4X1YB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 144
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1yB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1yB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1yB01
1OFUA 5MN5A 1RLUA 3VPAA 4TUYA 4ZOLA 3JALB 1W5BA 4O4JA 3HKDB 1SA0B 1W5EA 5FNVB 5JVDA 3R4VA 2R6R1 4DRXA 4ZOLB 2VAPA 3RB8A 4YJ2A 1JFFB 2RHJA 5MN6A 5FNVA 5JCOC 5CB4B 3HKCA 5J2UB 3JASB 5JH7B 2R751 3N2GB 4I50B 3VO9A 4YJ3A 5LXTA 4KWEA 5CB4A 4IHJA 4O4LB 2Q1YA 3HKEA 4I55A 5EIBD 5KX5A 4YJ3B 5CA0A 5LXTB 3RYHB 4F6RA 4I4TA 3JAWA 3WGMA 4X20A 5EYPB 5CA0B 5LOVA 1TVKB 5BMVB 5JQGB 3VOAA 4O2AA 5J2TB 5ITZA 3ZBQA 3JAWB 4X20B 5EYPA 4WBNB 5LOVB 1TVKA 3JALA 3WGNA 5KMGA 5GONB 4X1YA 1FFXA 4TV8A 4WBNA 4YJ2B 3VO8A 3JATA 1TUBB 4IIJB 4TV9B 2BTOA 5IYZB 3JAKB 4DRXB 1RQ7A 4TV8B 4ZI7A 3JASA 3ZIDA 3N2GA 4I50A 5LP6C 3HKCB 3M89A 4O2BB 3UT5A 2Q1XA 4I55B 4X1IA 4EI8A 5KX5B 3RYHA 4U3JA 3JARA 5EIBC 4B46A 3HKBA 5BMVA 4O4HB 5LP6A 4TUYB 2BTQA 5EZYA 5ITZB 1W581 4ZHQB 4O4IA 1Z5WA 1FSZA 4FFBB 1W5FA 4O4IB 5MN4A 1TUBA 5IYZA 5LA6B 4EI7A 1FFXB 1Z5VA 1W5AA 3VOBA 3RYCB 1SA0A 3HKDA 5LA6A 5LYJA 4X1KA 4O4LA 3HKEB 4M8IA 4X1IB 3RYCA 2GVIA 5M7EA 4F6RB 4U39A 5JH7A 3JARB 4I4TB 5J2UA 4HNAA 3HKBB 5IJ0B 3C8LA 4B45A 5C8YB 3RYFB 4IHJB 4O2AB 2BTQB 5EZYB 4EB6A 4LNUA 2VAWA 5CA1A 3M8KA 4XCQA 5KMGB 5GONA 3E22B 4EB6B 4ZHQA 3N2KA 3RYIB 5CA1B 4DXDA 3JATB 4IIJA 5JQGA 2VXYA 5JVDB 3JAKA 4FFBA 5IJ9B 3N2KB 3RYIA 4ZI7B 4O4JB 2RHHA 2RHLA 4X1YB 3WGKA 4O2BA 1W59A 5IJ9A 1JFFA 4TV9A 2VAMA 3V3TA 5LYJB 4X1KB 4E6EA 3ZBPA 2XKBA 1RQ2A 3CB2A 3RYFA 5JCOA 3UT5B 4O4HA 5LP6B 2XKAA 4HNAB 5IJ0A 4EI9A 5C8YA 2RHOA 4U3JB 3WGLA 3WGJA 5J2TA 3E22A 4LNUB
chains in the Genus database with same CATH superfamily
3M5CA 1XKXA 3ANMA 5LLDA 3CNOA 2R8RA 3F2IA 3QFCA 2BOBC 4ZOLA 1ZK1A 4G1MB 5C81A 5F2KA 4LGYA 4EYGA 3M6UA 1KB9F 3FYCA 1F2TB 3MT0A 3T3IA 1ZBQA 2NMUA 1T3SA 3P9ZA 1NFFA 3SYQA 1ZH6A 2A88A 3BJMA 3CISA 3BHMA 4MVJP 2BW0A 1GNVA 2WP0A 3DR3A 4RH3A 3VAZA 3ONVA 4FDTA 1MAAA 5C1BA 3ZO8A 3FFXA 2Q5CA 3LUFA 4JROA 3PWZA 2REOA 2PN1A 5ALKA 1GN3A 3IL2A 1B2LA 1IUOA 3H6HA 3IELA 2J6CA 2ZYAA 4CDNA 2B8WA 1E2HA 3D6JA 3L05A 1AILA 1DNPA 1GJRA 2IEIA 3OFVA 4RJIA 3VO2A 5EA2A 2FHSA 5NULA 1TVKB 1OYYA 2H29A 1QVVA 4U8GA 3DC2A 2DWCA 2RAPA 4CM9A 2AOVA 3H5OA 3N59A 2CVHA 2ZI7A 3O1HB 2C29D 2XLBA 4GMHA 3RUDA 4K8RB 3NVKE 4BLPA 4C4AA 2D3OW 2Y93A 4QXOA 1H2XA 4NU5A 4NZPA 1U0OC 3AESA 4RKYA 4JGBA 1OZHA 4L76A 2BI4A 4A8JA 5DDIP 1QU9A 1VB5A 3B6MA 3H4TA 4X85A 4C06A 1WOMA 4F84A 5ABPA 4H35A 3KCYA 5FNZA 2OO7A 2P1RA 2F55A 2UV8A 3WGZA 3V42A 5C8VA 4FI3C 5BN3A 1IPEA 2EL9A 2WKWA 1OYVA 2CD7A 5F1OA 4BO0A 3TLBA 1Q50A 1TQ6A 4QBGB 4Q9IA 5DLYA 3TLYA 1N9KA 3A6LA 4JF3A 1SOMA 4FPPA 2Z3WA 2EF0A 3K6RA 3QY9A 4OMFG 1KJ9A 3F7YC 2JB9A 4X61A 3VC7A 3GEIA 4I5IA 5EJ5A 1U9JA 3PYLA 4HQ6A 1L4MA 2ZR2A 1Q7GA 1YO6A 3CZCA 3PX2A 4W5WA 1RJEA 3EPLA 1GAJA 5LLTA 4ZV7A 3IXQA 1OD6A 1U3TA 5L3CA 2O8DB 1QDUA 3Q72A 1C0KA 1VQ7V 3JVVA 1NVUQ 1J2EA 1YL6A 1W2HA 1V4VA 2CCJA 2DCUA 3A10A 5DSTA 3WX0A 3PZRA 2WUFA 1SC9A 2PT5A 1QCEA 1OH7A 3NVMB 1ONBA 5IJ0B 2QKCA 2C2ZA 1G66A 3TI9A 1WUKS 3WNVA 1A82A 5IMSA 2Y1OA 4DC0A 5AXCA 1Q0ZA 3QF7A 1IVYA 3RGGA 5AVOA 1UFKA 1ZN2A 3BFVA 2MSDB 2XNJA 3UK7A 3LMEA 2O9JA 4GI3A 1M8PA 4ENTA 3JAMN 1WXGA 1JHRA 1XNJA 2K6GA 4KGXA 4A0HA 3AU9A 3J7AC 3E0XA 3ZDDA 3ZHVA 3IODA 4KXWA 1UUFA 2A3NA 5CVTA 2FZCA 1QIHA 4NDZA 3LC1O 4GRDA 4UHDA 5DI9A 2X8WA 2GJKA 3KT8A 3RUEA 3BUSA 2ZWMA 4FGWA 3QPAA 1U3CA 4C0LA 5KYWA 1ZGBA 1RQ2A 3BXPA 4LCUC 1P3Y1 4Q9AA 4E30A 1DXHA 1UEJA 4I5SA 3UT5B 1QBZA 3EOZA 1EFTA 2PMPA 3KBOA 1M1KH 1O2DA 1JAHA 4H4CA 4L9SA 5IE9A 5HMLA 5K3EA 4IRXA 3E9CA 4RO2A 4MP3A 4OP2A 4PE5B 4W7HA 3I61A 2YI8A 2CLLB 1HYHA 4JUCA 5FLEX 4EVQA 2YS6A 1Q12A 2M6YA 3USCS 3WLPA 4E12A 1XKQA 2BGUA 1VMIA 2CGNA 2OO5C 3VQWA 2PK3A 4OYHA 1NAHA 5ALFA 2EGUA 2ZYWX 5JVDA 5THKA 5D87A 2KQUA 3I6IA 3LMKA 5FUBA 1FNKA 1YJNV 4KPYA 5ALXA 3CRW1 5JC8A 2XNDA 3VKVA 1P19A 5AM1A 2VWGA 1KMQA 2FZWA 1OIXA 2OZLA 3HDTA 4LJSA 4JBIA 4NQZA 4EBFA 3NVIB 4ENRA 3V4RA 4OM8A 4P3PA 5DXFA 4YJFA 5EC8A 4B3IA 1NXWA 1RXCA 4KR3A 1NV9A 1KORA 4M0DA 3ON5A 2YXYA 2J4FA 1XFAA 5HKAA 1LI5A 1UM9A 1XJ0A 2YMQA 3BZWA 1U9IA 4R9UC 4ZO7A 5BW6B 1QRRA 3RS7A 1XQ6A 3V5NA 3RSSA 2C4HA 1ENYA 3B09A 2GERA 4NYMR 2FSHA 2QA5A 2ZYHA 4EDHA 1A32A 5LHGA 1E8NA 5KLVH 1P7VA 2JGAA 3JS5A 4UDXX 1GDTA 2VKQA 4BPRA 2WSSA 1QR8A 1O94D 2UZAA 4HQNA 3OUUA 3JATA 3ANLA 2ID8A 4UHJA 4NOLA 3B6NA 5J40A 1U96A 2QTZA 3M4SA 3V1YA 4BTVA 1YA4A 5CLIA 4DM3A 3F5MA 2ZEJA 1V7QA 2AHOA 2ZT5A 1XSEA 4NTZA 4E2XA 3KBBA 4KW7A 1DIAA 3ABRB 1YZGA 1M8JA 1NUSA 1TVCA 1FXKB 1EBBA 2Z6QA 2GZ3A 4JENA 2P91A 3X2QB 2C9OA 3U1TA 5H5JA 1AQIA 5JNUA 3BB3A 1Q1ZA 4IOMA 3UATA 4RLFA 4F3YA 2MMCA 3IFXA 1Q7TA 3GJTA 3ETEA 4DJAA 4KGZA 2HJVA 2Q3MA 4BRWA 2V3VA 3IDQA 4REMA 1Y8CA 4V39A 2QHXA 2IFTA 3VYUB 3A1DA 3QWHA 3STZC 1XTRA 1J06A 2INGX 3VOBA 4WEOA 3RFVA 2UVDA 4P5EA 1Y8RA 3R3YA 1MJGA 5LYJA 3EIFA 1WCIB 3HDJA 3WMWA 1HT0A 2D8AA 1VYTA 3DR5A 4QLBA 5E2IA 2QSYA 3H1TA 3QNEA 3MLBA 3P2OA 4QXMA 4Q6GA 5K8TA 2C5EA 3X1ZA 