4X1YB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 144
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1yB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1yB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1yB01
2GVIA 4B46A 4FFBB 4ZOLA 4I4TA 1FFXA 2RHHA 3JAWA 5GONA 5JH7B 1Z5WA 3VOAA 3VO8A 5ITZA 1TUBB 3JALA 4ZOLB 3M8KA 1TVKB 5BMVA 1FSZA 4TV8A 4X1KB 3JATB 3WGJA 5ITZB 3RYCB 1Z5VA 2RHJA 3ZIDA 4IIJA 5LOVB 4I4TB 5JCOA 5JQGA 5BMVB 4ZI7A 3M89A 3JASA 2VXYA 4O4HB 4E6EA 2BTQB 5JCOC 1FFXB 5KMGB 5MN5A 4IHJA 5EIBC 4X20A 2VAMA 4FFBA 4ZI7B 5C8YB 2XKBA 1TUBA 3N2KA 4ZHQB 2BTOA 3HKEA 3JARA 1RLUA 4I50B 4TV9A 5LXTB 4EB6B 5MN4A 1RQ7A 3V3TA 5J2UA 3N2GA 1SA0A 3E22A 4TUYB 4TV8B 5CA0A 3CB2A 3HKCA 3HKBA 5CB4A 5EZYA 3JALB 1W5FA 4WBNA 1RQ2A 1W5BA 3WGLA 1JFFA 5LYJA 3RYHB 3RYIB 4M8IA 4O2BB 1W59A 4YJ2B 4HNAB 2XKAA 4I55A 4O4LB 5EYPB 4EI7A 4O2BA 5EIBD 5IJ0A 4I50A 4TV9B 5JVDA 3JARB 4U3JA 5KX5A 4LNUB 3RYFA 3N2KB 5LP6A 4O4JA 5IYZB 2RHOA 4X1YB 5C8YA 5LA6B 4KWEA 3WGKA 3WGMA 4X1IA 3N2GB 4X1IB 4XCQA 5KMGA 4YJ3A 5FNVB 2BTQA 1JFFB 4O4JB 4O4IB 4U3JB 4O2AB 5KX5B 5CA1A 4ZHQA 4F6RB 3ZBQA 5EZYB 4YJ3B 4I55B 1W581 4DRXA 4EI8A 1SA0B 4YJ2A 4DRXB 3HKDA 5IJ9A 3C8LA 4B45A 5LXTA 5IYZA 4F6RA 3VPAA 5LP6B 4O2AA 5LP6C 3RYCA 4WBNB 5JVDB 2Q1YA 3UT5B 4X1KA 3RB8A 3HKCB 3HKDB 2Q1XA 5JQGB 4X20B 4IIJB 4HNAA 1OFUA 5MN6A 5LA6A 3RYHA 3RYIA 3UT5A 3JAWB 4O4HA 5LYJB 4LNUA 3RYFB 2R6R1 3JATA 4DXDA 4O4LA 5EYPA 5IJ9B 3E22B 4TUYA 4U39A 5LOVA 4IHJB 2R751 2VAWA 4EB6A 5M7EA 5GONB 5JH7A 5CA1B 5J2TA 1W5AA 3HKEB 2RHLA 4O4IA 3WGNA 3R4VA 3JASB 5IJ0B 5FNVA 3JAKB 3HKBB 5CB4B 3VO9A 3ZBPA 1TVKA 5CA0B 3JAKA 5J2UB 1W5EA 5J2TB 3VOBA 4X1YA 4EI9A 2VAPA
chains in the Genus database with same CATH superfamily
3NV7A 3PCXA 2PR2A 4ZQCB 1QBGA 1D5AA 1NNSA 1U8CB 2UZAA 5CW1A 3W7UA 4COKA 2D1QA 1K7EB 4I0WB 1FRFS 1JU9A 2JHAA 2Q6IA 3CUUA 3OVMA 1LTQA 4G8CA 4PSAA 3TMKA 5I7EA 3QYPA 2PS1A 2QTVA 1GTOA 1V1RA 3ENNA 2BE9A 2J9FB 5JZ9A 3BAZA 5DGXA 5KIAA 2MK3A 3I01A 3DZGA 1X1CA 2PXAA 3V6MA 4BBJA 3ZXYA 2M32A 2NQ2C 3VBEA 2MU1A 2CK3A 2ZTLA 2FX3A 4ZQEA 1E1QD 3V4DA 4B6QA 2PX5A 1XMOO 2V58A 1LPBB 1VMAA 3AJRA 3IUQA 3NTUA 1VBFA 3UC5A 1ZUNB 1GFIA 4GM1A 2V3CC 3KJIA 2JIMA 3S8MA 2Q9AA 2CNNA 4P4TA 1RXCA 2BTQB 1HE1C 1YUMA 2F8LA 4LOJA 3ZXIA 1Z6AA 2PGGA 2VYND 4KFRA 2CNWD 4XGRA 3WY9A 3BXZA 3SKXA 5C8YB 3L72H 3TQTA 3FJYA 4K9MA 4II3A 2NSYA 2OPHA 1TZ2A 3DV0A 3RRJA 3CONA 5A9SB 5IFKA 5L9AA 2GBFA 2CNOA 2BFFB 1MT0A 1WB6A 1USGA 2ENWA 3BHPA 2CB0A 2XMBA 3PAFA 1TYCA 3D7KA 3MA0A 4MTCA 4N82A 1XMQB 1LS6A 3PIDA 4TWIA 1SG9A 2Z9CA 3D02A 1JA8A 4H1WA 3HTXA 3A25A 2OIEA 4MRSA 2UUBO 3M9LA 1C7IA 5TQVA 1UQRA 1UBTS 2AOVA 2AFRA 4KXLA 1WOMA 4PRYA 1KYTA 4QGHA 3SYLA 4FQ8A 3WL8A 4C05A 4MVUA 1HXHA 2V74B 2F4VO 1Q0ZA 1WB5A 2HHLA 2OORC 3B3FA 5EYPB 4HO1X 2XQKA 1M66A 4J1SA 4TTQA 3F0FA 5BURA 1R8YA 4IVRA 1JDSA 4NCJA 1X7XA 4CR6A 1SCBA 2Z1TA 1Q91A 5EWMB 4KHPO 3U81A 5HP4A 1C7EA 4RA6A 1VF5B 4KNYA 3L6RA 2B8EA 4FFOA 4J1TC 2RMKB 1G8PA 3HJCA 4UCFA 4XCQA 1GT6A 2WLMA 4B34A 4CM8B 3B4SA 4J7JA 1P2UA 2YVUA 1QQCA 2XWQA 1P61B 1HPLA 2H11A 1QB8A 3BF8A 5EUCA 4AZ3A 1E2DA 1MHPA 1XJQA 3HCAA 3CX5F 3MSCA 4HXYA 3RIMA 3RUFA 1GPAA 2FPGA 2BMDA 1XZNA 1QOQB 3IESA 4PQYA 4RDHA 4U6QA 1PYOA 4OLHA 5B57C 5FAXA 2ZSAA 3GN1A 4CDGA 3EZNA 1AQNA 3ZVMA 4PG8A 1O08A 3K4HA 1L3BA 1H3NA 1V37A 1OLXA 4W4TA 4BIMA 8AT1A 4XPIA 3GO4A 5KTSA 1FK8A 2HJFC 2FLWA 5GANK 5DN6D 4P0QB 4MKHA 3A70A 5AUOB 2BFEA 4HAMA 4MVCA 1A9XB 1YUNA 3VTIC 2XH8A 3JATA 3PBKA 2V4MA 2XSZA 1I3NA 2ZUWA 1P2VA 1NPTO 2PRZA 4WNCA 1Q15A 3P7MA 5JXHA 1L5HB 1ZX3A 2FPGB 1RQXA 3DTVD 3G2HA 1UJWB 3HEBA 1TC2A 2DHDA 4P5EA 3E2PA 1K4KA 3BTSA 4R9RA 3N87A 3HL0A 4D42A 5B7NA 3WKCA 3GRKA 1I2MA 2FHPA 5HIMA 4UUJC 1L5RA 1T0UA 3BXXA 3IQIX 2GB4A 3OQPA 2OMKA 3QHDA 3QWFA 3CCEV 2IY7A 3BXFA 4G4SP 1V54B 4RXTA 4G9EA 4YHBA 