA6A 2D3TA 3ELDA 1Z63A 3UW1A 2OK8A 1IY2A 1JOYA 1VMDA 4CS4A 5JZ9A 1MDBA 4PDVA 1VQVA 5C5EA 2IYPA 2EWCA 1H2XA 4V38A 4Q7JB 2FSVA 1HZJA 4F92B 4RM3A 2B61A 4MO2A 1XD8A 2YEVA 3G3EA 1DG9A 1RIFA 2RIRA 4ZREA 2VL7A 4CH3A 3GZTB 4QFMA 4LKOA 3PJEA 3N8GA 4YDSA 2ID4A 3OFND 3DC7A 1DT9A 3WGMA 3A28A 3UHPA 5EWJB 2ZYTX 1C7QA 3V1MA 5ECGC 3EMDA 3TLGA 4LRUA 3FBTA 4N21A 2AZDA 1OGJA 4PO3X 4FDVA 4DKJA 2Z9DA 1JJ2U 5IDWA 1EWRA 2QUJA 3IEUA 3BEHA 1SQQH 4L08A 2WE8A 2ZE5A 1DBSA 5ALMA 3SY8A 3WNZA 3SMVA 4D9CA 4EY6A 3QKSB 2ZQYA 4PAMA 2WLMA 4H4DA 3LUFA 2HTEA 3GGCA 3F67A 3RK1A 3LWOC 1W2BF 3OZGA 3BORA 3ZHXA 4JCCA 4JU8A 1K73H 3EC2A 3RYFA 1P0MA 3X3HA 4U7DA 3BERA 3VZSA 5AG2A 3RUFA 1CU1A 5EEGA 4Z4QA 4IIXA 2Z8ZA 4AWBA 1RAEA 4DXHA 4IZIA 1KEUA 4I4IA 2W8BB 1R73A 4FU0A 3AIMA 2RHWA 1E96A 2R86A 3FPGA 3T3GA 2H5JA 2Z5FA 4WFQA 5DRYA 4JI2B 1JAHA 2CDNA 4TWIA 5K3DA 1P18A 3FAZA 3RRZA 4C0KA 4BQFA 1LZKA 1Y8CA 3VC7A 4AF6A 2PRZA 3DTYA 5BV1A 1G8SA 3WGNA 4KQ9A 2FTKE 3R65A 4A8JA 4CIYA 1OREA 4D79A 5HHTA 4BFYA 2JIZA 3K6JA 4MWTA 4TS1A 1MT0A 3IVRA 1F9EA 4HDNB 1Z3CA 3V9AA 4BCDA 1HQDA 2NO4A 2C78A 4IDGA 2XNKA 2AJLI 4PYOA 3OOWA 4WOKA 1X2EA 2W00A 1V43A 1EGMB 2R6JA 2FH5B 3VV3A 4LZWA 2EL9A 2YSUB 3WWYA 1HH4A 4CZ2A 1CK4A 3VPXA 2WJWA 3G02A 4M9RA 4NSNA 4KREA 1N6IA 1QRRA 4J3FA 3PC8C 5GTIZ 2H1SA 4XD7A 4JKOA 5IWAB 4BMXA 3FTFA 2FX2A 4ZQEA 3R75A 3LYAA 4G4YA 2QUKA 2QS9A 4DWJA 2JFUA 1QAQA 3TVTA 4HNGA 1B1AA 5L9AA 4LVOA 3ZTTA 3NHUA 4C0BA 3LQFA 3WLPA 1VQ4V 2CF5A 1BZKA 1G5IA 3T5DA 4A2QA 1IE3A 1G38A 1S8OA 4XUCA 4BMYA 1ILEA 4XVHA 1WHSA 4E2YA 2C2GA 1M6WA 2GA9A 2WTUA 3B2QA 2R8PA 1RXVA 1G2OA 4I19A 3IELA 2H1WA 4DCSA 4OQYA 2ZIFA 1L7OA 3GRYA 2YJZA 3KB1A 3ASOB 2WMOB 3P7MA 3GH1A 4U3JA 2AJBA 2ZBEA 4JU9A 1ZAKA 3L73H 5CYFA 1X3LA 4FOOA 1XKLA 3ICEA 2ZJ2A 3VSEA 2W6MA 3KEGA 5K3SA 3U3RA 1A76A 1AQYA 1JLMA 4XQCA 4J76A 3K12A 2V59A 3LT5A 1KJ9A 2B2NA 4UVCA 5H82A 1OCRC 4BMZA 3OOYA 1M2NA 3SF8A 5AUNB 4B33A 3PD7A 5AESA 1HMPA 1QO0A 4R01A 2JI6A 1H0HA 4C7UA 1E1CA 2JS7A 1IDN1 3ZO8A 5EWMA 1YIAA 5IN4A 2OXTA 1CIJA 3U7RA 1XV2A 4EDFA 1SXGA 2QD4A 2ODTX 2ZINA 2IRWA 2RJZA 2XUOA 2Z98A 4OL0A 3R0PA 4XASA 2RI1A 3SR2C 2AXNA 1LCIA 4GMFA 4CM4B 3CGWA 3V1NA 2MMGA 4DCNA 5JH7F 3RT9A 2XA9A 2C54A 1DKUA 3B85A 2JCSA 2VJBA 4UHEA 1ZGAA 1KAOA 2XAQA 5E1BA 4OQDA 5BT9A 2CYAA 4NS4A 4P58A 1EU1A 4YDQA 3R09A 1IRXA 1VBFA 4RESA 3U7HB 3EY9A 1O58A 2IH1C 1BQ0A 1O6CA 2WIKA 2CFSA 