3G80A 3P2JA 4Q03A 5TB5A 4DYLA 2V8OA 2H7VA 2XCRB 2GTPA 3W2FA 2YX1A 3L07A 2W7TA 4CCYB 4MVQA 3CO5A 4Y8VA 3SC4A 1EFVB 4GKBA 2I67A 4WASA 4LPKA 3RWOA 4BRUA 3FNHA 1TAHA 2CNNA 2D5CA 4EG4A 4EYEA 1ZD1A 4EJSB 3WYCA 5KQSA 1SQ6A 1AI4A 3PLNA 3H2GA 4UUPA 3NO4A 1BZKA 4P9OA 4RVOA 4PU0A 4CMIB 3I0MA 4ZI5A 2O5CA 1SO8A 2QDOA 2RSLA 5L3DA 5DI3A 3I5UA 1ACMA 3WK4A 4MTOA 3K0GA 5HF6A 4IJQA 2O05A 1AD2A 2OG2A 3MERA 2VF2A 4MP8A 5K2OA 1ULAA 5K1ZA 1I80A 1CRQA 2H2WA 4K9LA 1T5OA 3Q7PA 4H27A 1VQ9V 2OTLF 1B6QA 1ZVQA 4J0EA 4D6TH 2NLOA 2JLCA 4PG6A 4ZOCA 2Q69A 1DHTA 3LYLA 2PX8A 3LDEA 3IUMA 4BNGA 2MTBA 1QHIA 3NRJA 1KI2A 2QE7A 4YREA 3RKSA 2RMKB 1NMUB 3WYBA 1W30A 2CLFB 5H4HA 5KTPA 3OURA 3LUBA 4J0DA 3BMNB 3SK0A 1IQPA 3BT7A 1H4VB 3INTA 4H0CA 4MQEA 3IIMA 4X5OA 1XK6A 3QVTA 3EDYA 1Q6ZA 4HJRA 1LLCA 4PO9A 4EUNA 2JIQA 2WOOA 2ZJBA 5JVDF 4X65O 2FZVA 3VNUA 4DK1A 4IXNA 1H6AA 3EIXA 3DOFA 1BVYF 5J4VA 1E99A 4A2CA 5ITWA 2OM2A 3N70A 1FNJA 4YGYA 2IHJA 4D4JA 1SXJE 4PRYA 1R5OA 1TIPA 1L3IA 3U4IA 3GJ0A 3FAVB 3C9SA 3IULA 3MCAA 4MW2A 4NE7A 3KQSA 5FDFA 1AQNA 2IS2A 1NUHA 3EXFA 3L7DA 4JZ2A 5K1PA 1N9GA 3PRKE 5I3ZA 5ICMA 1CB7A 4LYFA 2E6KA 2C7BA 2EZTA 1EUZA 3NI2A 3FNGA 3FVTA 1ABFA 3LRPA 1I36A 5IBPA 3T4ZA 1QK4A 3KD2A 3RVQA 2PEZA 3SXJA 3HACA 4WZAA 4CG0A 5JFTA 5JSZB 2FMXA 3BEOA 1IMOA 1C1XA 1TAQA 3EE6A 3O9MA 4WFFA 4B75A 1TUBB 4B2YA 3KZNA 4PF1A 2RH5A 3WQHA 2NNWB 3RDPA 2Q21A 5KHKA 3CVVA 1K06A 2CZQA 5EB1B 4FE3A 4B5LA 1PJ4A 3KWLA 3CF6R 5LIPA 3HR8A 3PFWO 1VQ5F 1VQMV 1Z06A 4TTSA 3CLSD 1VOTA 3AG7A 1DDIA 3C14C 3PJFA 1UOQA 3CC2V 2G82A 2ZRMA 4N23A 3DEZA 4Q1BA 4YJHB 4F72A 1ZSYA 4X6LA 3BX1A 4PAGA 4PWYA 3M6MD 1C9YA 1LDYA 1R0WA 1U11A 2PLWA 3H5WA 3KKOA 5EXTA 1YSCA 4JASA 2O2GA 3NK6A 4QQFA 3P3NA 1MN6A 5DGIA 5KOJA 3P9YA 1AGRA 3EA5A 4UEKA 4X45A 1Z38A 5GWXA 8AT1A 1R8QA 4UHKA 4TL9A 4NNOA 5C7YA 4V1CA 3RKRA 4CEJB 3FOFC 5IK2D 2VQ6A 2XZOA 1LK5A 2GZDA 1QH1B 3NANA 4ZO9A 3NOXA 1R2QA 2PD4A 4CLHA 4Q9LA 3ZP4A 1RXEA 3DMYA 4P9NA 1IFXA 1JQBA 2Q0XA 2YUTA 4DY4A 1I7SB 2JGDB 3AY6A 1NX6A 2CNOA 4GM1A 3RRNA 2G8NA 5G4KB 1TRHA 2MOKA 4XLZA 4YXWA 3GUZA 1XVUA 2E5LB 2Z1DA 5TVKA 3HJBA 2UXDO 3GLHB 4GZMA 2HHJA 1D5CA 4N5MA 3UC9A 1QBKC 5EJ9A 5I9BA 4RA6B 2UXNA 1YD7A 4IIDA 4M6WB 4RMIA 2HG5C 1FXVA 4TN5A 4ZQHA 3MPOA 4IDCA 3CSDA 3FFBA 3CX5F 4M55A 5COAA 3SSAA 1VE5A 2IZ6A 4QE7A 4KPEC 1YDHA 4KSYA 4YN3A 2VUHB 4YUVA 3QMWA 2HN9A 2C83A 2H11A 2I2CA 3APQA 3O92A 3R7NA 3B1FA 3B8NA 2EFHB 3DZCA 4MB6A 2BH2A 1GNPA 3CEJA 3K2QA 2W8ZA 5BXZA 4D0RA 4HBGA 2DXIA 1DWOA 2OECA 3TSOA 4ZV4A 3GLQA 3DDCA 2B33A 5SZJA 2B5WA 2XCIA 3Q9LA 2EL7A 2ZI6A 3CRNA 3S28A 5CCEA 3OH8A 5TEVA 1QBGA 1QV6A 1QFXA 1X7HA 2R68A 3BRWD 3SC2A 3UJ7A 4EFLA 5SV2A 5IJ0A 1EMDA 1TADA 3T5CA 1VQNV 4Q7QA 3MMSA 3ECSA 3GWGA 1Q0UA 1YHYA 1X14A 3BE6A 4HRYA 4B82A 1W73A 2B4RO 3BE5A 2FJPA 4F93B 3OMWA 3RLFA 3UC5A 5BQ5A 2CE4A 3CC7F 1NXXA 1T4CA 3APOA 2A9PA 1THTA 2IYRA 2OFXA 2XUJA 3ELDA 1I7QB 5JDIC 3JQ7B 2HP0B 1H5UA 1TUEA 5KOHB 1FCJA 4ANFA 4LJKA 421PA 2V7EA 4F46A 4QC2A 3HUDA 4XFJA 4HT3B 5EAIA 4C0KA 5LPNA 1EX7A 2IVZA 1MG5A 3COZA 1RT9A 3IQFA 3QKWA 1XVLA 4Q4HA 4LCKA 4UBIA 4WFHA 2W2QA 4JIMA 3RHFA 2JIMA 1JILA 2YOGA 1R37A 2NT3A 3BGVA 4J6EA 4LY9A 1KP3A 1PT9A 2WM9B 2G04A 3O4IA 1BOOA 1SPXA 2KLBA 3LSTA 1P4AA 3L8FA 4WY2A 3PQ3A 4BYGA 1EP3B 3GNLA 4DE5A 2PSFA 2XNHA 1N1EA 5LOVA 4KDCA 1P1CA 4GL4A 1DGQA 1ZJ4A 2C3YA 2XAGA 2POCA 3OWOA 3X0DA 1HNZO 2GD6A 2LCFA 2Q49A 4RHUA 5EYPA 5DIFA 5LQJA 3I42A 3IC5A 4PLWA 4RD1A 2OORA 1RWOA 1IXRC 4FU0A 1VH8A 2XYPA 3KNZA 3L0DA 1N4DA 1BDHA 3D4PA 2HQ1A 1NMZA 2D1YA 4JT9A 1Y7IA 1F8FA 4OI1A 3UK0A 5JLAA 3F71A 1IPHA 1UKEA 3WWYA 3GYGA 5KKCA 3FMVA 4PA3A 1U9YA 3IEIA 3MBKA 2GPBA 4FPXA 4NJEA 3OIFA 5DK6A 5IDXA 5KNBD 4I55B 2F8TA 1QRAA 5BOVA 5M29A 4KUMA 3LFOA 1QVWA 1W2BF 1GRJA 2P8JA 1RBZA 1JE0A 2PD6A 1YDWA 1VQPV 3RT7A 5AVTA 3FY4A 3O31A 4FZ3A 4U7WA 3SJCA 4MW3A 4DZRA 1JTFA 2D7JA 4TKMA 5BMVA 3PPIA 1NAIA 4LZZA 1XBTA 3IKLA 1IVNA 4H4DA 1RKVA 2RK6A 5LMUB 2Q0SA 3C4VA 5EFOA 1TD9A 2Q07A 1Q95A 4AICA 3AT1A 1KY2A 4KP4A 2XITA 2NZVG 4FZVA 4MRPA 3PXXA 3IV7A 4ZOLF 1GKYA 1OT5A 2IXGA 5DCWA 2DPHA 3TIIA 3W5DA 1GN8A 1TAGA 2JATA 2KG7B 2GMWA 3AK1A 3CLSC 4PGMA 3SYCA 3DHVA 4CQJA 5ARCA 3H3XA 4W8HA 2GPTA 5DNYB 1XRPA 3CGGA 3UJ8A 3MSCA 4XYMA 2CHVA 1HNXB 5TISZ 2VDOB 2BM0A 3NKVA 4ETMA 3V8QA 2D62A 2Q5JA 3K1AA 3IR6A 1KQOA 2K4MA 4JR1A 3NWPA 4TWZA 1B7GO 5TQ0A 1M4UA 1DLBA 2IUFA 3HVJA 4CR7A 1IXZA 2BVNA 4JX9A 3B82A 3RU2A 4PY2A 3HABA 3O03A 3FYDA 4P92A 1SQXH 2AMVA 4XPIB 2VI5A 4OFWA 4DB4A 2GWRA 3A25A 1G8AA 1V3TA 4N6GA 3GPCA 1MJNA 1R64A 2J5RA 2A4MA 1UMDA 3OFJA 4PSUA 5AVSA 1YQUA 3PUIA 3F1KA 3KFLA 1J0XO 1A9QA 3IA7A 1ZSPA 2Z04A 1B6RA 3HB0A 4JLBA 2PUVA 4GZ5A 4NENA 2YC4C 4DDVA 1P1FA 3WIUA 1ODEA 2G0TA 4CV0A 1KYXA 1N77A 4KTVE 4PI0A 4BWYA 2POQX 2O7SA 4ZCRA 4ZFNA 5HUJA 1YR7A 2ZSFA 4LYAA 4MXDA 2Y1DA 3MWYW 5JC1A 4OYLA 1OSNA 4LZNA 1O58A 2B4AA 2Q4DA 5AKXA 1J8YF 4NG4A 4D8UA 1SXJB 4MQFB 2QJFA 3C3BA 3N8HA 2C94A 3QUQA 3MN1A 2R5NA 4OYYA 4ON9A 2JC3A 4IWXA 4BNDB 1CQXA 2YHUA 3NYQA 3V4ZA 1YITF 1QHXA 1E61A 1PV0A 2FEMA 3MAJA 3ORHA 4KBYA 4OHUA 5JAHA 1RQGA 