5ALGA 5AKZA 2IYXA 4NFSA 4X3LA 2GAFA 3ND9A 4HQ0A 2G9QA 2FPMA 3TRJA 1BEZA 1QNFA 3X1YA 4BJ1A 1OYVA 2ORED 4WOJA 1T1SA 3QF7A 2FEAA 4GSYA 5DNVA 3N8GA 1MUUA 1FKAO 1VARA 1T3HA 4J2OA 4NOJA 3RTCA 3WJAA 1NYLA 1P0FA 3AWDA 1VQLV 1NE2A 1XDUA 2HBRA 2ZS9A 1FXUA 1PL4A 3AVOA 1PQPA 1JV2B 3TRDA 4AKGA 1V8DA 2AMVA 2FFAA 2ZJ0A 1NFFA 4R2LA 2ZW9A 2E3JA 4EVIA 1EWTA 4AVYA 1WMAA 2RGNA 3RVOA 4C4TA 4MVQA 5GTHZ 2J3KA 1O0SA 3HU3A 5AQ1A 4IIVA 3E03A 3KHKA 1E8MA 1KO4A 1JAZA 3NH6A 3I6MA 3WS7A 2BYTA 3GEGA 2ZJ4A 3WMRA 5LD2C 4BB0A 1NJFA 2XCUA 3EAGA 2NXWA 4IDGA 2QEQA 4BC1A 4L9RA 1A9OA 4YXWD 1PK8A 5AVWA 1NVBA 3E8HA 4ETIA 3D5QA 3L6UA 3UK2A 2CFSA 4W5OA 1ZBQA 4KUHA 2IUYA 4KQHA 1TZCA 5MN5A 2BSKB 1HQKA 3COPA 3ZDYB 4TQ9A 4KN5A 5G1OA 3NM6B 2PAAA 4O3FA 1CQWA 5KEIA 2V3VA 4TQDA 2OOSA 2VDPB 2UXDO 1BXRA 1L7NA 3PDIB 5KQSA 4C0XA 3IQXA 1YS4A 1ZSPA 1H2HA 1YB6A 2AH5A 2IHJA 3KALA 3TB4A 1A8SA 5AM4A 5C5EA 4BT7A 1D0SA 3NNNA 3G6EV 3USES 1C0LA 3K2IA 3KT3A 4KN9S 2PHNA 3DMFA 1YRAA 1A9ZA 4DT1B 2HVYD 4XWTA 1GX1A 3D6FA 3IBYA 4ZT4A 3K2XA 1H0SA 1PTJC 3AI1A 5CNMA 2YXYA 2IZZA 2WT8A 2II6A 2Q41A 1GTZA 1RWQA 1UBOS 3M5DA 4X41A 1NY6A 1COZA 1IG3A 2JJYA 3MIZA 3LZ6A 2Y68A 2DY0A 3FVTA 3MLEA 3TEMA 2RK3A 4EHAA 4ZCIA 3UJ3X 1Z18A 4M53A 1ZC3A 1ML3A 2GZDA 2X3UA 2QVLA 4P80A 3GA0A 1E1KA 2AJCA 2KG7A 3KJEA 4RPKA 3EODA 1H47A 1J06A 2HUPA 3ILHA 1XD9A 2IW5A 5DOZA 3LO8A 1QRSA 3RIXA 2ZXWC 3F5DA 3JVHA 3AEKA 3LT1A 4X9XA 5D01A 1ZGGA 3T5GA 5JMWA 2WWYA 3P2OA 2ADOA 2C3YA 3C6YA 4CH3A 5L3QB 3B40A 4BP8A 2XUJA 2C4HA 1QM5A 5IAAA 1NVVQ 2QLJA 4MQ6A 1A04A 1FP6A 1Q0LA 4WXPA 3LJKA 1SOAA 2FXVA 4KOAA 5ALIA 1R0ZA 3JWEA 3MUOA 3Q9NA 3VR5D 3ZOKA 4DCJA 3EMKA 3ZJ5A 1UMKA 3H9VA 1CK4A 2V1XA 3IPRA 1AILA 3C3XA 1ONOA 2AKYA 2B8TA 3A27A 5FO0A 2C29D 4ERHA 3FLEA 4D8WA 2I4IA 2LKDA 3UWPA 2ZRGA 1Y34E 4NCHA 5F33A 3TZ6A 3QZUA 3PGVA 4JUCA 3EA5A 1L7RA 4ARZB 3TFOA 1G1AA 4YRLA 5HA5A 1I2DA 3GCGA 4IDAA 4PHHA 5EQJB 4ENRA 4PONA 4O4LF 1EVLA 1NKSA 3NNSA 1BCRB 1SU4A 3G9TA 3SHWA 3AH8A 1E18A 1U3VA 4HCJA 4HQ6A 1DRUA 2XVAA 3D0OA 2OAGA 1I7PA 5BQOA 5IJ0B 2F3PA 4LOKA 1M6VA 2R60A 3GJ0A 4JTCB 3PA8A 4M9UA 3KQUA 1O6CA 4TZ6A 3HUFA 1SIUA 1XWFA 2QRVB 2ZTUA 3UPTA 4RGVA 2GEDA 3UB2A 4YCLA 4N9WA 2NO7A 4PPQA 1WTCA 1BSVA 2A0WA 3NUGA 5AK5A 1F20A 4LHYA 3JR7A 3KYCA 1L4NA 1CY8A 1XKLA 4KQCA 4BLQA 3UT0A 4R8SA 2BBOA 1PHRA 3AHDA 4F2WA 2GUZB 2H06A 3Q8LA 1QP4A 4RBNA 5KNDD 1D9XA 1WPRA 4KDFA 4KPYA 5CLJA 4HEA6 4F93B 3T5CA 3BL5A 2JJ2A 4IHQA 1ZFNA 1FQWA 3A6DA 2XLBA 4ZREA 2YMMA 2ZUVA 5DF1A 3SX0A 3N4YA 1JJAA 4C0KA 1LNZA 2BSXA 4L74A 5JS7A 1PNVA 4FR5A 4WCFC 2PZEA 5K8LA 4CLOB 2HHJA 1SPBS 1R74A 2B7CA 1TO2E 2E4UA 5DHRA 5KB3A 3W5VA 3CO5A 4K8ZA 1U4NA 4CG3A 4PX3A 3KQKA 3GT4A 3JYQA 3HVRA 4CN8A 3RSHA 4KMSA 3AZQA 1UMCA 3RVZA 3SIVA 4LY0A 3VH2A 4EUFA 3K5OA 10MHA 4CEJB 5EMHA 1GAJA 2CNBA 3EDOA 4G81A 2RG7A 2HX1A 3TH5A 1XQXA 1P33A 1GJRA 1TM2A 1T8WA 4MTXA 2FW9A 3LK6A 5JYDA 3DCJA 3CRZA 1XT6A 2I7VA 2DYKA 2EILB 2I4NA 1DTWA 1QYXA 4PGMA 4C2AA 1X52A 3BIFA 1CIVA 4X7RA 3ANXA 5T3YA 3R09A 4EGCB 1HDGO 2ZIFA 3CJRA 3ICVA 4I1RA 2WHEA 4Y1EA 2OXIA 4XWKA 1JQKA 2UYHA 4PLYA 4EJMA 1SQVH 4FDUA 1QZUA 4RY2A 2VYVA 3QY9A 1ZXXA 5LDGA 3M6UA 4JIGA 1ULZA 2DHCA 5HXUA 1UBSB 1DK1A 1C1HA 3CVXA 3E4DA 2EWMA 1NBEA 2QPAA 4HDRB 4KKXB 2R7MA 5CB8A 4RM2A 4V3CA 2C2YA 1QP7A 1KJ8A 3ZCVA 1NRWA 3L43A 4ZEOA 5BSWA 1R0SA 3BFKA 1FP4B 3I9FA 4M76B 4TZ0A 1G7SA 3S68A 3TAHA 4EEKA 2O54A 4NARA 2QSYA 4D1YA 4KIWA 2MINA 2UVDA 4ALMA 3F6CA 2V65A 4AJLA 1WPBA 1FP4A 1P3JA 4K28A 2BGWA 5EP1A 1UT8A 5TMEA 1L1QA 1ZRSA 4BMSA 2WOJA 2IDZA 3S55A 2OCCC 2B99A 2ZF8A 1LVHA 1FP1D 4ILKA 4URWR 4YRCA 3FHCB 1UBKS 4RZXA 3SSNA 3BVOA 4F6RA 1KJ9A 2GZRA 4PAGA 4DQUA 2OCHA 5KCZA 5HPYB 2BDTA 4LDAA 1ZMTA 4MOWA 2YJ4A 4HKTA 1NVUQ 1UDXA 1U7HA 5T64A 2PJDA 2DXIA 4EI2A 1JEEA 1KKUA 5CYFA 4DW0A 3H04A 4PGAA 3WLKX 1MSDA 3TLGB 4HYYA 1UJNA 4MA0A 4BWYA 1MB2A 