2F3RA 3DLPX 1TUIA 3BBPA 3F0TA 1QYXA 4QBKA 5HG0A 3EZNA 4BX9A 4YCLA 2VLIA 4OBEA 2A3NA 3DWFA 4Q82A 3UC9A 4NOLA 2ERXA 2YDYA 2UYNA 4ZU1X 2XB4A 5DXFA 5AQ1A 3X44A 1O87A 1YS2X 4GQAA 5TNXA 3W7TA 1S76D 5TT0A 1SU6A 2PJUA 1CRLA 3GP8A 1D07A 2R5FA 4W1QA 2I76A 2FMFA 4RTMA 1RXYA 5KVSA 5KB3A 2R8ZA 1XJCA 3ZWYA 4FPXA 2WU0A 3IUJA 5A6SA 4UM5A 5FWNA 3G8AA 3W5UA 2NVUB 1P5ZB 4S24A 4L75A 1FJGB 1LXCA 2VDUE 2XLBA 1UJCA 1L8OA 4KFMA 1DV2A 5CA1A 2O4UX 2ZRFA 3KE9A 2CZQA 2GJ8A 4ZI5A 1X9HA 4MYDA 1AH2A 1J8FA 2GHRA 2NT3A 1Q81H 1I0HA 3O5AA 2XNHA 3KCQA 2Z2YA 4EG6A 4BNVA 4ASUG 3IURA 3EGXA 2FQ1A 4WFJA 1OC2A 2EWWA 4F12A 1RXCA 5CNIA 2EBUA 4FDTA 3N2GA 4FIDA 4X9QA 2VAMA 2V96A 3DEIA 4JUAA 3EAGA 1V0JA 1KMHB 3QXSA 1QVWA 3FSRA 4RA9A 3OA2A 421PA 1LS6A 4UC0A 1AO3A 3C9UA 5IJ9B 4OH1A 3R5SA 4AD8A 1K3UB 3A36A 2ZIAA 4P0PB 1ELOA 1JZTA 3TKLA 3I7TA 2DU8A 1ENPA 3ZHOA 3UTDA 1PRYA 2WWWA 1A9XB 2FEOA 1QG4A 4B6FA 1P29A 5CLGA 3ISJA 4G0UA 1DHTA 3IIIA 5JNTA 4Y6QA 2H0AA 2WU1A 5LZ8A 2YV5A 5L51A 4UM7A 1DG3A 2NSJA 4FDLA 221PA 3WSWA 2UYPA 1MAAA 1CRQA 2G9VA 4E46A 2YC0A 4OI4A 2RDCA 2ZROA 1G19A 2C31A 2JGNA 5D1HA 3V5NA 4G8JA 4LTNA 2IA5A 5F1YA 2BEJA 5HRUA 3HXTA 2QBYB 2R6DA 2QN8A 4H7DA 1JB1A 5F3WB 3S3TA 1RKXA 3SI7A 1I14A 4ARUA 1BJRE 4C8IA 1BVRA 3OJXA 4FFPA 3MWDB 3BXEA 3ETDA 3R20A 3QZUA 4BASA 4ZVOA 2RGNC 1ZMRA 3TNFA 1YHZA 3B1VA 3CQ9A 3FNRA 4WAUA 1F0NA 4CCSA 5A06A 3D5EA 1XF9A 1ITZA 3EQ7A 2Q1WA 5EQFA 4PSCA 2HP8A 1NW6A 4IICA 3OX3A 3C2QA 1OI2A 2BEWB 3RJ9A 3AVWA 4LF4B 1NN0A 5K3OA 4ZWNA 3HJWC 4R1TA 1FLVA 4MO9A 3SSMA 3T4DA 2RGGA 4MP3A 2FHSA 3O4RA 3J81A 1W2HA 3I5YA 4FFLA 3IKJA 1HZZA 1GCGA 1P19A 4NZYA 2WWVD 3D6HA 4DUZO 1L7RA 2EJWA 1ZJYA 3I9KA 4F1JA 2IZ6A 3CUSA 3LNTA 4RTLA 1T4MA 5DNWA 4L0QA 1BS1A 5JDCA 1UPTA 1B06A 3HXOA 4PLVA 4TL9A 1TF2A 1TB4A 3PN1A 3TGPA 2P4KA 5CW1A 4P82A 4QQRA 2CDRA 3D0QA 3IS3A 1T8UA 4M1MA 1MTZA 2FRVA 3X1JA 2ODMA 1V55B 4UMDA 4BQOA 5LWQA 2GZLA 3D00A 5CR9A 3CPWU 4NXNB 1D5NA 4X6LA 1JDVA 1FRQA 4E03A 1VKZA 4R7GA 2DCMA 3Q85A 4YALA 2DQYA 1BWRA 1UFOA 3JAMN 4Q20A 1HPLA 3S70A 3T7IA 3JARB 4FB4A 2G7MC 1CY8A 2V6BA 3V6MA 4C0HA 1PJ4A 3KKEA 4WDRA 5LP6F 3O3NB 4BY9D 3DT6A 3N3AC 4UUJC 1ZRNA 3K0SA 2WSBA 1D0VA 1EXWA 5JXGA 3TECE 4R2HA 2GLTA 5HF8A 2N42A 4NE9A 1QONA 1ZD5A 2O6LA 4J9VA 1Z2CA 3V33A 2NV0A 1SAYA 2C4HA 1P9LA 3FOZA 1CLIA 3HRHA 4CS3A 3P0ZA 2YMLA 4BN5A 5JD4A 1ZICA 1QTRA 3IC9A 1E2KA 2GTAA 3N7TA 1U94A