5JMWA 5L6MB 2I1QA 1CY2A 1XMOO 4Q1CA 2P77A 4MVJF 1KPHA 3UJ6A 4L5JA 4AG6A 3KV1A 1TJ5A 2ATKC 3WGGA 1BT8A 3EMBA 3X2FA 3FOBA 1F2UB 2P41A 3PQCA 2I7TA 1M1YA 2H2AA 4IHJA 1HQKA 3S3TA 4PLYA 2NV6A 4A8JC 4JY7A 5IT0A 4DR4B 3FLEA 3TTVA 2PO7A 3MBMA 3DP9A 3OT5A 1JB1A 3QOYA 1D2NA 1TLLA 3TI7A 2IJKA 5IF9A 3AKEA 3KSRA 3IGAC 1Z7EA 3I2KA 3F3YA 3KTOA 3EFEA 3L8HA 1O9HA 4L4YA 3ORYA 4FK5C 3ZWDA 2ONJA 3TR5A 3A7DA 2NXNA 3H5VA 1RE0A 1M2FA 5JYBA 4WTOA 1MG0A 2GBIA 4IXMA 2J5KA 3A0RB 2HJGA 2C4KA 2FPIA 5HILA 2ADQB 1A98A 1U2PA 2ZWPA 1AUOA 5CX4A 1T5EA 2QF7A 3AXTA 1Z5ZA 4BNIA 4NCAA 4AY6A 1SXHA 3KXLA 2WM8A 1T9BA 2H4HA 3CE2A 1BCRB 2CJFA 1WKVA 2JCYA 2NU6A 2O3TA 3WO1A 4RZUA 2KJQA 3T6KA 1JLHA 2JGKA 3OIWA 2KTVA 4DOMA 4ATNA 4XWWA 1M8GA 1GUDA 2FZKA 3FROA 4RH1A 5A62A 4LV6A 1QMPA 4AILC 3DLTA 2ZDIA 4N03A 4RA9B 1RWNA 4YP9A 4AG5A 4DWOA 3EEQA 3Q41A 5D86A 1Y4SA 2XADA 4FEGA 1OFVA 3F96A 3MBIA 5HE9A 2WJVA 1N33O 3PHHA 4IFIA 4CLEA 5IM4F 2XTJA 1VYVA 3TCKA 3D5EA 4OLHA 2H1SA 4EJSC 3GELA 3JQ8B 2QTVA 4YRMA 1D0VA 5TPZA 1G6OA 1N2GA 1O95C 3VOTA 3TEFA 3GBPA 2H6LA 4HB3A 5DTRA 3SIRA 4XJTA 2PKQO 1VARA 1UIRA 2VUIB 5GIPC 4H4EA 4MR8B 4N49A 5TC4A 4O59O 5A9SA 2ERYA 3VC2A 4E70A 4IUYA 3JYNA 4GX2A 4XGQA 2TMKA 2PDAA 1IQUA 1Y7HA 3WLIA 4MVUA 2F48A 4MKRA 4JJ4A 5E0OA 3D36C 3HBLA 3MTBA 1BQZA 1G3RA 1OROA 3BWDD 3N4ZA 3F7OA 4HWRA 3CJHB 1JLLB 1L4UA 2H8GA 3MCWA 2B4KA 2ZRBA 3AEXA 5IDYA 1E2IA 2FFBA 3TLXA 4XYGA 3UAZA 3CCEV 4EB6B 1HOXA 4J1NA 4J0FA 3FIJA 1RWPA 2A0XA 4K5QA 2QN9A 1TJYA 1VBFA 2QRUA 4EGJA 5IDQA 1T1EA 3DBOB 3SEQA 4GLXA 3WQQA 4IIUA 3L71H 2VJNA 5EMNA 3VU0A 1NHGA 3IP6A 4C7JA 5IJ9A 3LLMA 4OB7A 4JYBA 3X2QC 4C6TA 1AXEA 3GDWA 4I5FA 4EW1A 2VK4A 1ZMXA 2BONA 4G89A 5DYYA 3VR4D 5B1YA 1E79A 4IPTA 1LCIA 4YAIA 3EWAA 2EFDB 2VXOA 3KJZA 5KVAA 3CLUC 2GB4A 4WCFA 2XNSA 4H3KB 1K66A 3U31A 4EVSA 1E2LA 2O3UA 3OQIA 1VQ8V 1SQGA 3KEMA 3O3CA 4FILA 4HUJA 2ZAYA 3DMFA 4UXJA 2WLKA 5H5NA 3S0HA 3BPSA 1QYIA 4PZCA 4BKUA 2J48A 1GTSA 1CUDA 2VZ9A 1AP6A 3NHSA 1WVIA 3A32A 1J7HA 2AZ2A 1T0KB 2HUNA 2YVQA 1EXDA 1AK9A 3L7JA 1V6SA 1OJHA 2XB2A 1QP8A 2BFNA 4OX9Y 3PNYA 3TMYA 4B3TB 5GAPK 5EHIA 2P2ZA 1EVZA 1NTZH 2XTAA 3ZZUA 3F0EA 1EN6A 3UAGA 1SBZA 5BNWA 1PK8A 2Q27A 4Z7QB 3ZHTA 2Q67A 1R5BA 5A06A 1RYHA 3CEAA 1GGJA 1W0KG 5CA0A 1CK4A 4XJSA 4FCCA 1C3EA 4GEGA 4MJXA 3O94A 3NNDA 4LKRA 4FMBB 1FFEA 1JDBC 4G1FA 4GM4A 2PTMA 1AHNA 1BDBA 5D3MA 5T67A 3WI7A 3ZZTA 3A28A 5HM8A 1YQGA 1V11A 3RK1A 2EG5A 2EIKB 2I1VB 2XYRA 2XAAA 2IHNA 2FE4A 1WU8A 4UVDA 5KJ6A 3BB1A 3L4BA 3QMPA 3A9VA 3GLHE 4Q0MA 2D1RA 3G8AA 1QRTA 3NNNA 4PDRA 3CR3C 4I5GA 4D0NA 4DZTA 5EGSA 2EKQA 4HXEB 2K1EA 1H1DA 3NETA 1KEWA 2XMCA 1E3WB 1ESDA 4R8RA 3L8DA 5T6MA 5K6RA 3VZPA 5KPDA 1NVPB 3PTAA 3D36A 4TQFA 4EI8A 1YRHA 2NADA 4NWOB 2R8PA 3HN2A 4RQTA 3A14A 4QRHA 2QG4A 5HFLA 3Q2OA 2FMUA 5LL6Y 4H13B 3JCMM 3HWRA 4O8ZA 1O94C 4GZ6A 4MRMB 4RPGA 3NHMA 3T54A 2H3OA 4CODB 4E14A 2V8BA 5IG2A 1Z68A 1BMFD 3ILXA 5F64A 4YV7A 4WKBA 4DMHA 3EX7C 3AUAA 1XMVA 3EH2A 2HJWA 4JZKA 1HWYA 1G2PA 3NC4A 5AI4A 4ZXPA 3GV0A 1EGVB 1TUGA 3D7MA 2RDMA 1RBYA 3OX4A 2GLTA 4NJMA 5HUHA 2EFEB 2CUZA 2OCYC 1K7FB 1Q6IA 1V5WA 1WCV1 1S7GA 2PKYX 3BORA 1ZWKA 4EB8A 1VRVA 1N6PA 5HOQA 5LGUA 2QM7A 2C4TA 2GPJA 3C24A 4UVIA 2XRYA 3E1SA 3UM9A 4BBAA 4ETIA 2C7RA 1ML3A 1LBTA 2NYAA 4FGZA 4HD8A 4HZGA 4CLOA 2A06H 3DTTA 3RE3A 2RCNA 2ZSEA 4UOEA 3K9CA 4ERNA 3O6VA 1YRLA 1ZONA 1YBAA 3ACCA 4U9UA 4BEJA 5EKDA 3QG1A 3VAAA 3JXEA 4D56A 3IX7A 1K97A 5B7GA 1P45A 3OPVA 1H5NA 4KH0A 3U1BA 1EZ1A 3AUFA 2GETA 4DJEC 1XJCA 5CXSA 3UJAA 1QIGA 3PF9A 1PWYE 4L16A 5JCZA 4XFKA 3H42B 4FJ0A 1EH5A 1A76A 1ZL8B 1IY8A 1MORA 2HBZA 3AP1A 3QWFA 4HB0A 3V2GA 1D1QA 2H4WA 4DLRA 1YS4A 4EYOA 4TTVA 1T5IA 2BEWB 3MLAA 1V9CA 4Z0TA 5FOQA 3I8SA 2BGJA 3TLGB 3ETGA 1MB2A 1Q19A 2QPLA 1NV8A 2X8AA 2GBLC 1UBMS 2BMDA 3KUKA 3PICA 1M5TA 1ZR4A 2QD2A 2B36A 3MPUA 2PJZA 3QQ5A 5DSZA 4DAEA 2QUZA 3DCNA 3MD9A 2P2YA 4WT7A 5TQ0B 3ZDRA 4DUYB 1ZIDA 5D00A 1KDZA 1Z2OX 3AK2A 1RZUA 1WCYA 1R0RE 2G07A 2ODPA 2XVXA 3F98A 4J4BA 4M7OA 2YCLA 3V8MA 3H5AA 2FQYA 4BT2A 1VECA 4ZT7A 3X3HA 3EWNA 4Z7JA 5I7SA 3RRYA 3Q7TA 5T5QA 4NABA 4WFBV 5L3RA 2XUKA 4X3MA 3DXXA 3DEIA 4FVMA 3RTGA 3CW2A 1OWMA 5KAIZ 2P5UA 3IAM1 2Q7DA 1JMYA 2M2IA 3ZU5A 3IEKA 3OOJA 1E2QA 2F95B 2QA4V 2L69A 4KYUA 2LCQA 4EJFA 4O4LF 4GPEA 1LJLA 4PYRA 1VL5A 3K2EA 3ESJA 3OMLA 3RFRA 3F7MA 3HYLA 1J2TA 2PMBA 1Z0IA 1YNSA 3K3PA 4FYHA 3Q7IA 4C0AC 4ER3A 1P0MA 3WSVA 4WJLA 2RJNA 1I13A 4Q3CA 2NUAB 4G28B 1NUQA 2BEUB 3IAFA 4OQZA 4BMVA 1TEZA 2F43B 4FONA 3VOAA 3KOZA 2I8LA 1I9CA 4HJXA 4KQKA 4D0SA 1CZNA 1W1WA 3FFWA 3QU4A 1G291 4YRPA 4AMUA 2WHPB 1QLJA 3VPDA 2HKIA 1SZXA 3C70A 4DGSA 2HRUA 3C90A 1M2EA 3BL8A 3HP7A 3RIHA 1VJDA 2G67A 2Y48A 1M9NA 1ZH4A 4MGZR 3NBMA 4FVTA 3UJHA 1M8KA 5HY4A 2G3YA 2V1DA 4UASA 3A6DA 5T7BA 4S04A 2Q8QA 1M1YB 1MX1A 1Z88A 3RS9A 4FB5A 5EB0A 1PO7A 3BAFA 3BBPA 2D59A 2A5GA 1H2BA 2CUNA 2FKNA 4OXYA 2P8SA 1ZO8A 2VTBA 1YUMA 1HE5A 1QCYA 1T43A 3HUTA 2PH5A 1BWPA 4A2WA 4H0NA 5CFRA 7GPBA 1KAOA 2CFRA 2GH1A 4PTZA 3ZCUA 3KZKA 4QUKA 4YT8A 1Z4QA 4F8YA 1GQRA 1Q3HA 5B55A 2Z2ZA 3A6FA 1CF4A 4QNMA 