4XRRA 4BHTA 4Z2AA 4QUIA 3WXMA 2WIBA 5T4EA 4YRFA 2GPTA 2IUFA 1OLSB 3M2TA 1K92A 3IAAA 2F62A 1XKTA 4RJKA 2ZCUA 4WFBV 1DP4A 1AMOA 3ELDA 1SKBA 3VR4H 5IG2A 4DJAA 3BYZA 5KQPA 1P2SA 3FH0A 1QLJA 2I6XA 4KZPA 4QUEA 1VJGA 2X2FA 4IV5A 3ZX5A 2VWQA 4K3VA 2OCIA 4Z7OB 3D2CA 2H07A 4MUIA 1KK1A 2HBZA 3V1MA 4B33A 2HP3A 2A1TR 5AVQA 3DYIA 2IZ7A 2MSNA 2ZJOA 1SBNE 4ND4A 2WQZA 3I58A 3NK6A 4I5IA 3Q8HA 4GYCB 1ICIA 1PJQA 1UBRS 2LGJA 2ODNA 4WEQA 4PR0A 5BSHA 1IHUA 4JV5O 3QVNA 1ZONA 2WU0A 1WV1A 3DVAB 2GUZA 3VO8A 2VHCA 3QX8A 4UAJA 1AUQA 4D26A 3RIYA 4BNFA 3VNVA 3PDCA 4K0RA 3S2UA 2XMSA 1U0FA 2F3RA 1BS2A 2JK1A 1ZICA 3LF2A 4MGEA 4CODB 2Z6QA 1JYEA 2L6LA 3E8XA 3GK3A 4P6VF 3ZWXA 1ZUD1 2VP9A 3ZYCA 3DTVA 4OGWA 3CYQA 3HGTA 2XKKA 2Q5EA 2WIAA 2Y67A 5HBGA 4EJFA 4LSWA 2DY1A 5IRCD 3IKFA 3Q1KA 1JGTA 2JFVA 3L0PA 2BZSA 5EVCA 3OCZA 3RNOA 1TA4A 3ABMB 2RMKA 2ZDIC 4R05A 5B37A 5M3BA 3L8MA 5EWMA 1P4SA 4MJ3A 2JH8A 1W96A 1OZFA 2HHHO 2W6IG 2FSIA 5K3BA 3ABLC 3K9HA 4MWSA 4CVNA 1X9GA 2I6TA 4K8OA 4MARA 5HOEA 2GKSA 2VHUA 3ZY5A 1JLMA 2RI0A 3A3OA 2O2YA 4IVPA 2PYJA 1Z33A 4ECEA 4UAUA 5FULA 3UG7A 1KA9H 4B3RO 3FDJA 1M2HA 5LYJA 3GROA 3LUGA 4C7MA 3ANSA 2Z09A 1W59A 3AG2C 4U7OA 3GMSA 4X24A 1CY0A 3B52X 3DGEA 1GNSA 1II9A 5BWBA 3MCWA 5HOQA 5GMOA 5JATA 2IVZA 3B1JA 4HS4A 1CHNA 4FLEA 4F45A 1NHWA 2QV0A 3GW8A 5DM60 5I9NA 1M2FA 2QJ1A 1JLLA 1AKMA 1LPNA 4NBWA 3QU2A 3BTUA 4OXNA 5C8YA 3QIVA 5E6RB 5CDYA 3LIPA 5I4BA 3NIBA 4TROA 2NVWA 5CNKA 1JN0A 2C7BA 2Y76A 4Q05A 4QOEA 1SOMA 1FYWA 3BQNB 3D3KA 3KLMX 3NC1C 1SUCA 1QNLA 1QQBA 4JT4A 4L0QA 1TZBA 3GUZA 3BL6A 5AR1A 4AUEA 1LLCA 3BQMB 5C7YA 1KJWA 2FZ4A 4UNNA 5KBYA 1TDJA 4DV3B 1M2OB 2J9GA 3DWIA 1DCFA 4XDLA 4DT1A 2Q1YA 2B4KA 1QFJA 4LCKA 1YFKA 1ZNZA 3NFRA 1Z12A 2X4GA 5KYWA 2PGNA 3ZW7A 3K9GA 1NN1A 1EBUA 4RAIA 1SDSA 3GLIA 1CE8B 4LP8A 1K9VF 3NBQA 4PD4F 3AETA 4EABA 4QUHA 3U56A 2W6CX 2RJZA 1QGUA 3SX2A 2GASA 3DPSA 4FB5A 5HZMA 3CPQA 5ECDA 1DWUA 4F4DA 3CVYA 3CNHA 5AKLA 4JI5B 3ZKWA 3GYQA 3TZKA 1ZH8A 3AR4A 5D7BA 3LLMA 1N6LA 4H3SA 1R9JA 2XHEA 3UXHA 5JQWA 5HY4A 2W2TA 4LKRA 4P36A 3U39A 3PIIA 1HG1A 1RM1B 2K6GA 1NN5A 1JUDA 3CKYA 3ACBA 1ZN2A 3HYNA 3I6BA 2HQSA 4AMBA 3GZNA 3FBTA 3V1KA 4CLDA 3U62A 1VG8A 2ZJ3A 3OZVA 4G4ZA 3NG1A 4AZTA 1MP0A 2EZ9A 4K8XA 2Q6LA 1FDOA 2PO7A 2V54A 2FSUA 1KB9F 1E9RA 1WY5A 2QN7A 1E9BA 3EDRA 4IDBA 4LV6A 4RORA 1K7XB 1IXBA 2ZBVA 4YRJA 3WYNA 2XD4A 4IZIA 1RI4A 3ORRA 2D7CA 4MUJA 5CTJA 2RGNC 5EXPA 2OQVA 1JWLA 1R1BA 1OIXA 5KHJA 1ZL8B 4GOJA 2GNAA 3RV4A 4FI3F 2ZSUA 5KUMA 2E4WA 3ENZA 3NVDA 4EYQA 3KHSA 1CZNA 3GBSA 3OIVA 1BE8A 1N3BA 1VL0A 3IQGX 2IY8A 2O7VA 1OBFO 2YI8A 2H4ZA 4XWWA 5M2QA 4Q7LA 2WVJA 1VBKA 3THOA 4ZDIA 3THXA 3DUFB 1WCV1 4YT5A 1VQKF 3MG9A 2FN3A 4X64O 3WK6A 5IE9A 1MEJA 1K98A 1ISFA 1M0SA 4JI8B 2NPFA 5CXSA 3SXUA 4CT5A 4URXR 4ENPA 1FMCA 2EBFX 4FHFA 1KETA 1GZ5A 3ZU5A 1ZGHA 4DNQA 1V8OA 3PSAA 4XXHA 5COAA 3FD9A 1OBOA 1I51A 4N1AA 5BY1A 1SKYE 1XVVA 4DSNA 2PUDA 2XKBA 4Z2WA 1KC1A 1EUZA 2ZT9B 2GXSA 2AJLI 2WD8A 4WCFA 1J24A 5EKXA 1PT5A 1M2VA 1CCWA 2IQIA 4FMPA 4A92A 3DS8A 2N0SA 4BRUA 3U16A 4MRMA 3L7QA 1U5CA 1XF1A 4NG5A 5A1TA 1GPYA 4ZMRA 2WLHA 2CDYA 3MK31 3APOA 1MJHA 1GZ6A 3MS4A 1ULAA 4LE1A 1PNLA 1INLA 1RWPA 2BMFA 1W5FA 1V7PC 3OP1A 4Q4LA 2JKYA 4Z49A 3HR7A 2SNIE 5D1HA 1ZWIC 2CLMB 1ZZGA 5B58C 2I67A 4TUYF 3C16C 4BVKA 1G8HA 4NOKA 2NIPA 3TGPA 4R41A 3HNPA 3ZCQA 5LMUB 3SC6A 3EFHA 4XVCA 3PD0A 3WG7C 2KX7A 2MWMA 3HS3A 2IHKA 1HTWA 1MOPA 3DZDA 4X3MA 4RVDA 4DL9A 4C1BA 4G24A 4AJEA 3JVEA 4G0ZA 2NU6B 2ONJA 4CM8A 4L08A 4X1IA 1QZZA 2QRZA 4MVXA 2CCGA 3HXMA 4WFQA 1UK7A 5D84A 3HPRA 5G0SA 1Q21A 3IRVA 4EGSA 2K87A 3FSGD 3MERA 4K0KB 3RVKA 2CE4A 3VI3B 3IDFA 2VWJA 1X7XB 4O2AB 2IZ5A 4D9MA 1LX7A 1FRVA 2BRUA 5A5GA 1Z4OA 4WK6A 1Z2DA 3DE7X 1EFCA 3NHFA 5LQSA 1C2TA 4L4RA 1UM9B 3RVBA 5IF3A 1LDYA 4NPCA 3UJDA 2IYEA 3EBLA 3HVHA 5JY1A 4IQ4A 3M4XA 4HAWA 1ZEJA 