1X9GA 5BQPA 2HFEC 1FEZA 1BX3A 1JDUA 1Y3IA 3ZW9A 4NBWA 4CBCA 3UF0A 2P3LA 3EORA 1NBMA 1XWIA 1JEEA 4X1KA 1K98A 3K6KA 3B2EE 1FTGA 2IT1A 3FB4A 4N0MA 5C7OO 3RC1A 3CX8A 3G2PA 2J67A 1UT8A 4N3BA 4RIGA 1EJ0A 1EB9A 1EA7A 1WHSB 3CBQA 3V55A 2CTQA 1PUJA 2H52A 2FW1A 4ND8B 4ZP1A 5C3UA 5E8JA 1WBDA 3E84A 3NDIA 3ROEA 3U0BA 3UG7A 5DBHX 1BDIA 5CXQA 3CTPA 3SYNA 4AZTA 1MLDA 1WULS 4OQXA 2K2QB 4JA0A 4CS3A 3S2ZA 4YIOA 3E2EA 3B1ZA 3D3EA 2UU9O 1T36A 2X0IA 4FZ5A 1W3EX 5IXJA 1SN7A 5FL3A 1AP5A 5IDJA 1XV2A 3NIBA 4JC8A 4XWOA 3CCRF 1MABG 1XYGA 1XTQA 4RJLA 1JLSA 2B1GA 1YKFA 1ABBA 3Q1KA 4OSEA 3WGOA 5TX7A 1XDZA 2EIJB 3O9VA 4RE6A 2IQIA 2FPWA 4O2BA 3D4OA 5HUQA 1PGJA 3PUYA 3OJLA 4MIKA 1CLUA 2WFLB 3UHPA 1WETA 4EENA 3CJRA 4EJ6A 2D7DA 2PS1A 3LBYA 1JFLA 3QUBA 5EWRA 4FGSA 4OK6A 5CIWA 3WKEA 2O3RA 3ETCA 3K1YA 5KHIA 4AVYA 3OTFA 1WXIA 3LQRA 5L40A 1HUQA 5GW7A 4YT2A 5F5LA 1Q0LA 3OAAD 1DELA 4MI9A 5BMVF 3LNMB 1M57C 1VQ4F 1WQ3A 2V6FA 3QGMA 3TLEA 4DLWA 5I3CA 3LDHA 4L28A 2DJVA 2A7XA 1G5IA 4BO8A 4JLAA 7YASA 4HRAA 3IHWA 3T06B 4PJ0Z 4QDZA 2VWJA 1T25A 2JJ1G 4HN2A 3T0IA 1E5XA 4DIDA 1MNGA 1F6DA 3HG7A 4P31A 3IQHX 4KE9A 4E7OA 1XREA 3V9AA 2IYZA 4FW9A 1CWUA 4R83A 2O07A 1X9HA 3STVA 1NVAA 2JRLA 4K46A 4ZEMA 4MVMA 1R8XA 1JNXX 1UF9A 2RKBA 3EIUA 5DBIA 4Z0PA 1TX4B 4RPHA 3RSLA 4M1ZA 4CNBA 3PE6A 3ABTA 1EM6A 2HQRA 3A6HA 2QJ1A 4EHLA 2XIQA 3HR0A 2V4DA 1ECLA 1ZM3A 2OV4A 3K0FB 4ML3A 4GYJA 1YTFD 2VP3A 1DQZA 5TXGA 4IDOA 5B1OA 1LDNA 3K70B 2OCHA 4UNSA 2NTJA 1LLDA 1RI1A 4OXSA 1RWKA 2VS1A 3IPAA 3UYLA 1DBQA 3RO7A 3OHSX 3ZCCA 5I5GA 1F7UA 5I7FA 4BV9A 4PTLA 2VTVA 3OA0A 3S99A 3LFUA 1QIJA 3KAJA 4V0KA 1Z62A 5HWEA 3KLOA 4M89A 5DE3A 1ZMBA 5D5HA 2QYOA 4EB0A 2R7AA 4HATA 2FMIA 4UPVA 4ER6A 3A6JA 5ICSA 1NE2A 2L2QA 3CCUV 4YC7A 2IBMA 5BQXA 1M76A 2GF9A 2I7VA 5EC2C 1YQ9A 1NBOA 4LF8O 3M83A 3QBJA 4RIHA 1PFQA 5FFFA 1U2QA 3K92A 4X64B 4X7RA 1DWQA 4BFSA 5CFOA 4JLNA 5HJ5A 1UBEA 1C29B 5FPQA 4BO9A 1UMBA 3T80A 4B4KA 3O21A 2JFGA 1WV0A 1NI8A 1SQ5A 1GEEA 1GFSA 3AUTA 4PO8A 5IKPA 1C9DB 3T7SA 1X1BA 2E18A 4U02A 1PL0A 2QENA 4A6XA 4QDTA 2EARA 3WG7B 1DC6A 3WIBA 1SXGA 1JKIA 2IEDA 4DLPA 3UMMA 2GBOA 1B15A 1M90H 4DIEA 3TSZA 1KJIA 4YK7A 1CRZA 1J7KA 4EY8A 1FNCA 1ULUA 4O08A 1L5SA 2DYSC 1J2JA 3NYWA 4H7DA 1XEXB 4C4SA 3K8YA 2QUBA 3V2UA 3FKJA 1JEAA 4C4YA 4KNYA 2FW6A 1CETA 3F9IA 4A0FA 1Z5OA 3D8CA 2WZCA 1U3WA 3FDZB 1ZK4A 2J0UA 4TMVA 1UWKA 2F59A 1ZL0A 3LP5A 4I4TF 2BTQB 4MRMA 4AUMA 4F85A 4DHWA 1E9AA 4MO2A 2LGWA 1PS9A 1U5BA 4QIHA 3WAKA 1H2KA 2BFEA 3KO8A 5D51S 2X1HA 4Q02A 3ZJYA 2X0JA 1I4TD 1M7GA 4AJKA 4CPDA 3H2SA 4RPJA 1QVFU 4S1TA 1EUQA 4WI1A 2XAUA 4YP7A 5A4IS 2IIBA 2OTCA 1TF7A 1YRBA 3SJQC 5KWIA 5FA6A 2C2BA 1KDOA 4UEQA 1T0JB 4B43A 5HRAA 5IMBA 1FTNA 2HSEA 3I4CA 1E7QA 1Z6TA 1XHOA 2DX7A 5HCUA 1TU3A 4CWAA 4GYCB 1JJIA 1ZA2A 4KQJA 4BQIA 2DT5A 3VDRA 1MRZA 1VE9A 4QVGA 3MDSA 4K6OA 3KJFA 1QLEB 2X8BA 3BWBA 1SC6A 1UJ4A 4LSWA 1E2DA 1G98A 1XVAA 5D1HA 1OIVA 3Q8WA 1Q8RA 1AO3A 3U44A 3ZZ1A 5FOVA 2P6PA 2A9RA 3CSSA 3Q88A 2C2YA 1E3TA 4EPRA 1K8YB 2CLSA 1KO8A 2DAPA 1JIVA 1XRQA 4LDQA 3IT2A 4NU8X 3ZHYA 4IYHA 1M75A 1UBFA 1FYDA 2CTRA 4F45A 5A05A 4GL2A 1HA3A 1OZAA 3CC2F 3HCPA 1G8YA 5EZ5A 2UZ1A 4ZJPA 5GVSA 3PR2B 2GN0A 3RC7A 5KSPA 4XBFA 2AHRA 2WJZB 3D7RA 3OM8A 3RK4A 3OU2A 4ZK7A 1H8HG 3BKWA 4P98A 5K6AA 3T5AA 1MHTA 1XZAA 2NQ8A 2ZATA 4C7BA 1RTTA 1UODA 3C6ZA 2GDJA 3T3NA 4B3MO 2Q9BA 3VSEA 4ODIA 1MIOA 2OC9A 4UARA 4P34A 2CJWA 4ASUA 1RPJA 5AJTA 2G0NA 1E2UA 3KALA 1VHWA 1J9ZA 1U8TA 4CM5A 4LH6A 1FDIA 1AKNA 5FJJA 3HCDA 1JALA 4WPGA 3KWJA 1JJVA 2C1ZA 3VTKA 4A10A 4ZO8A 4BNYA 4DKJA 2LXNA 2HY7A 1N3LA 3H7IA 2Q29A 2ZVPX 5ALIA 5LBIA 3NASA 1RJ9B 3WK5A 3RS2A 3GFGA 5K0NA 5IYZB 3IXLA 1W85A 4J07A 1WB7A 1R18A 3RCBA 3SX4A 4BGIA 5CEJA 4F2WA 3OEHG 3BZUA 4C2BA 3D8NA 3QP9A 4YCLA 1OB5A 3W8RA 1JVMA 3OJFA 4ZK6A 4JZYA 3UGQA 2WMYA 4UNRA 4QE9A 4D9EA 4N41A 3PWKA 4MVXA 2X4IA 1PLLA 1QKJA 3HBMA 4JJEA 4UW9A 3K4HA 3H8VA 4AUKA 5L51A 1I3CA 1UKYA 2BR4A 3QYAA 4J3FA 4YO8A 5DYTA 5FI5A 3M9XA 4EBBA 1JPXA 2Q7HA 2Q3BA 2R9VA 4C3ZA 3ZIUA 1QG4A 1GTZA 1VDZA 1US8B 3UEOA 1NBIA 1Z2GA 1MB3A 2FMHA 3OUZA 2QAGA 5L3EA 1EFDN 1S2GA 1ZL2A 2P4EA 4RTLA 3RYTC 2YZNA 4B4UA 2PL3A 4DMMA 1P80A 5TQJA 1T0HB 2C99A 2D3TA 1Z45A 2R6ZA 3L2OB 1K08A 1RHRA 4Q3OA 4Y2YA 3C98A 1XE3A 4C20A 1E1KA 1T6BY 3BSSA 1KQSF 1GUAA 4IKOA 5FNVF 3FFAA 2GXSA 4R3NA 5F76A 1BE8A 4B7UA 3T12A 2R6CA 1DZIA 1SDSA 3K09A 3W3AH 3CYFA 1NVVQ 3N58A 5D2CA 4CHGA 2ID4A 1TM5E 2WAMA 1F14A 1CZOA 2PCJA 4L4RA 5H82A 5KWJA 2QR3A 1STOA 4WKGA 4FR0A 3WLTA 1XA4A 1O6FA 1GPDG 1GZSA 2EQBA 3NOQA 4NYIQ 4YP6A 2VTBB 2LO1A 1JYSA 1QG2A 1EDOA 1SCBA 1FVFA 2FUEA 3KR1A 1UK7A 1VYUA 4GOMD 3V1LA 1RRPA 2VJMA 4OBXA 5A03A 3FYHA 4DXDA 2F2TA 1GRCA 2Q3FA 4Q3BA 4RAOA 4RK1A 4OFXA 4WOJA 3VJKA 4MARA 4B6OA 3E1KA 5CPBA 1TPZA 4NBTA 4WNYA 4ARZA 4M9QA 3E20B 5AJHA 4FZ0A 1HZZC 4S1OA 2ZFUA 5AXBA 4PW0A 1XZEA 2QRPA 1A5AB 3FTCA 3ZH9B 3UWDA 1O94A 3OECA 3NK7A 1YMUA 1LPNA 5JRJA 4MUIA 2WPNA 1WQ4A 2M7WA 1DEKA 3P2MA 4GKJB 4TZZA 2IW5A 2HGSA 2ZUVA 1X74A 2GLXA 2I6QA 3FDFA 4G97A 1K63A 3DFMA 4ND8A 1XPUA 4KIWA 2H1OA 4P2GA 1G7RA 1SQBH 