2A0YA 1KRHA 1IJBA 5AVYA 3T1TA 3QTCA 1B8VA 3RO7A 3I9V6 1FXVA 1KBZA 2C9OA 4BMPB 1E9AA 1GUFA 2WJWA 3SYTA 1NULA 4M7RA 3GAFA 4DG5A 1YIAA 1YRYE 2QORA 1XZHA 1XA0A 1ZM9A 3P19A 2XVYA 4KQ2A 4U7PB 4AULA 4DV2O 1N75A 3NNDA 2CH7B 4NMMA 3DV0B 4RENA 4CM3A 1D04A 3LQRA 4ZQBA 3NJ4A 4WASA 5KYXB 3VOSA 3PDJA 3W1VA 2R1TA 3WHLA 4BMZA 2EZUA 2BKAA 2J48A 3JWGA 3PFIA 4N3NA 3WA7A 4DB2A 1G20B 1UFIA 2C59A 3U1BA 1UK8A 1TQHA 3B13B 4UPDA 5FNVA 2OAQ1 3CY6A 3W3ZB 3WK8A 4G1UC 5DRYA 3MIIA 4C6HA 3W2IA 1XG5A 1UMDA 3WMXA 3VSCA 4GMDA 1XFAA 4P0TA 4RPIA 2Y4TA 4CR7A 1GNVA 2FRDA 2PD6A 1C80A 4KXWA 5HZKA 1WB8A 1UINA 2RH9B 3BCUA 4ZARA 5K3FA 1V1RB 3RWRD 1FX0A 5CVVA 1J1IA 1YVEI 1XNJA 1ZEMA 1TI7A 2L0XA 1DF4A 4N0DA 1J56A 2RB4A 4MSUA 1I7LA 4YI3A 3ZWWA 4B0OA 3JCMM 1U96A 4ZODA 5T8KC 4AYTA 1GYQA 2ICAA 1OB5A 5H5NA 2VTKA 3MILA 4UARA 4JC0A 2A92A 2W6QA 1WCIB 3A2KA 4AP9A 4ECAA 4IXTA 2Y0EA 1W29A 1G38A 2V7TA 4N0PA 4RSRA 3CO0S 2OC4A 3LL4A 4DMMA 4CTMA 1SXJB 3K0AA 4WKOA 3FOCA 4IYRA 4MPDA 3WIOA 1PFQA 2ZDGA 5A7FA 4RD4A 1JEOA 2V8BA 3E9CA 3H1FA 4FYWA 4G1CA 2D2IA 3C5WP 4O08A 1IV2A 4QXQA 4RADA 4EJSA 3K9FC 4HATA 1XEAA 4N7RA 3OQHA 2JVIA 4RPJA 4B3TB 1F7YA 3C14C 5EHQA 2JK5C 2DWPA 3TEJA 2FETA 1X15A 1BDMA 1VI2A 4FGLA 3TLAA 1PT8A 3H2KA 4GZMA 2VNAA 1GCGA 1G6UA 1T6XA 4H77A 4JNCA 3KSBC 4HAXA 4PXAA 2YSUB 4R6XA 3ZCPA 2C4WA 3HZZA 3HJRA 3VQVA 1U1FA 2ZKLA 5KAFZ 3HB4X 4MKIA 3UXEA 2WUFA 4ID9A 5DNUA 4XTRA 5E4FA 2FEWB 3D1JA 4J16C 4RW0A 1G4AE 1RKVA 4GKJO 3KZXA 4O0MA 4RZ3A 3VMFA 4BO2A 4CHTA 2EJTA 3IC7A 1N33O 3CC7F 1TCUA 1YE3A 2F3SA 3FCYA 5AW9A 3WGQA 2AFIA 3E9DA 5CDHA 1ARZA 1PR9A 1RIIA 3RHFA 4RVGA 1GPUA 2SCUB 5EIBD 2OFOA 1W9HA 8ADHA 3WBKA 2OWDA 5KDOA 3KE1A 4MCHA 4PRLA 5AHRA 4LZWA 4KVZA 5DMHA 1E3WA 3B3GA 1W36D 1JH9A 3CXHF 3FLAA 5FDFA 3H1AA 4Q1AA 5A6SA 5J63A 2EBWA 2M6LA 1DBIA 1NE7A 3N6XA 5I9LA 4YRTA 5HG0A 4N0QA 2OCYC 4B4DA 4EKDA 3NXSA 1L4BA 1BQ0A 1VLZA 1AI5A 2CHEA 4NF2A 4OI1A 4I4TF 1EB8A 4U2EA 5BV0A 2ZYHA 4O1HA 4M1EA 3DHYA 1FMJA 3JD2A 2LXNA 2OXRA 4X8LA 3LBAA 4N41A 1W2BU 1LD3A 4B4WA 2VP5A 4G8JA 3HM9A 4NXNO 2PGJA 3FFAA 3TNFA 5DIFA 3G3EA 4QE3A 2WSSG 1P2GA 4JCCA 4XDGA 3SFZA 2PZGA 3T3OA 3C3KA 4UEOA 2W6JD 3E86A 1W0JD 1KY5A 1YS7A 3M1XA 2WM2A 2JBAB 4HZUB 2QN1A 2XGGA 3DFFA 5LZ7A 1RSZA 2VRZA 1RJDA 2YYYA 1Q7BA 4C3UA 1UUFA 3LQYA 2R48A 4X8AA 2P30A 1ROPA 1RQRA 3C6MA 3NEYA 4K2HA 4A8JB 5L45A 3A2FA 1EFLA 3LE8A 4OXRA 3T3MB 4HWTA 5CBPB 3DXRA 2AWNA 4JR2A 2IYQA 1DWQA 2X40A 2XUPA 3B7GA 2E2WA 3F7MA 4YN3A 1ORVA 4G85A 5IKOA 4D0NA 3AVYA 2ILTA 1U31A 1N6IA 5B7PA 2O5CA 1M2KA 5JFGA 1YVRA 3B3JA 1V5WA 5E38A 2H1CA 3FYHA 1I94O 3E4CA 4WZBE 2VDOB 1EESA 4DQXA 2AZTA 2PH7A 3JAKA 4B2LA 1GAEO 1KI9A 2Y93A 2QPLA 1QCCA 2Y1CA 2Y4OA 3FF4A 2IYRA 3QLJA 4LYFA 1YCIA 2XGMA 4V2UA 1DI0A 1DKRA 1H8HA 2CW4A 4MRVA 4U9UA 4G0XA 2YV2A 2KWIA 2B20A 5E79Z 2W71A 3G9QA 1GU1A 2ZM6O 3D54A 3NORA 1JJ2U 3VYTB 5JHGB 3PQ4A 3KU1A 1Z5WA 2E55A 5AI0A 3SS7X 5KNCA 3H1KH 1GTSA 5CEFA 4ZAXA 2I62A 4KQKA 1OCCC 2XAJA 2DOKA 2I76A 5AG2A 2G17A 2J85A 3N0VA 4Q7JB 2X2OA 3TLJA 4BAZA 2ZLBA 4XVUA 5HTOA 3WGJA 3DOEA 4JOSA 2Z9DA 4E09A 1WNTA 4E13A 1IYZA 1QV7A 2DC1A 2GBPA 2JK0A 2EJCA 4LJYA 1QUEA 1O6ZA 1S96A 1XXHA 2NXJA 1NPDA 2WZDA 4IGFA 4LE2A 4EW3A 5AM0A 5TEWA 5GP1A 3OR7C 4PHTA 1U11A 1JWBB 2DWOA 4N7JA 4V2IA 1HOTA 3LF1A 4CKCB 3WB0A 1EP3B 4A2QA 1BWQA 1NQVA 2DAPA 2KMLA 3AW8A 3PWSA 4KAJA 5E3JA 4N12A 2YOGA 3S2FA 1VSBA 2R5NA 4W7IA 2VNSA 1F4NA 2WTNA 1NATA 4YAUA 4MR8B 2Q6KA 2CC2A 3LXMA 1U7PA 3OTHA 4ZI7B 3L9WA 3QRWA 4UKDA 4Q9JA 3TOXA 4OHRA 1HI9A 4EF4A 2HRQA 4II2A 4DMGA 1FZQA 3FKQA 4MR7B 1SKQA 3L75H 3WB2A 1J9ZA 4YDQA 1BE3H 2D8AA 2F2TA 2V6FA 3PNVA 4D0RA 2XLCA 5H59A 4CG0A 4RTOA 5E95A 2WAAA 5BSRA 3RK0A 5F9HA 2PRSA 4JEHA 1FNNA 2ZJYA 2HK9A 3RKUA 4RGQA 3S4YA 3T3GA 5JMTA 4RPGA 1ILWA 1H5NA 1XJCA 3BDAA 3SBEA 5IYBO 1CEQA 1CG6A 1Z25A 1P8AA 2OWEA 1ZRHA 2YRWA 3ZOZA 2O1WA 3Q0EA 1Q1ZA 4R9SA 4W6QA 3TAUA 1APBA 2WSLA 4Z4QA 4QBKA 3PKIA 4RETA 3K8OE 3VX4A 2HK8A 1MH1A 1UBCA 1US8A 1LSSA 1VQOF 3ETHA 2I78A 3ZV5A 8ABPA 2A4MA 3OHPA 4ENVA 1YR2A 2JS3A 2PUSA 3U80A 5IKPA 2QRQA 4LW8A 1Q0RA 4HNTA 5KO2A 3NT2A 3K6SA 1BH2A 1ZGJA 1NASA 1YFLA 1NF3A 4YMWA 1BMFD 2PBZA 4FHDA 2C8VA 1C3OB 4KAAA 4RS4A 1EP9A 1FTSA 1XROA 2G77B 4J10A 1Z4KA 2PWAA 2R6AA 1YQ9A 3JQ6A 3KEGA 4HMOA 1KJQA 3ZWYA 5TC4A 2JGUA 4PICA 2EIMC 2Q5HA 3KC2A 3SQMA 3CLUC 3OZGA 3L7AA 4PBSA 3V8PA 1PZFA 3FCOA 3K0EA 4IKEA 2BBSA 1K5QA 4DHEA 3MOSA 3CCMV 1CT9A 2B36A 2PXHA 3NBFA 1JQEA 4R1SA 3IE1A 5KSOA 1SBHA 3F7YC 1FRQA 1R27A 3M3DA 4BZWA 4NXMO 2VDVE 2GHTA 3C1AA 2CTPA 2ZETA 2XF8A 3F3SA 1HQYE 3QELA 4PZCA 5TLSA 4I81A 2UUCO 4K1XA 4M55A 4CU5A 2XBUA 1E7MA 1HYGA 1T9HA 2IHYA 3DPIA 3T15A 2XCSB 4UOQA 1E7WA 2VK4A 1N0NA 4M54A 1G3MA 2RSLA 3IUMA 1CDZA 1YWGO 3KYDA 4BVRA 3WSWA 5DBHX 4BQRA 3V2IA 1RXVA 1U40A 2EIMB 1TRHA 4AIIA 4WFGA 2HQSC 1Q81H 1CQPA 4LRSB 5GONB 3GLHA 1DIGA 4QSHA 1GPJA 4B6RA 4BB5A 1KQSU 4JP3A 4DXHA 1BWRA 3B6MA 2HF9A 1SUSA 2QYSA 4H7DA 4NK4A 4NVRA 4PHGA 2GN0A 4ZI2A 2PO5A 4DNFA 1GZ4A 3GBPA 4BCDA 1V6SA 1MABB 4UCUA 1JVMA 3D6HA 4NNPA 3DQPA 4RE6A 4HDSB 4DUZO 1F8XA 4F5ZA 4YRGA 3GHHA 1ZCBA 3HXKA 4YHHB 1XE3A 4BGVA 3A3PA 3COWA 2RC6A 4Q00A 5DM2A 1MX9A 1CUXA 3W4IA 3RFRA 1GGHA 3H9QA 1M67A 4LFAO 1DJMA 3IX7A 1RI5A 2IU3A 1GZHB 4JI4O 3MMPA 3OO0A 2RHGB 3IAYA 3DE0X 5LUAA 3BCCH 1BXGA 2YMQA 3DUFA 3BJEA 4ZEMA 2QKAA 4X6UA 3WBJA 2F7SA 3HFSA 3ZGZA 4DIEA 1H6BA 4LRXA 4MVWA 4RPCA 5ARDA 1KP2A 3FSGA 4JELA 3ZQ6A 2OIGA 1J00A 5LQCA 4PFSA 2FPPB 4P3KA 6GPBA 3IAS6 4XQCA 1RRVA 5A9TA 2OUIA 2PQMA 2WWXA 3CEMA 3QXXA 1FQKA 3ML1A 4IO0A 5KHAA 4TVBA 1LRKA 4B2PA 2JLWA 3TJMA 3CC7V 3ZO8A 2NZJA 2HDWA 3PPXA 2OYCA 2BMAA 1KFKB 2O2GA 2VHJA 2WM3A 3EXFB 3UJNA 5DECA 1Q3TA 1Y80A 2VFAA 1NX9A 1GKUB 1H0RA 1O95D 5LMNB 5C4IA 3R5SA 5KC8A 3AERA 2YXZA 4URUR 2D2VA 1WP4A 3TW6A 1B43A 2ASVA 3PI6A 4HFJA 3DBRB 3MWDA 3ZG6A 3QU9A 4LS3A 3RUDA 4ANFA 1L0BA 2DKOA 2D0DA 3H5OA 1WU8A 3GYBA 3R3JA 1HYHA 3CXCU 2YINC 1Y1KE 4FXOA 1SHUX 2ERXA 1XDBA 4UHHA 4FMCB 5H1YA 1U3UA 1I08A 1CUJA 2WWIA 4HVCA 2Z3ZA 1AHPA 5HCUA 3WOVA 3CLRC 1HDCA 3R9WA 2PX4A 2QUHA 3OX2A 1KQGA 4DC9A 1D6SA 3N2KB 1KE2A 3MOIA 4FM1A 2HOQA 2PRIA 4CF6A 4TVSA 1CWUA 3ELCA 3G71F 1PZEA 2BGUA 2HRRA 2OD9A 2QE6A 3GLIB 3AERB 1C50A 1XZPA 3QJ5A 1J8DA 4HQFA 4J16A 5BYKA 1H38A 2WLKA 3AESA 2W90A 4QLOA 4YUVA 2FR8C 2KS6A 3AXSA 2B25A 3I9NA 2ZSEA 4ABTA 4E2WA 5CDSA 1NYRA 1CUYA 1ZU5A 4Z4CA 3SYCA 4FZ5A 1WD7A 2EDAA 4J7XA 3UKOA 2JI9A 3DR3A 4B2IA 4OLJA 1ZCFA 3ZX6A 4ENUA 2I4LA 1QBZA 3SC2A 4NCAA 3HC7A 4NOLA 4CS2A 2HLDG 2V9CA 2XKJE 3D4OA 1JEYB 1SIBE 1S7GA 4XYEA 3JSLA 1HE2A 1UKZA 5HIIA 1HNWB 1FYDA 1DCMA 1JZTA 2HO4A 3L3BA 5AOAA 5FBWB 3SF8B 5L3SA 4F7WA 3LL7A 1GPH1 3EMDA 3K2EA 1NTRA 1P7BA 1HDOA 3D6AA 2AI3A 4FT2A 2PLWA 1MXHA 1XEFA 2HUNA 4G23A 4MYSA 1B6QA 3ZE9A 3OOSA 4DPLA 1GH6A 3HU1A 3L8DA 2M1XA 4HC4A 2NW6A 2PD4A 4JVSB 4N6OA 1DT9A 1EZ4A 3G8AA 8GPBA 4H44B 1G0NA 1TFRA 1V4BA 3A4YA 3WK4A 3SR3A 2A9PA 1KNKA 3PDWA 1U1EA 4M9SA 4N8DA 2D6FA 4NZYA 3ABMC 1H4QA 1VQ5V 2GLXA 1VL1A 3ELUA 3BBPA 4E1AA 3GGJA 3SK0A 3P94A 3E8GA 1O4WA 2R65A 4JUDX 2VPYA 4N0MA 3RJMA 1J09A 1WF6A 3TS1A 4X3PA 3VNQA 3AK3A 5A4KA 3WRXC 4UTVA 3LS2A 3PXBA 1Y7PA 2J4CA 4FX5A 4WZBA 5IUNC 2DLDA 3H19A 4EI9A 2XDWA 3OQOA 5DNAA 2CXTA 1AD2A 4MCJA 1YHQV 3MQWA 1Q1NA 1DC6A 2OHOA 4XSVA 3T9EA 2H1OA 3A1UA 5CT8A 2QN9A 1R00A 1R0XA 2GO1A 1I5XA 3DOUA 4AZSA 4FE4A 2R1VA 3ZWKA 3T7TA 1ZOPA 1T9GR 5GONA 2EWVA 3GLHB 1L1FA 1GTVA 3CCUF 4OXKA 3TWOA 5BQXA 3KE9A 2ZYGA 1T9ZA 1L5QA 3RARA 3WK9A 3PU6A 5IARA 1SKUA 5IMSA 3LLVA 1E9FA 1YHZA 4KI7A 3SAJA 1WMEA 1HT2E 4WESB 1Y76B 5BUZA 2RH4A 3E6AA 2HO5A 1L1EA 2PMPA 3MFYA 2XNDD 3TTSA 3IQWA 1IHOA 3A14A 4ZCRA 1AT1A 3TOZA 1ZGAA 2PSSA 1R0BA 1LDMA 2CTQA 2IXFA 1F9AA 1OLUB 1NBME 4IX9A 2HXGA 3VI4B 3A0HZ 