3AGKA 3AR2A 4LF7O 3DG9A 3L4BC 1QVGF 3BA8A 1B0AA 1KP9A 3A1VA 4DA8A 2IK8A 3WIVA 3KE1A 1ND5A 1T2VA 3IKTA 1IOLA 2IPNA 1SQVH 3GCDA 3DLBA 1YIJF 3NWEA 4U8HA 4UATA 4CE6A 3OM3B 1V8BA 3QW2A 2HWUA 2PUBA 1U81A 4UDOA 1F7VA 1C2TA 3R3UA 2WHRA 2X7RB 1DKQA 2E7ZA 4ILEA 3RS4A 2UYHA 1U8ZA 2D5LA 1BWRA 1Q2UA 2H1HA 4BO3A 4G0WA 2HWKA 3CPEA 1NVVR 5ARDA 1KDVA 5BRJA 4I1OA 4UAVA 2GZSA 1QGED 2I3DA 4JBXA 3UJCA 3DMDA 1SD5A 1VJ1A 5EL0A 3R7FA 4D81A 1YONA 1OILA 4KAAA 4L74A 3B3FA 3E1YA 2WKSA 3E81A 2OC4A 3PC3A 1RSOB 2ZVZA 3A9TA 4M98A 4ZMRA 1Z83A 4Z4IA 1GWNA 2I1LA 3F67A 1QF9A 2LKCA 2SCUB 3CU5A 2H2IA 4CKCB 1YC5A 5KVQA 1C1XB 2VUUA 3H75A 3SLGA 3TZKA 4FDVA 2D7CA 3LCRA 4MV1A 2C7OA 5HXZA 1FFXA 3AYXB 4W5QA 4YQEA 1IHDA 3TIFA 2O20A 3DFUA 3GVCA 5AKLA 2EYUA 3E0QA 4WNCA 2BTOA 1FYJA 4UCRA 2J3JA 4IGIA 1RQ7A 2C3PA 5CMUA 1CE8A 4D82A 4FFRA 3INYA 1XG5A 2V7PA 1E7SA 3QVSA 3RS3A 3P20A 4QDOA 5SZIA 1VPWA 2HPVA 1QD9A 4R41A 4IXWA 1PPJH 1A9TA 1UAYA 3QPDA 1XI2A 4LXTA 4YAJA 1O54A 2R9IA 2J3EA 1CZLA 5TF0A 1JEJA 3WTBA 3JQPA 5IAOA 2X2FA 3WGHA 1JZSA 3UMRA 4K9SA 5COBA 3EW9A 1K7CA 4RCZA 1T5LA 4TXHA 2GD1O 4BO4A 5DHSA 4DQVA 1BMFA 3C6QA 1A4UA 2RMKA 2ZJ0A 1Y81A 2PYLA 2CE2X 5J9PC 3BE4A 4INPA 4MV6A 4DY6A 5ELXA 521PA 4XM0A 2QNRA 5CVCA 5CLGA 5G4KA 2X41A 3LHDA 2VZLA 5TPWA 2G72A 2FUKA 1Z2DA 2WHEA 5CHYA 5LVAA 3IOEA 2NNUA 3OO0A 5CK5A 1SCKA 4WUTA 4LF8B 1PJSA 2QN7A 1K73W 3EUFA 3H9BA 1X7ZA 3I6MA 3LECA 3LL7A 5AI9A 2EXXA 3UGTA 5CB6A 1JU9A 1Y4DE 1UQUA 4HR7A 2OMKA 1NJIH 4XYEA 2VN8A 1Z8DA 1QCCA 1R9MA 4XCQA 1HE1C 2BRUA 3EXG1 3IAUA 2Q7XA 3KHKA 3M34A 4RQOA 4N18A 5INTA 2DF8A 5KJCA 4ZHQA 3DNFA 3ANTA 3T1YB 2YINC 1H5QA 3CMAV 2G4LA 3EMVA 3R4CA 4CQLA 1ZC3A 3PS9A 3HJTA 2Z43A 3GVHA 2HWXA 2AK2A 3E89A 3K04A 2WYIA 2FRVA 3NHYA 4BZPA 1VFPA 4L50A 2CZCA 3C3AA 5F77A 4GUAA 3DC5A 2CLKB 1SKMA 4KN8A 2IOQA 2PXXA 1MO3A 3O83A 4UZEA 1D0IA 1K3FA 3OTQA 4HNGA 5B2FA 2IU0A 5LR6A 5CG1A 4OH7A 5DASA 5C4GB 4B5KA 3VHLB 1JDPA 1JL3A 3ICCA 1OZ0A 1D2RA 3NHJA 4LZAA 4AO6A 1W0JD 4ZVVA 3LA8A 2B82A 3OLZA 3Q40A 3BG5A 2DT4A 1N78A 1NYRA 2W6IA 1G9XA 2YBDA 1UZAA 4M2LA 4AP6A 4HS9A 2XTNA 3JQ7A 3MS4A 4UVEA 5ALQA 5FTMA 3SC6A 1RQLA 4N5IX 3ZW8A 4E7PA 2BFEB 2EBFX 3E9DA 3AETA 2TS1A 4K8OA 3I55F 1EXVA 1C4KA 4LYYA 3LAWA 3TW8B 3L4JA 3L1KA 2J09A 2QD1A 4WK2B 4F9FA 1YZYA 1D2HA 5D5QA 1PP4A 4H08A 4NS1A 1T2FA 3HQ4O 3W7UA 3WBKA 1OJLA 1FDOA 5HJ7A 3RV3A 4CEJA 1OGIA 1IY0A 4IUBS 3P9CA 5LYJF 1UPUA 4BZZA 1BX0A 2B5VA 2I1WA 4MKIA 4MA5A 3QI2A 4OD0A 1Q1NA 4GI1A 3X1YA 4ALMA 1Z4PX 4G26A 4HUTA 3JPWA 3A6ZA 3SPIA 3VR2D 5C46F 1EEHA 2QTTA 2Z9CA 3B5JA 5AW6A 3GF4A 2GCEA 2YYZA 3MJRA 5GJCA 1HSZA 1C0PA 2A9QA 4ZDJA 3L01A 4IDQA 1CQIB 2WVJA 4NR1A 3E3AA 3I2FA 3NZEA 4OH1A 1SESA 2MK3A 2ODMA 3IHTA 2A1TS 5UKDA 4A8HA 1OTYA 5GM1A 3W34A 1HK7A 3HJGA 5A71A 1DAGA 3CFYA 5G0SA 2GM5A 4MLZA 1XO1A 3TNJA 1WZUA 1N2CB 1RJGA 4P22A 5B3JA 1WU7A 2NU9A 2R4UA 3GPBA 4R8SA 3TUIC 4ARUA 5E3HA 2JGEA 4XI9A 1VRWA 3TFOA 1P8AA 2JZOA 1KAEA 2IUYA 4MWGA 5FUXA 3VDQA 4YIPA 3H5IA 1WW8A 1Y6QA 2AUTA 3AF4A 4QTTB 4MIEA 2FPLA 1OX4A 4WN9A 2I3ZA 4AD8A 2QLJA 3LCVB 5B5SA 3BS4A 3ORSA 3EOAI 3EPRA 1EK5A 3R6GA 4V03A 5MDHA 4B3SO 3GK3A 4S35A 3GPLA 4CFSA 2AJ8A 1W47A 1KBHA 1MIOB 5F73A 3FUTA 4ALNA 4LWPA 4H44B 2RC5A 2I4MA 1IE3A 2B0JA 3LV8A 4KNWA 4LGCA 3S68A 3UKDA 4AIRA 2P5OA 1Z15A 3G0CA 2VEOA 2C98A 3LT1A 5CVVA 4Y6QA 1EEXB 2X6TA 1U5AA 2ZWVA 5ENZA 3VR6D 2Z2JA 4B74A 1PN3A 2HIMA 2B8NA 4M54A 1FF9A 2ZBDA 4D9HA 1YE3A 4O3FA 1N36B 2JNBA 4Q9KA 5DISB 3WG9A 1VQ4V 2FGKA 1XJQA 2CW5A 4ROSA 3TZCA 1ZJWA 5DLDA 4DV2O 3DVAB 3EGWA 5AUPB 1O08A 4MCHA 1IRXA 5EPEA 3WC4A 4Q4HB 1KZ9A 4LRQA 2J7KA 3WGUA 2ONKA 4KQWA 4DIMA 4KRYA 5DRYA 4AZ3A 5KQRA 3AGQA 4FD3A 1F2VA 1JR6A 2IY8A 4L4XA 1E2GA 1V54B 2AHZA 1X87A 2EBHX 2PGNA 2QLMA 1NG9A 1M1XB 5J4HA 1F5NA 1IM8A 3DBRA 3DT8A 4GPZA 1PZFA 2NO5A 3HO8A 6LDHA 3KYJB 4RYDA 1Q7RA 3G71V 2WWFA 4F60A 4RTSA 2QRVB 2LP7A 3QWAA 2GZLA 1QQ5A 3EVAA 4KQCA 2CMFA 3NVAA 2C57A 2ATCA 2MR6A 2YY6A 3DONA 3IE2A 1AQLA 1RRFA 3M2TA 5AOCA 2I3AA 1EN5A 1B6TA 3D4LA 4UUBA 5E4YA 4ALIA 5JJLA 2D2EA 3A3NA 4PHZA 3ZWXA 3I9JA 1A27A 3Q5GA 2RD2A 2V03A 3MF4A 1XDBA 4FHGA 4HNVA 3K0EA 3RK0A 4X8LA 5LU8A 2ITDC 2AF4C 5D1NA 3WRXA 1T8UA 3KJJA 5TF4A 1ZI9A 3W0LB 5HP8A 3JAMM 3ZI4A 3K35A 4XRGA 5LQAA 4H6PA 2FCRA 4TKUB 2VSYA 3E53A 1W1UA 3KWFA 2PNJA 1REQB 3CMEV 1OVGA 3H65A 5ULLA 3URKA 5JWRA 2GI4A 2M1ZA 3L6DA 1CUBA 2ZJ6A 2ZPTX 5IBQA 5CFQA 3REGA 3SYAA 3OD4A 1I4WA 1OLXA 3FHLA 5BQOA 1BWQA 1SK9A 3G79A 3K5PA 4K9MA 4KQGA 2VH5R 1KMHA 3IP3A 4WK6A 5EIHA 4AROA 4KIUA 1G55A 4UULA 3TEMA 4XDLA 1P39A 3MFQA 3WFZA 1X19A 5A5GA 2X6BA 4B83A 2VRCD 1OHHG 1C7EA 2F8LA 3FOCA 2I34A 3ELWA 3NJRA 4FZRA 4CM7A 1MB4A 3CVXA 3FYUA 3GRFA 1LSUA 1T1JA 3IOYA 2WJ6A 4HC4A 4UJ3A 1VG0B 2FSPA 1TLFA 1N3BA 4KV9A 2JG3A 2H00A 1G7CA 2ETXA 2QV7A 3E27A 5B1IA 4W5TA 1H65A 1QGDA 1Z2NX 2Q1TA 2ST1A 4E21A 3PUXA 1JN0A 2XRMA 3FR7A 3BN3A 2G28A 3GIDA 3WA7A 4HGRA 1JSZA 5F1YA 2BE7A 3DWFA 2ZB2A 5K0ZA 5IS2A 5EEHA 4L4ZA 3M4NA 2TMYA 3BICA 1WIWA 5B1AB 4FFSA 3CCMV 1HR0B 3LM8A 4LS3A 5CBKA 2E89A 3GQVA 5FI1B 2C5AA 2VYND 2OLEA 1JZQA 1N6OA 4RTJA 