1HLDA 1W4BA 1WXEA 1G2QA 2C8JA 1KHTA 1ZTEA 1SIWA 3U0OA 3IBTA 4G0OA 3UJHA 4I7ZB 3DTNA 3DVAA 4Y0VA 3WMEA 4B3GA 2Y0PA 3C8ZA 5LB2A 4IIFA 6NULA 5FA8A 1HFEL 3ZGLA 5IWAO 1CF9A 4CFYA 4OJYA 4IEEA 4M0CA 4BNUA 1KUQA 1PS0A 4RJJA 4KFCA 3DAHA 2UYQA 2WILA 3UJ6A 5K4HA 4JUBA 1NIPA 2YFKA 2JLXA 1SD2A 2N9UA 1YK0A 4XA8A 3QUSA 2CE2X 2WP8J 3AEQA 4R7CA 3HDYA 4RAQA 5JMPA 2PV7A 4QIWF 1C9EA 5IAEA 3K6SB 1EQAA 2MSCB 2PL5A 4AYWA 3FX7A 2HNKA 3DL2A 4N65A 1BS3A 1F4VA 2Q9BA 1Y5MA 1OLSA 3M70A 1AGXA 4DV6O 1VL6A 2JGIA 2ZT6A 4UQOA 4UHKA 1E1CA 3FETA 5DNCA 4I9UA 3T4PA 4OH7A 4DV1O 3IEQA 1FNDA 3P2YA 3HXOA 2DWDC 1J5EB 1HE5A 4BKOA 1MNQA 4PA7A 2XHZA 4TQGA 3I64A 1FTNA 1J7JA 2OCKA 3LY7A 4HPJB 4NU6A 1U3FA 4PQRA 3L6BA 4QG7A 1UH5A 4M0MA 3WKDA 1VHDA 5DBFA 2CLIB 3CRRA 5I5EA 2GN1A 3ESXA 3QHAA 4LDNA 1Q7TA 3BG5A 4NR0A 4ZIRA 4MICA 3OZUA 4N03A 1V41E 3GDGA 3VMMA 3L0BA 4F6RB 4LHWA 4V0SA 4AXXA 2HJVA 2WUWE 1X9IA 2XA2A 4FK8A 4JJ8A 4BMCA 2EP5A 4MS1A 5CW2A 4AI8A 2ZREA 3TBKA 3QPWA 4U5QA 3IQDB 4ZVSA 2W42A 1VG0B 4FGJA 4ZDKA 2QB5A 1TKBA 3IOMA 4ZGBA 5IXSA 3D8CA 1H4SA 3LSYA 1SQ5A 1TD1A 1YQQA 3VCZA 4TTVA 4CQMA 5BNTA 2X86A 3N7UA 1XN1A 3G0BA 3OA0A 4FOSA 3SCZA 5BUSA 3WL7A 2O6LA 3CEAA 3GELA 1W34A 3JQEA 1TB4A 4TLMB 3ZV6A 1X74A 2M6SA 1SQ0A 1E4VA 3EFOB 4FT4A 5AKIA 1R6NA 2BONA 4HJXA 4LXHA 4BUCA 3B8HA 5JJEB 1KQFA 5DX0A 1YB7A 5DSTA 1CY6A 1GY8A 1ZNYA 1OXMA 2OGWA 3E5NA 4HFNA 1N36O 4FHEA 2SICE 3SSOA 4BIOA 3PNOA 4PAWA 2B34A 3M9XA 4M0PA 2ETNA 4UVHA 2GJ9A 3TDKA 4C0AC 2XVMA 5K3OA 1NJ5A 3AL2A 3B85A 1PXWA 1NAHA 3ZZ1A 1UZLA 3DG9A 1EX6A 4FSXA 2YW2A 6AT1A 1OH8A 1Q1GA 2VWGA 4BZZA 4TKVA 1LJLA 1DUSA 4QDXA 4UTXA 5IVIA 5KREA 3ZDBA 1VQ4F 1VRVA 3EIXA 4EY3A 3KIZA 3E83A 2BGTA 2ONZA 4Q6WA 3UJCA 1XC7A 2GN4A 2YVLA 3KXDA 3D81A 4OEHA 2BMJA 2FLVA 4D43A 1C0KA 2NSDA 4PV7A 3W3AD 3CB4A 1O4VA 4YAOA 5SYMA 3ZZ0A 2EF1A 2QU7A 3KEOA 4Z0HO 3NC0C 1E1YA 1FUKA 4HTFA 1FJHA 4UHEA 2GPWA 3WNCA 1QSGA 3K59A 2YVKA 2JH3A 1D1TA 3H42B 4WCEV 1NJ6A 5I7HA 5KHGA 1PV1A 4AU1A 2YKGA 3VNRA 3LFUA 1C2YA 3PQ3A 4YB8A 2J7KA 4NK5A 3LFHA 4BASA 5K6AC 3JZIA 3NANA 3S1SA 1NR7A 3MDOA 1CNFA 3DC7A 3KPYA 4TT8A 1B42A 3T7JA 5CG1A 2JBAA 4GWKA 2GSMB 1RWMA 3LCCA 1UAYA 3NGXA 4QTUB 4XJTA 3W5DA 1JG4A 2QRLA 4M2LA 5KWVA 1ZESA 1S7CA 2R11A 1GN2A 3B1KA 4RZQA 4ZK2A 2JC3A 4DWVA 4X3CA 5FT9A 2QOEA 1MRSA 1WDKA 4UMDA 1U3GA 1M7HA 3M4SA 1IBLO 4G8DA 3R7LA 4OOFA 1M56C 1NV9A 3AT1A 1QH0A 3F7VC 1QHHB 1NX6A 1Q7RA 2VEDA 3AU8A 2J6IA 4WKPA 4KFMA 5KA6A 4J4TA 4E94A 1PGNA 3SZRA 5I9SA 2VHWA 3ZY3A 2CYCA 2OHHA 4BNVA 4XPZA 4X45A 3KKKA 5IFLA 2ECFA 5HXZA 3GNQA 2FAXA 1F4MA 1RXIA 1Y1TA 2IV2X 3FOEC 2FSPA 3AUJB 2RGUA 1QF7A 1R4AA 5FP0A 5B4VA 3ND8A 5AUNB 5EIEA 3GGDA 1WUKS 2CJXA 4S0XA 2O8EA 4FC7A 4DSAA 1G21A 4FI3C 4IDQA 4QGGA 1Z8HA 1G5HA 2WKRA 4KGVA 5DWVA 1TK3A 3TPFA 1RC8A 1P29A 2PSFA 3SQXA 4KO4S 2VLBA 4M8LA 4A26A 1BGWA 1X1QA 2Q4EA 3OESA 5JTTA 3IRUA 2A9JA 4KRXA 3BRCA 4Y6QA 2O7RA 5CYOA 1V5EA 2AXNA 1L8XA 5T4HA 4AKTA 5U4XA 2B30A 4J07A 3E35A 1VCOA 3CNNA 3NHJA 4PW0A 5JOQA 3LDCA 1S8OA 2BUAA 3G2NA 2XMPA 3GVIA 5G40A 2I2BA 3U7EB 2IEIA 1E9VA 2Q9UA 1XV2A 1OASA 1DOZA 5C46F 1IB0A 3FUVA 1L7XA 1BDBA 1K5SA 3L0DA 1Q44A 3QF4B 3S6JA 4BIIA 5CX1A 1YBMA 5CH5A 3NEPX 5EIAA 4FLTA 2IE8A 5F1PA 1FIUA 1Q1QA 1NT2A 3KAJA 3MN1A 1ZXLA 2FUEA 5DNDA 2HB6A 5AMXA 3IUNA 4M46A 1D7AA 2ACWA 4M88A 4FNGA 5C2JB 1XK6A 4R3NA 3UAZA 2J0UB 2Q4TA 4DZTA 1N57A 1GHTA 2QJOA 4URZR 2DFKB 1U81A 2CUKA 3QY0A 3RV3A 1LDBA 4GYYA 4FJCC 4QXPA 1PL6A 4QEKA 2P4QA 3R41A 1ZLXA 1KVRA 1T4MA 5B66Z 1RPAA 1T5SA 2H18A 2CWWA 2HMUA 2Q67A 1N2OA 2J3IA 4QODA 3CCUV 1XWWA 3EQ2A 3ZBPA 1FBTA 2R2GA 5DRTA 3L1HA 4BVHA 4MA5A 3UZUA 4W4KA 5KOYA 2OZBA 4LZZA 3RK4A 1D2AA 5G3ZA 1T8TA 1H2KA 4NDNE 4HHEA 3VPDA 3SQNA 3BJZA 2VAPA 3S2ZA 4ZN6A 4DR1B 2XOXA 4HGNA 4B46A 4FZVA 2J3QA 4NQZA 4X63A 3GNLA 2MMGA 2ZP1A 1E1QA 4IKOA 4DR2B 3RFTA 4LHSA 4DLAA 5INTA 3CC2F 