2MSEB 2YXNA 3VR0A 1VG1A 4ZTZB 3DOUA 3EG5A 3UOGA 4KMSA 1NLZA 3K09C 4ZWNA 3WPXA 2Z8YA 3U7GA 1R6TA 2PL1A 3NKLA 4L3VA 3DQZA 3ZHSA 4CIBA 3NV7A 1ZVKA 1SUSA 3C3KA 4ND3A 1L5HA 4O4HF 3V46A 2KYRA 1QX3A 3ON1A 2JCXA 2WINI 1F38A 1N8RW 3BD8A 3CURA 1H23A 1M10A 1L5WA 2F1RA 1ZD8A 3EULA 3R6WA 4FFLA 221PA 3RUCA 1CW2B 2WJHA 3IP1A 1V4BA 4OREX 1TIKA 2ZRLA 5FTKA 4MCIA 3AONB 5A6SB 2GEDA 5IVKA 1PGOA 3EH1A 4LPSA 5REQB 1MC1A 2C7GA 3R0QA 4G5FA 5GJVC 4U7NA 2O7VA 3JYLA 4MB0A 4RDCA 4X7PA 3LC0A 3ZY5A 1FFXB 1RSZA 5CCXA 5M5BA 1I94O 2AHYA 1A77A 2E21A 4QGPA 3D6MA 1FDTA 3CCEF 1GSOA 3EPPA 5EUBA 5EZSA 3SBEA 1EDDA 1BMDA 3W5BA 5E1MA 2E4ZA 5E1DA 3WLAA 4C0WA 1YQEA 1E32A 2PR2A 3Q7EA 4BB9A 4NH0A 2B0CA 3IURA 2AQKA 4RD2A 4FFMA 2CYAA 4RKRA 1RR6A 3C8HA 4C7VA 5JMPA 3IILA 4R1NA 3SHWA 3RBAA 4IHJB 2V7BA 3O8OA 1VC2A 1IULA 1QZTA 5G40A 3THYA 4LNUA 5LOVF 3B3QA 1Y33E 4I5DA 4NIMA 5KTTA 3BWXA 1OWNA 3IO5A 1ZGHA 1J5EO 5TE9A 8ABPA 1AXRA 4ZQEA 1Q0HA 2ZT7A 3SIUA 1MC8A 3GIWA 4GU5A 3Q6NA 5LBTA 4AZVA 4UPEA 6ADHA 3AJRA 5IJ9B 4JS0A 1U1FA 4OGKA 4Y2RA 2AK3A 3FKSA 3WK7A 1ZOOA 1VM6A 5DXJA 2WYOA 3OFNA 2F6RA 1OXBB 3KJGA 2I4OA 4CTKA 4W5NA 4BMOB 2CSLA 2V97A 3DAFA 2HADA 3ZJUA 4OIFA 3TD3A 5BXQC 1KH1A 3K0KA 4S2UA 2HCBA 1IPFA 4NYMQ 4OLAA 4PX9A 1S9DA 4M21A 3RYFA 1PJRA 4EKIA 3SYMA 1IYZA 1TTTA 2IJIA 4WNIA 2Y0PA 2QMYA 2Q0HA 4TMWA 4KFRA 1KBQA 1BCSB 1TI7A 2BFFB 4PG5A 5DW0A 2V45A 1JEDA 3U7RA 3K5LA 1FPMA 1RAIA 2CN1A 2JI9A 1GCUA 1GA1A 1NXOA 5THXA 3ROXA 1FDWA 3DOIA 1CF2O 4EAQA 4EYKA 3LPAA 5CDFE 1U4NA 2QUKA 2GBGA 2R6R1 1X39A 1QO0D 2RK4A 1ODLA 2SHKA 4GQBA 3ZGZA 3S5JA 2UZIR 2Y1CA 3KXIA 2X6CA 2Q5HA 1QU2A 4RE5A 3NONA 1ADFA 1Y3FE 3HJUA 2BY4A 3DO5A 1P0IA 4LZLA 1KI6B 3KT6A 5IYBO 3N8KA 3L7MA 4DQXA 1P9RA 3VSAA 3GAMA 3D4NA 3BK1A 4RZ3A 4YV0A 5LXTB 1ESNA 4P4SB 3IEPA 4D98A 1F8XA 4F2DA 2CAZC 2G4CA 2WF8A 3H87A 4W5JA 5CCDA 1X1CA 2XV1A 2V7UA 1G20E 1P74A 3H0CA 1P0QA 3AILA 3QX7A 3A36A 1R5JA 3VSBA 1GGFA 3FI9A 1OOEA 5E6RB 4V3BA 1KKDA 5HS4A 1SHJA 2JKVA 5K0JA 4G2NA 1M56B 2CF5A 2JJMA 5G1OA 3T0FA 4K9DA 1NRWA 3WFJA 1QR9A 3HDHA 2RKOA 3GUCA 1QIEA 3CYQA 1HDRA 2RH8A 3S7TA 3LC2O 3BJZA 4ZAGA 4ITRC 3MS7A 4JODA 4TN1A 5F21A 3S5UA 2OK7A 4IDBA 2F9LA 3TEJA 3M89A 3U3RA 1H4QA 1X3LA 1IHPA 2QI9C 3FDXA 1DG9A 5ES4B 3LWDA 2GUWA 3SR3A 1Q11A 3CCVV 4LZWA 3UG6A 1Z4KA 1ZNXA 3ZYCA 2NP7A 1TD1A 2ONCA 1DTWA 1AMOA 3PFHA 2OBXA 3INRA 3OY2A 4KB5A 5ERYA 1SG9A 4L57A 1H48A 1VF7A 2WILA 1RIFA 1AURA 2OCLA 3R66A 3ASVA 3BH7A 3D6HA 2Q5IA 4IHKA 4JJ8A 1CVLA 2ZVQX 3W7AA 3WYEA 2CLOB 1I1HA 3Q3CA 2PM8A 1WDWB 2E5WA 5ALZA 4CFYA 4C7XA 4IT5A 3ZHBA 3Q2KA 1VL2A 1K5GA 2RHGB 4MVJA 3TAUA 3E18A 4DV5B 3TSAA 4QBFA 2WSYB 1PL6A 2JJ8A 1V16A 2PJDA 2HU2A 3VBCA 2PL9A 5CGQB 1JHQA 4DIKA 2HRCA 4P4TA 3KQNA 3VQXA 5JSFA 1LLUA 1IOWA 4KVGA 4J7CA 1YASA 1YHZA 2DBQA 4JI0O 1PG2A 3GR6A 3MRSA 4IHJF 4BV2A 4AN1A 1N6NA 3BERA 1QVGU 5TQ2A 3ZEAA 5BN3B 4IDFA 1E1LA 5KQGA 1PT8A 3RT9A 2UYCA 4WFQA 1Z2CA 3EFOB 5B30A 2PGOA 2KW5A 3ZWNA 1XEFA 4AWXA 2OCIA 3COJA 3OE7G 3T2MA 1AKEA 1EWRA 2FWJA 2OLKA 1NW8A 2EFGA 3BYZA 3T1OA 1QH0A 1DKUA 1JHXA 3P0JA 1QHTA 1L5FA 3LVQE 3B9RA 3JTMA 4D8VA 4GOOD 3QYFA 1KARA 1I0ZA 2JFFA 2A14A 3LUCA 3JQCA 2BF4A 3BIXA 2CSXA 1JTVA 4RHAA 2ISQA 5CT6A 5IAKA 2NZYA 4LF5O 1QIKA 2V65A 4BYMA 1AF4A 2QUIA 1RVDA 3GH3A 2JIZG 3NW9A 3TLGA 2CNLA 5DBEX 3J81A 4QUDA 4PA7A 4LNHA 4Q3KA 1WSAA 2XGSA 5DN9A 4B3RO 2X42A 4Q6BA 2XGJA 3F4KA 2FFRA 3A1CA 4GDFA 2WUWE 5C1OA 4B4WA 1GKLA 3DMNA 5LZ9A 3OLQA 5G53C 1LQTA 3VXKA 4CN9A 4ZIRB 3R3JA 1FK8A 2EKBA 2WBLC 2JFBA 5E38A 2YFYA 1CFZA 1R15A 1XLTA 4G8DA 3T15A 1KAMA 1QFSA 4IIYA 4JI6O 3PQ4A 5KQPA 4BC1A 3IXMA 4EA7A 5JZVA 3HKDB 1YI1A 3HE3A 4CVNA 4P4NA 2FZEA 4ID9A 3GT0A 2DBZA 4PIPA 5EIXA 1JFFB 2OV3A 3UV6A 4HH1A 3HY6A 5GIOE 2ZZNA 1I3NA 3G6WA 5DTQA 2PV7A 2JAOA 3HL0A 4U2EA 5KYWB 4OB8A 5HP4A 1KZGB 4G8JA 1ZLYA 5BNIA 2NVUA 2CZWA 1KSHA 3WV5A 2BEUA 5CDFA 1SVNA 5DLEA 4BFVA 3GUYA 2R47A 4HSGA 3ZX6A 4GYWA 2V7QD 1EX1A 3PJEA 2GBPA 4MV9A 3QM1A 2VP9A 3PVZA 2JZCA 2V9CA 3EHEA 1CK2A 3C15C 5CLFA 3PGKA 4CLXA 3PJSK 1QHNA 3JQ6A 5ITZA 2IOFA 2WJ4A 3UCFA 3EF1A 3VTIC 1U9CA 3BRWA 3KKMA 4F38A 3ZD7A 1CY8A 3HXTA 1TQHA 1NRXA 1ZM9A 5GPBA 3UKOA 1CNFA 4WBNA 3I5YA 2H94A 1GAQA 2C03A 1COWG 3AZOA 5IT9N 1X80A 4GPD1 4P6VF 3UCSC 4Y6GB 1P4RA 1ZL8A 4QELA 3ZIDA 1V5EA 1J33A 1FMJA 1F20A 4JSTA 4F2PA 3UJ3X 2V4ZA 3HADA 5IJWA 3L7QA 4AUNA 3EGDB 4BNZA 1YBFA 2FDCA 3VPSA 2JANA 1OX6A 2DFTA 3F74A 3G6KA 3QYPA 5B8FA 2HLHA 2ZK7A 3B48A 3VHXA 4IVPA 1DBIA 4U00A 3FW1A 2Z1UA 2WPDD 3PGXA 4XYLA 2FPGB 5KHOC 5DYIA 2XOXA 3AR8A 5B57C 4G1VA 3SS8A 1GQFA 1QSGA 4WY8A 3I1FA 4P7KA 4S1VA 3NHUA 5I9SA 5B1BB 4CM4B 4F5EA 2R8OA 5FOUA 1F8GA 3CS3A 3N74A 1UAAA 1T0AA 2WSIA 1I5YA 4PSVA 4UHCA 1YUBA 5AKEA 3SQNA 3QHPA 4KPUB 4Q4CA 4Q20A 3JX9A 3ICPA 5IZ4A 4JHLA 2VBCA 1OWPA 2OPBA 2R8EA 1MFZA 3PRJA 2BD0A 2PRIA 4HGYA 4UTRA 1JVNA 1U7UA 2Q3CA 1IZ8A 5DWVA 1MCZA 1M2WA 3EBOA 3H1EA 4HPWA 2ZTSA 4D8WA 4Q7LA 1QHHA 5EE5B 4Q1FA 2H1WA 1KWKA 4CIAA 4XCVA 1BG6A 1JJ7A 2CXQA 4HX2A 4EWLA 4D8XA 1CHDA 4TXLA 3JAKA 3MCTA 1KVUA 2AB0A 5ENVA 3H1BA 3G88A 1I2BA 1NUUA 2AYZA 2J5BA 2VJQA 4HEQA 3X1JA 4EB3A 1Q0QA 2I29A 3QUAA 4WLFA 2JAXA 3T0GA 3TXXA 4KR7A 3U0VA 2FKAA 1KKCA 4NBRA 3LBIA 3TNYA 1EVYA 1AZSC 2O0LA 4R6ZA 3ZN1A 3BGWA 3RTBA 1QJCA 2X0RA 5SY4A 1Z22A 2FGJA 2I71A 4Y0NA 3T4UA 4BUCA 4DLXA 4QNRA 4DMRA 2CLCX 4RETA 2O5RA 4CL2A 4MHSA 3CPWF 1DXYA 4B1FA 3ZVRA 5B1EA 5I6DA 1U3LA 3V34A 1ZK2A 5FBZA 5KJFA 4KLRA 1E9EA 1E94E 3AEQA 1K3UB 2B7LA 4LJRA 1I1QB 2IC5A 1Q6HA 5GP1A 1WBBA 3KYIB 3ZKWB 2YQZA 2JRIA 5HHTA 4YTEA 1YZFA 1X8JA 3T1QA 1Z26A 1E6UA 2JEOA 5AVRA 1L4BA 4WF9V 1Y9DA 4RY2A 4BPBA 4QOIA 5AOBA 3HCCA 3EWSA 4Q9JA 4C1NA 4IAOA 2DPXA 3C3SA 4KREA 3KUUA 4BP1A 3DZDA 3ASOB 4RHCA 3CZMA 3AQIA 4RQFA 1J39A 2I2DA 3AK4A 4D5GA 2J45A 1LR1A 1RFYA 4LY0A 2VPTA 4LSZA 3C5WP 3UMGA 1SU7A 1AVTA 1M1YE 1LC3A 3RIMA 2J3MA 2W8BC 2V96A 4KQEA 1N7JA 2E74B 2ORWA 3HC7A 4LZOA 5I7VA 1ATZA 2QR5A 1PKEA 3THRA 2ALJA 2OXIA 2Q1WA 3AIKA 2XDQB 3W6ZA 1VRCA 3DQPA 4DDKA 2I4IA 3AJ8A 1PR4A 3RSHA 1IK6A 1BHAA 4MOWA 4M0KA 1X7WB 2WFMA 3OT1B 4OA5A 2JCVA 3DZJA 4I8XA 5IARA 1BVUA 1N6IA 3QEOA 1SEVA 3OM0A 4J2TA 4OQPA 3CRAA 4E4RA 1C9EA 4R2IA 2NUPB 4WBSA 1QLEC 4B17A 4BQRA 1T8TA 2HH9A 4ZKIA 1GPYA 1XOUA 1Z2EA 4OHRA 5F9HA 4EHJA 4XJVA 4GGPA 3FNBA 1PNLA 3HB5X 4J80A 4J0GA 2GK6A 3H2KA 3ITDA 4L6AA 5BSKA 1QIFA 2VPWA 3E61A 1NJ1A 4GBED 5ALHA 1RRMA 1P29A 3L7NA 2BL4A 2ZULA 1J97A 4N0PA 3FCYA 2FG7C 1SKUA 1L0NH 2BM9A 2ZETA 3LYUA 5JZOA 3OZTA 5B5EZ 4RWEA 4ZGBA 5ESRA 4ZCLA 1B0PA 4DT1A 2AQHA 1JA8A 4HQRA 2YDEA 2AFHB 5C3MA 2P0AA 2X9GA 5IAGA 4I0WB 3IS3A 5L3SB 4BCBA 6CHYA 2ZKOA 4O4LA 4G4YA 4ZALA 4DFDA 3QEMB 2CVPA 1NT2A 1PJTA 4X1IB 2VQ3A 3ZY6A 2HVYD 2PX0A 3COSA 3JAMA 3CVWA 2H08A 2HQBA 4Q3LA 3C8LA 2EILB 3OEED 4HWGA 4NCIA 1N32B 2LVBA 4OV6B 1GM9A 3RVSA 3GARA 4DZZA 1GNLA 1UZLA 4CMJA 3BVOA 3G2QA 1RABA 1BW9A 3I72A 4I99A 2OE2A 5TMBA 3V9PA 2X1MA 1V5GA 2AJBA 1O57A 4JLPA 1YS6A 3ASNC 1KDRA 3MUOA 3QLJA 6PFKA 1GSAA 2W37A 2QRJA 3QE4A 4RD0A 3A26A 1NU1H 5KYYB 2PH1A 1DG1G 3BD6A 2RHLA 4LOJA 5FUYA 1VQKF 5SICE 3CCSV 2X0DA 4FKZA 2WG1A 3QPCA 2FB9A 2XUAA 3DHEA 3U4AA 3LSSA 4XWAA 3HCFA 1K5PA 2BCJQ 5CM9C 3WVNA 4R3WA 2GF2A 4IJKA 3IMPA 1NXPA 2GBFA 3ZXSA 4U7TB 2F23A 1NDHA 1AJEA 4PEVA 3LK7A 3ACBA 5K05A 5SY9A 5E1AC 1GPNA 1AR5A 3EAQA 4GMXA 4BEWA 4UD6A 4TWKA 8OHMA 3MHTA 1K4MA 2SKCA 5A2QM 3HVIA 4L4UA 3PEEA 4UB8Z 3M81A 3EDQA 1JG3A 3TRHA 3WLOA 3M49A 1IV2A 4HTFB 1VLVA 4REQA 2OTJF 1UMBB 2WSBA 4WBXC 4ZDWA 1V5IA 4PLVA 3P26A 2PQMA 3RD5A 5HY1A 2D74A 1I4DD 1U90A 3OHMA 1AR4A 1OU0A 3M6VA 3ROTA 4EFNA 3NEJA 1JKJA 1Q57A 4BV8A 4K35A 2H7YA 4M49A 3AG3C 2UUAB 1KQNA 1DKMA 2HMAA 3GJXC 4U7OA 1QV7A 2O8BA 2ACEA 3D5TA 3I0ZA 3T9CA 4BBPA 3DO6A 1UBHS 2WPDA 3E4CA 1KI3A 2Z9DA 2AD5A 2BKXA 2OV1A 3GLRA 2PWZA 4LOKA 1A97A 5HF9A 1H2MA 2HCFA 2ZBEA 2A57A 2UXDB 3BCCH 2DR0A 4WFGA 1T0UA 1I3KA 1ZS9A 1LF5A 1J8DA 4JMPA 4YFYA 5CITA 4H3SA 1SOAA 2G76A 1T4CB 1XRJA 5CA3A 1MX9A 2EU8A 4BS9A 3EC2A 1ZMOA 2Z3YA 2BMEA 4GD3Q 1WUIS 4B31A 1GR1A 1TUEB 3TSWA 1W85B 5B4UA 2RE8A 5IT5A 1UDXA 4RPLA 3ZCQA 4B09A 2XDYA 3K0DA 3BA6A 3EVCA 5EVJA 1PWZA 4OMCA 4ZCQA 3E4DA 2UVPA 1C3OA 3ROPA 2B30A 4TSRA 2HT6A 5DEIA 2AS0A 2KSQA 3ZE0B 1IN1A 1NJFA 1IJBA 3FPCA 3IT3A 2CWJA 3NS7A 4HQKA 4M53A 4RIFA 5LSAA 1N9ZA 5ALVA 2YJ6A 1YJ5A 3GJZA 3A0HZ 1FLVA 3GJ6A 4PLZA 1QUEA 2AR0A 2RI1A 2EIJC 1PQWA 4NVPA 2XMGA 1EBFA 2BGKA 3C6YA 1HYQA 1F2DA 1SVLA 3MCVA 3I1YA 1QZUA 1IJEA 1KKLA 1N0WA 3MOIA 3V4PB 4AK9A 4DMGA 6AT1A 1J23A 3D64A 3C3PA 4XTCS 1QUFA 4IIFA 4MS1B 1YZHA 4J10A 2X9QA 3VRHA 4I5EA 2I5PO 4MVJE 2PY5A 3G4SF 5K3CA 4HDNB 3Q3EA 4EITA 4MVJH 4I19A 3PI7A 1OXSC 1XNGA 4E1VA 1XVTA 1XRLA 4QYTA 3KAQA 1D2CA 1KI4A 4AB1A 3I56V 1W41A 1P4JA 3H2YA 2IH4A 4LCBA 4M7PA 4MUNA 3CNQS 4F2GA 2NQTA 4LHEA 1NP3A 1ECCA 3EGDA 2R1ZA 4BKPA 5HFAA 5JNLA 3ZVLA 4DCSA 4G1CA 2DWPA 4US0R 2F64A 1D1TA 2CJWB 4QFBA 5KO2A 1OFUX 4HQOA 4ARZB 4YROA 3HI4A 4QOHA 3TZEA 1LJ8A 1VA5A 2P90A 2EIXA 4P36A 3RAGA 1BZYA 1XLTC 1J0BA 4YMUA 3AEZA 1JLMA 1XDCA 2Y3IA 2IZ7A 3VYVA 3VJLA 3F49S 1GG8A 4Z9FA 1P4GA 2HDHA 1SC3A 5LCXA 4ZI7F 4RFSA 3USZA 2YWXA 2PGXA 1EE2A 1BDMA 1YIJV 4RSHA 5J2UF 4DCNA 1GPLA 1FP1D 4Q1VA 4ZK2A 1TFRA 3R1IA 2YHAA 3FM9A 4UVBA 1E4OA 1J0EA 4PFQA 5GTDA 5A3JA 3FMIA 4UZSA 3WDMA 3K6SA 4BQFA 1H93A 4BAUA 1X59A 2XWQA 1FU8A 3VZDA 3RSOA 3ZLBA 3ZGNA 1PLJA 4J2HA 5B53A 4WZZA 5FWYA 2DERA 4MRNA 3T35A 2QVBA 3OW2F 2VPQA 4B7XA 4Z4CA 3GFTA 1EFAA 2IS4A 1BEUB 3FPHA 3B7WA 1I0IA 4PZZA 3RIYA 2OMEA 1IOVA 3FLMA 4RO0A 4C2UA 3UKJA 3H17A 5DVZA 4RV9A 3BY6A 1NMYA 3K9SA 2RNBA 2EZ9A 2YXPX 3UH0A 3AVWA 4FQ7A 2ZB8A 1IN4A 3RRJA 1YCFA 4HLDA 3IQZA 1WO8A 4WK0B 4C30A 1G8PA 1LDGA 1XBIA 2PSHA 3DUFA 1O3YA 3NX4A 3DE6X 3SPHA 1E5DA 2ZJ5A 2HHHO 3JASB 1NPDA 1PKXA 4AZWA 3WRWA 2IYOA 2KKWA 2GAAA 4B4OA 1DFHA 4FEYA 4PS0A 4EGSA 3M5PA 1HZJA 4I9WA 4XX0B 2VHZA 3HM2A 1KFBB 4LCEA 4NPAA 2AXNA 4HMQA 1WEKA 2IA5A 4WOPA 3Q5EA 1QAMA 2Y05A 4CKCA 4EDFA 3G8CA 3TKYA 4JUIA 3U7IA 1ODKA 4EG7A 3BFJA 1DX9A 3BQ9A 4IS2A 4CTOA 3C3WA 4I66A 1R3DA 2FSFA 3P2YA 2CXUA 3KZIZ 4Y6RA 3REOA 3ZE1B 1AQJA 5FTWA 1C3JA 4I9UA 1CY7A 2DOSA 3LDAA 3OPYA 3A6KA 4M4SA 4QUEA 4PINA 5DGDA 4YWJA 1IV4A 3FGPA 3OEEA 2FPUA 4MW1A 2KG4A 4KGVA 2GD0A 1RRCA 