1B3RA 4UREA 1Q0QA 5TMDA 3QO8A 4PDVA 2P90A 1BX1A 3BEDA 1SVNA 1QUFA 2IV3A 4FK5C 2C2XA 4ZOLB 1FXSA 1MJGM 2EILC 5CM2Z 4DM3A 1AN0A 8LDHA 5JNWA 1ZHOA 4KFTA 1O9BA 2ZTHA 3RYTC 3HYRA 3IO5A 4LF5O 3O47A 2CH7A 3PFNA 1GQYA 4CZ2A 3KZNA 2JHPA 5ESRA 3THYA 2C5HA 1GM7A 1XAJA 3R0QA 4A16A 4WNIA 5ALEA 5DBIA 3E0XA 3HJGA 2DTEA 2OFFA 1X7PA 3FUCA 3L7NA 4WBXC 1YR9A 3ZV3A 4C87A 1CR0A 3ZDFA 1BMFG 4I0XA 1V6CA 3Q0IA 2W70A 1A4IA 1U1GA 3ZV4A 4EB8A 3OZAA 4QG3A 4CL0A 4D8XA 4GYWA 3LPDA 2HMTA 3LHDA 2P9CA 3GMIA 4GKKB 3L18A 3RSCA 4A03A 3O0TA 5LA6F 2D4AA 5TJHA 4LF4O 4KDRA 1PDWA 3B38A 2XB9A 1T2VA 2B8NA 3CF0A 1G3QA 8MHTA 3I56F 2OV8A 3KM0A 3N5KA 2OP0A 3WLJA 2XT9A 3JQFC 4N7MA 3W5CA 2QSAA 4YRSA 4JI1B 2JI6A 4WZAB 1TU3A 1K08A 4OJNA 1PUJA 5D3MB 1QAHA 1YZKA 3H86A 4OYHA 4TV8B 4MS3A 1QPBA 4D9JA 3SP1A 4MMYB 3A1NA 3RAJA 2MYUA 3LZDA 1GPDG 5J5CA 1NVPD 2P5SA 4BU0A 2W2LA 1NVDA 1DRKA 5B1HA 1N2JA 1WW8A 5TGTA 2R6ZA 3GJTA 4F46A 4C4YA 4YJ2B 1WDLA 4BO6A 3SHFA 3Q8WA 4DBLC 4FZ0A 4FJ1A 1KR5A 4R5MA 3A6EA 3TG2A 1QMPA 4O2BA 1OCCB 2K1SA 4NYJQ 3UAXA 3ZWDA 4DZZA 5JVDA 2HA6A 3MHHC 2ETVA 1U0JA 2W6NA 5JXIA 2ZKOA 2W0XA 2BFBA 2WYUA 4FINA 4DLNA 4UW9A 5LKAA 2AJ8A 1BC5A 4MV0A 3ZEAA 5CLGA 1W0KD 1AGRA 3VU3A 4C89A 4UCOA 4RQBA 2QMQA 3EDYA 2CKDA 2BFNA 3OD5A 3SE7A 4PELA 2NZYA 4BZPA 2O2CA 1K8AH 2ONYA 6Q21A 4G01B 3HR0A 4EKEA 3F97A 4QUJA 3V7EA 2G07A 2PX6A 5H3CA 1DAHA 4KO3S 4C21A 4FONA 1CXZB 2VS0A 4YJ2A 1Y4ZA 3K35A 4JU9A 5AHWA 4BQOA 4QPCA 3LQ1A 5P21A 2WSSA 4D5EA 2JJ2D 3ZTTA 1HKUA 3V42A 3TJTA 1W94A 1GRJA 1AF4A 1ZUIA 1ZIDA 3DVRX 2YJZA 4L8LA 4OHCA 2ZPUA 1CS0A 3LY8A 4RKEA 2YBEA 1JNXX 2VXCA 4DV7B 1COWG 3DVQX 4HGRA 521PA 3CGGA 3HCRA 4AJOA 1I4WA 3I1IA 2HSJA 1DEAA 2Q8QA 1GUAA 2IEAA 5D51S 3UT5A 2WVGA 4IJ5A 3U10A 1YJ8A 4CWAA 3GX1A 1POXA 7ADHA 4CW7A 1JJ2F 3LY9A 4QDJA 3ZH2A 5EYPA 3NVKE 4JYMA 3QX3A 4C76A 5GADl 3LKDA 3GV0A 3VPFA 3P5BA 1IK6A 2B3TA 2OYSA 4DLUA 1L5LA 1L5OA 4PYNA 5LLTA 4CPDA 1DV1A 2RJ3A 3JASB 2ORVA 1B3BA 5BWMA 1RACA 3PG5A 1RYFA 3OMNB 4Q5IA 5M34A 1PL8A 1K3TA 1VSUA 4FFPA 4J4BA 4K6OA 4U2KA 1AMUA 3UO3A 1OZAA 2E9SA 5JZBA 1E5XA 1OXUA 1V8PA 5JECA 2GD2A 3SPJA 3NZEA 1QX3A 2QVGA 5BSFA 3VKHA 1LDEA 3Q5GA 3QMPA 3WK7A 2ZS8A 2WLTA 3JWIA 4MP3A 3SU8A 1H5UA 3EIQA 4JI7O 4YP5A 4B7EA 3DPUA 3IMFA 3Q12A 4Y7CA 4A0HA 4YAGA 1AKTA 1Q19A 1P0CA 1N7HA 5BW8A 5LBUA 3HV0A 2HRBA 1AJNA 1Y8QB 4RA9A 2PFGA 1HSOA 3FPEA 3IVRA 5EKDA 4AUNA 1HYQA 4EY5A 4YV1A 5TISZ 1JSCA 2IF2A 5IBRA 4UASA 2HPZA 1RPOA 4NESA 3SOPA 3FBGA 4K6MA 4OAOA 4IG4A 1CY2A 5ISMA 2NVUA 4P3PA 3COJA 3NTXA 1SHLA 4ZAYA 2R79A 2FKAA 2CVOA 3M89A 1YRLA 5EUBA 1EFTA 1FEZA 3SHTA 3VZCA 1BMTA 3PR1A 1TQ6A 4YS6A 1M2OA 2Q3LA 4BNGA 7YASA 1WSBA 4DIKA 3GVPA 3TXAA 2F9MA 1SZJG 1DOHA 1I14A 3CVJA 3B53X 1OJ7A 5A3JA 1A8HA 2J46A 5TMBA 2DVMA 4CBVA 2G6BA 3TXYA 3FGPA 1MB0A 3S0WA 2JD1A 1IMOA 1T5OA 3AFGA 1V1MA 2L2QA 3LXRA 2JGMA 3COSA 3LUKA 3NOXA 4PA4A 5GZ3A 5JYCA 4J75A 3MB5A 4CF3A 2PSDA 4KQMA 3SMQA 4DEVA 2IV7A 3AUFA 4QOFA 3V32A 4XCXA 1SRYA 1K73H 3TPCA 3L7LA 4Y1RA 1Q3KA 4ED9A 4F97A 3NRJA 2BP7A 3TLYA 5G4VC 3QYFA 4PSUA 2C7QA 4ZVUA 3T80A 3DJYA 4A5OA 2IVFA 2IFTA 1CQIB 2F1KA 2WB4A 4QWWA 1S3IA 5DHPA 3VOBA 4Y2PA 1RW4A 2NZUG 3VR5A 1H23A 4EYOA 4DLXA 2Z5UA 5DI3A 3ZDQA 5K09A 3L1JA 4YJ2F 4RLSA 3GT0A 3G6EF 2P69A 4AS2A 3WL4A 4BLVA 3QEAZ 3LCMA 3AUUA 3OFSA 2EW8A 4DLZA 1OD6A 3T95A 3VR3D 2IDMA 3IURA 2YVQA 3EORA 3RRYA 3MTBA 2RB9A 4UHDA 3CUTA 5EJ7A 3WV4A 2PJRA 2AD5A 2O23A 3FWZA 3UAYA 2EGGA 3IDQA 3PUXA 4Y30A 1X87A 4QJIA 4UFPA 4JHXA 4FR0A 1ZN8A 1WZNA 2AXTZ 1Z6XA 2QP9X 4X1KA 3FTCA 3LOPA 1U2GC 3OJLA 1JHDA 5DBGA 3WFJA 3WNVA 5A4MS 2CXXA 1YHQF 2WUVA 4Q34A 2X0LA 4Y2VA 3CX6A 1X7WB 3WLMA 5IABA 4UCVA 4I5DA 5LFAA 4U02A 3LUFA 1TM5E 2OM2A 2YNMA 3Q0TA 3VYWA 4LVUA 1N2CE 1T1JA 5J43A 1MRNA 3NHBA 4H17A 4JXKA 3SIPA 4B6JA 1VGRA 1T0PA 4HNVA 4MW7A 1C3XA 1W47A 4Z8XA 2TSYB 2CHFA 3VVCA 2PBFA 4AJPA 