3ZIAG 4JWKA 3H1GA 1PR3A 4OG2A 1IXKA 3TD6A 2EILC 1XDSA 2ECPA 2I4RA 3NC0C 4BFTA 2CMKA 2WT8A 1VXOA 5LKAA 2JVJA 3G71F 4B4VA 2QRZA 1VQOF 4B44A 5K20A 5IHXA 5KJEA 3MTGA 2YVAA 4CKWA 4G81A 1XKLA 1SS3A 1W34A 2O0MA 1E6WA 1H8EG 1NTRA 2YC2C 3AFNA 3LKDA 3O8LA 3F6RA 1QO0A 2Y1XA 3L77A 4MS2A 4DXWA 5DH9A 1ZSNA 5JARA 2IXAA 3TINA 4XA8A 1P62B 3ZPXA 5AW3A 2UUCB 1Y67A 4O4IB 2OB1A 1Z4IA 1N2HA 4HVCA 3R3ZA 3KHSA 1PJAA 1ZOIA 4EHAA 2PRJA 4BNLA 5H59A 5TPWB 3P0IA 2AIFA 4WXRA 3VTZA 3FB8C 1F4VA 2GSWA 2QL9A 3CC8A 3VDXA 2ZS7A 4EOGA 3T3OA 1E4EA 4H7FA 2W6JD 1EPUA 3RQIA 4M1SA 4AKHA 4JELA 4RTKA 2ZAIA 5AH0A 5DOZA 3MHSC 2PLNA 1ULZA 1EZ4A 3PLAE 2OCAA 1EGMB 3B3AA 2J46A 1RC1A 1ST3A 3E7DA 1YZBA 3NIDB 4PAQA 4IJ5A 4O2AB 2AZTA 5D8DA 5E6UB 1I3MA 4L6CA 5FO1A 3SHQA 4CT4B 1JQEA 3DXRA 2PX2A 3KYDB 4XGKA 1XELA 1NI5A 2WVHA 4PBRA 3U0ZA 1WA8A 4HH3C 2YNMC 3PXDA 3TQQA 4M1KA 3FX2A 3HU1A 4MW5A 4DSUA 2I2FA 2NO7A 4CHTA 2BHRA 2SCUA 1SWVA 1PJ3A 1U2ZA 4DV3O 1XN1A 2QJOA 4D92A 4ZI7B 4EHHA 4BNVA 5H3LA 3IBFA 3L41A 2F3PA 2FMLA 1H22A 2AV6A 3DZKA 3BCHA 3N39C 3KWMA 3N0WA 3S1AA 3M1AA 3H1IH 1C7JA 2PUHA 4C4WC 2YXDA 1DQNA 1UADA 2R7KA 3FVVA 2AEJA 4HLCA 4CMCA 1R00A 4GKKB 1P73A 3JZAA 2WRZA 5HQ3A 4Z3DA 2LDBA 5K5EA 3IKEA 2XJ9A 2GKSA 3K0BA 2V74B 3N2LA 1CPYA 4A8TA 5K8LA 3KM0A 4UM5A 1EQ2A 2HHLA 5TLSA 4KDFA 4A27A 2GXAA 3ADDA 3DM9B 1M5IA 3RS8A 2QNBA 2AXEA 5EMMA 3GZNB 3KUCA 2HS3A 2FP4A 1RE1A 5H80A 4ENPA 3AVTA 3TE6A 3VSCA 1OX5A 5ISMA 1BW9B 3DVQX 3HWWA 2EIKC 3RJ9A 3QEAZ 1G0NA 1MAWA 4LHXA 1SCJA 1OXMA 2C54A 4F21A 1GZ5A 1TF2A 3N87A 3GLIB 4ZAZA 4ENVA 3PTZA 4L8WB 2BMJA 2PSEA 1FSPA 2ZNIA 1Q90D 2OT5A 1UJNA 1HRKA 4N9QA 4O33A 4MTFA 3R8CA 2JVDA 5FT9A 4POAA 4KITB 3GHZA 3TLAA 1VZ2A 3UCEA 3L1HA 3RODA 4YV1A 3JYPA 3W8DA 3GQBA 2XUGA 1JZTA 2O2IA 2M98A 2WSLA 4KG7A 1G7TA 2COEA 4HQ0A 4ENWA 2FN9A 3FYIB 3H97A 1WDMA 3OQIB 1Q0RA 1ULHA 2ATXA 4YB8A 3RAFC 1IVSA 5KUMA 2WU4A 1RCUA 2XODA 1ADCA 3CN7A 3LT4A 2JF0A 3LVRE 4HPXB 1L5KA 1CT9A 2HQSA 4G1EB 3CUSA 5HS6A 5JAZA 2E48A 2Q6KA 3H1LH 1JVSA 4II3A 2YXLA 5AHWA 3FGOA 3H83A 1V1MA 2DJIA 4C22A 2OHGA 3VKHA 1XAGA 5LZ4A 2O8CB 2XQJA 2NLJC 1TJPB 4EP1A 1DGSA 4BW9A 3THOA 3QXCA 2WHXA 1OX4B 4WN9B 3A11A 1P4SA 3PVCA 5ANRB 3HYSA 4G01B 2AMTA 2RI6A 4JYCA 1LUAA 1YBHA 5HYVA 4J9YB 1A4XA 1BGWA 1SVWA 3GX1A 2VYVD 1BXGA 4U3JA 3FE2A 1GIAA 2OGTA 3O95A 1N5IA 3F4BA 1GITA 3FJYA 4A7PA 3D7LA 1OCCC 1NUTA 1JG1A 1S02A 1JUDA 4KQ2A 6REQA 5F7XA 1U65A 1YZKA 1JAYA 4KU4A 3CIOA 3PPVA 4MLPA 3SFZA 4BOYA 1RYDA 4KV7A 3KXPA 5A5EA 5LBUA 2LUOA 5C4MA 3OR6C 2OV2A 4ACBA 1V9LA 3FUWA 4P3OA 1DLJA 1RLMA 4LP8A 3LXRA 4ZVPA 3UO2A 3VM6A 1SBCA 2AQ8A 4IQ0A 4HEHA 5BSWA 1SQPH 5LA6A 4R16A 4PCAA 1P6XA 2BGRA 3EHDA 2VTEA 3P94A 1INLA 4JKOA 4PC1A 3RC2A 3TNLA 4CM8B 4Q9HA 3MG9A 2EX3A 3WYGA 3A2FA 3CH6A 1ZGCA 4V3CA 1OTHA 1YULA 4AN4A 4C08A 2FMKA 5C8YB 1EFRD 2V1XA 2WNIA 2ZJYA 3PITA 3DDNA 4PPFA 2QQFA 3EVEA 3M4XA 3AF5A 3HLKA 4OQNA 4MI6A 3BHPA 5FEMA 5FAXA 4MHTA 4XIGS 2WKPA 4BJHB 3BFPA 1CUZA 1YOBA 3GRCA 5C31A 4LBYA 1ZOPA 5M2QA 4YRLA 4C7UA 1NSTA 3SDLA 2IZ1A 1M6VA 2JARA 3LNTA 3SVZA 1YI2F 3A58B 3D31A 1KNXA 4LMPA 5IABA 3LUAA 1VF6A 4Q3DA 3ORRA 1XZIA 5JBQA 2HF8A 4DANA 1WB6A 2QIOA 4D6PA 1VIYA 3TGPA 1OCRB 5JE8A 2WALA 4JYZA 2VDNB 2G08A 1YF3A 5ED0A 4CYMA 3Q9SA 3BMQB 4EG5A 1P7WA 2V54A 5IP5A 3I32A 4QYMA 1IAVA 3ZY3A 5JASA 1IHOA 9ABPA 1ZDMA 3AFGA 2O2HA 3STWA 2RGDA 1XU7A 4I7EA 1ECJA 4QG3A 3OBIA 2ZYTX 3TDNA 1LPOA 3WJ7A 1C14A 1VMKA 1UBTS 2RHCA 4BNUA 1X94A 4ASUD 2CDNA 2VLIA 3V3KA 2W2MA 2UXBO 3VCZA 1MJ5A 4Y2GA 1RLUA 4DYDA 4L9AA 1A9SA 2C04A 2H1VA 3OLCX 1AQ6A 4RM3A 3OPXA 4CL3A 4RVHA 4D46A 3ZMUA 1USIA 3B12A 1PG5A 3DQQA 4HZIA 5EESA 1Q81H 4J3NA 1YJCA 5JALA 2QVGA 2V3WA 3GFBA 1OLOA 2R3SA 4KN5A 5EQFA 1X13A 2NXJA 3KU1A 4ZKDA 1FNSA 1DXOA 3CNBA 3LXUX 1X8LA 2ESRA 4JI7B 1VHQA 2RHWA 2AG5A 1VG8A 2R7MA 3STUA 5H3CA 2ES4A 2VDUE 3AK3A 4IIVA 1X6VA 1DRWA 2PWBA 2QTNA 3I52A 1S8OA 4HCJA 4PX3A 5HBRA 2OQIA 4F5ZA 3RUHA 1HLPA 1KC8H 3EVZA 1E1CA 4MV4A 1DKOA 4IH4A 1FXKA 3AKDA 4JL6A 5AP9A 1LX6A 2ATIA 1H69A 5G4UC 2FRDA 4KOAA 4MO9A 1EFRA 1J25A 2OKCA 4WA7A 4IG9A 1EFCA 5JMTA 3LRTA 3JWPA 4YRAA 2QKSA 5H6RA 3MQ2A 5BSGA 5FADA 2XNCA 3MIZA 4ITUA 2I6FA 4X1YA 4UUNA 2J0QA 3GNSA 1E1YA 1G5PA 5AK6A 4GOJA 2WJGA 1XWFA 4P3NA 3D8RA 4G27B 1M34B 3DB2A 4CMEA 2HMUA 1ECPA 3TECE 3NVKI 4IMJB 2IQ5A 5AVWA 2ZD9A 3W8NA 2VHCA 1SXJC 3ENVA 4LDPA 5E4TA 5JADA 5CJ2A 1L1FA 1QVZA 4MAMA 4N5HX 3SM9A 1ZD4A 5FWXA 1XAJA 4GOXA 2GFIA 1RRGA 2H59A 3EGCA 1W93A 3TW6A 3FBTA 2VPYA 4C78A 3QFRA 4CM1A 3KSBC 3TXSA 2NUAA 2W90A 3AUXA 3PDHA 3ID6C 2BSXA 4NWIA 1GL3A 1M6WA 2RB4A 4BFUA 1E2EA 4BVRA 1XR3A 1X8KA 1XLUA 3CZRA 4QTZA 3O9ZA 4BUJA 2ETVA 2F93B 5HWSA 1JQKA 2VR1A 3BREA 4M9ZA 4BJ1A 4YUZA 5AM0A 3T1TA 2DFPA 4WZBA 2V98A 4C7OB 2QTWB 1W87A 2AX3A 2GCGA 3IQEA 2J9RA 2Z2XA 5JDCA 4JYAO 1Q8IA 5TS2A 3GJ8A 2YASA 3GGGA 3OBBA 1SA0A 4WCVA 1PEAA 1G16A 5JSKA 3W2EA 4H1TA 4K3UA 2ZR3A 2P7TC 1IZ9A 2MINB 2RKWA 3RW9A 5KB3A 1VLQA 2CSUA 1N3YA 4I0XA 1YCDA 2JJ2G 2RGNA 4JJ7A 3GNTA 3ROFA 5JH7A 4CMHA 2HFKA 1D1PA 1GM7A 1PR1A 2P2LA 2GUZB 3KB2A 3GP5A 5DN6G 5HKOA 4TSFA 3TQFA