4HYEA 1SCNE 3PPVA 2WF6A 2GZ1A 4J2TA 4WXMA 2HSZA 2VH2A 1AQUA 2Y99A 3H5VA 1A2QA 4OHVA 1EFAA 1JR3E 1TKRA 2XUAA 4OQYA 2Q1UA 3O8NA 3CZQA 4ILEA 4CIAA 4RTPA 2AVNA 4LJAA 3PNQA 2JLVA 3UMCA 5EIXA 1MTZA 1F60A 2BRUC 2IEDA 2PVPA 1P18A 3B1WA 3WLHA 3PJDA 2XD9A 4JEMA 2C78A 2J5KA 5GV7A 2OYRA 1CJTC 3IA7A 3EAQA 3CWQA 4KFSA 4OJMX 1KL7A 3VU8A 3BCHA 1HNNA 2RB5A 2AQ8A 4O59O 4MW6A 3PXEA 4MINA 1P9OA 2Q0XA 1VECA 3GFOA 2FPKA 1AXEA 3DMRA 1WQ4A 4FFRA 4HLUA 2OSVA 2RHHA 5LZ8A 5ED4A 2IXAA 1P84F 1C30B 2X13A 2LCQA 3A05A 4OX9B 1YH3A 4BBPA 2YWHA 4OSOA 2GEJA 2OEPA 5AFSA 1W85A 2ZBEA 1N92A 4DCTA 1NLFA 1NVPB 2BBTA 4FD2A 4GRIA 3CD6F 3KVYA 3V9PA 3AHEA 3RC7A 5KTOA 4LQDA 1G2PA 1U2QA 3AI2A 5D3QA 4C5AA 5HM8A 4LWZA 1R6XA 4HNRA 3LBIA 5PNTA 2QAIA 3PC6A 3DXXA 2FN4A 4IIGA 1IQRA 1N34O 3BMOA 2ZTSA 3EK2A 3N8DA 3NQ41 4NUTA 3OLVA 4GPEA 3A2NA 3L82B 3QVXA 4KLRA 4XGKA 1Z4NA 1U6JA 5I8ZA 5EUMA 2HJGA 4K2AA 3IJRA 2OBBA 2OCGA 4NI5A 3SYQA 4DQLA 4OQMA 2FP4B 1KU6A 3PHHA 5CBHA 2VQFO 3BYQA 3QTYA 1R7RA 2I29A 2HYDA 2ZDQA 3LW8A 3GGOA 3PP8A 1FVXA 3QVJA 4KJXA 4JI3O 4NAHA 4NJMA 1X8JA 2QUIA 3IKJA 3ZLJA 2KW5A 2P1ZA 1ESMA 3D7RA 4AIRA 2VDLB 3G2OA 1W6UA 1K5HA 5AVTA 4C7JA 1QDLB 2W58A 1NC1A 1TC1A 3HXLA 4U7TB 3GFGA 5ANRB 3HJFA 3FPGA 5HBRA 3EC1A 3H8WA 4UU8A 4EF6A 3FWKA 2GFHA 1DO8A 1KDPA 2CKMA 2ZAMA 4PQEA 4R9VA 121PA 2ZVJA 2FN9A 1U6IA 1Y4MA 1USUA 1CETA 2WD7B 3WYGA 4M3NA 1K7YA 4BT6A 4GVXA 5E1MA 3A1WA 5D2CA 3EF0A 4CMAA 1NS1A 3ITEA 4RC9A 1RIFA 1FXHA 1VIYA 5TPWB 3LQ2A 4E07A 2P5UA 1JIIA 3JARB 2QLMA 4RK1A 3B6ZA 6REQB 4TTTS 4LQLA 3GUHA 5ULLA 1L8OA 5BW5A 2P62A 2EJRA 1CVLA 1T8PA 1X14A 5M5BA 2DT8A 3GARA 3NHMA 2HT1A 4R0NA 1RZUA 1XSEA 2P41A 3F6SA 4OQZA 1BJTA 1J42A 2OTCA 3KX2A 4OMDA 1Z2EA 2AW5A 1JU3A 4ZT7A 3VYUC 4CM5A 3RROA 5C1BA 4LTMA 4V24A 2YY6A 3LCUA 3MQ2A 4J76A 3VAAA 2D5LA 3GJ8A 4B7AA 3HMQA 4H7HA 5AI4A 1I4TD 1O58A 5JJKA 1Z4PX 5LXTA 4EPVA 4OIMA 2MSKA 1LLDA 2Q7EA 5LP6C 1GL7A 4F3TA 3TBHA 1Q57A 1D2CA 2ZBGA 3U40A 1EFDN 3WIUA 4AY4A 4AJKA 5B3JC 5KDDA 2EEZA 5KHLB 3OURA 2X9NA 3WOHA 3EHDA 4EJ6A 4QVGA 4PNEA 1KYQA 2QK4A 2C9YA 1C8KA 3AEQB 4EHJA 1W7AA 4FQ7A 5H6RA 3DMDA 5JJCA 3CCFA 2J08A 1RP1A 4TMXA 3OEHG 3V3KA 1FSGA 4O2RA 1P7YA 4K9DA 4Q3KA 5I7UA 5KYGA 3E9NA 3N6VA 4KDEA 4OGGA 5GIPE 3FTFA 4Z4IA 1I6MA 4Q7KA 1YTFB 1H4TA 3ZHXA 4CQNA 2C0CA 1H7MA 3LX4A 2B82A 4CCYB 4EQZA 4LCJA 3K3PA 3NYRA 4LV5B 3SE0A 2CSXA 3BIJA 5EG5A 1QFYA 5CB4B 2BCEA 3O83A 4E14A 7ABPA 4B09A 4X7PA 4OVKA 1KO5A 4F4JA 2AI1A 2WJYA 1VGVA 2DR3A 4Q19A 4OK6A 3MGGA 4UHCA 2F66C 4X6LA 5GY7A 3V1LA 4KR2A 4EH1A 2G1AA 1BMDA 2QP3A 2Y05A 1IATA 1A1VA 2IODA 1UWKA 3IOEA 2WD9A 2WJ3A 2HC9A 2XR1A 4OBBA 5HF6A 1AA9A 1F2UA 1RI1A 4AG3A 1ZK1A 2QWXA 2VNJA 2Q9LA 3OIWA 3W04A 4ZZ1A 2I5PO 2QXUA 4H31A 3DGFC 4RELA 3RBVA 2WZQA 1PZHA 2VRNA 4MGHA 4YRRA 3QPDA 3OT4A 2CMKA 3BJMA 3NIWA 4KX3A 4KQGA 4AC9A 1VJCA 1UEXC 2YMPA 4JD5A 5LBTA 1B6SA 2G8NA 3SYRA 5IT5A 3EGCA 4BQSA 2KTVA 1MAHA 2D06A 3OPYB 4GSLA 4Q3BA 3U48A 2V4DA 2PQ0A 1V47A 3U7IA 1EXMA 3FW1A 4QDUA 4DLBA 3TD9A 4MT8A 2GK3A 4YBRA 4FLMA 2IH3C 1K6IA 4LXGA 1Q20A 3HLTA 3O2SB 3M5WA 3BY6A 1R6KA 4BGIA 2QAGB 1WSWA 2X5KO 3AKYA 3H84A 3WYAA 4TS4A 1YJ9V 5CDTA 2J8ZA 3DE5X 1UP7A 1ZSVA 2FW8A 3IDSA 1ZS9A 5FPRA 3PGMA 4JBHA 4OHMA 1JIUA 3FTDA 5J4KA 1EJ6A 1RPJA 3IUYA 5LNK1 2VDWB 3ZTWA 2PZFA 4OA8A 5F2OA 4UBNA 1R3JC 3E9MA 4CC5A 5IY5C 2NUTB 2P6OA 2IC5A 3B82A 3BMXA 4LVCA 5KSWB 1V55B 3OTOB 2BZ0A 2H1VA 3AEKB 3JSXA 4MRRA 1XL1A 4OHBA 4TQFA 3GLFE 3CKKA 3RS4A 3PE3A 1FVOA 1YDMA 4JPRA 3STTA 3CB2A 3QENA 4B8YA 3M7MX 1W25A 5DCUA 3T7IA 3R3VA 5K0FA 3MGAA 2WMDA 3K09A 1GUZA 3MJTA 2D3WA 4JWKA 4QAJA 1N5MA 1JAXA 3DNFA 3FZNA 3HDQA 1SH7A 4H7KA 3DLCA 3SS8A 3ZWOA 4B6OA 4F6CA 2AXPA 4Y8VA 4DBLE 1FLNA 1KO1A 4FW8A 1ZH6A 1D9ZA 1BHQ1 3Q4HA 1WMSA 3C24A 3EARA 3F7OA 3AP2A 3GBVA 4FTWA 4LI0A 2V7QG 3GVMA 1H0KA 4P7FA 4R2JA 4MHTA 1KNQA 2GYYA 5KNDH 3UTCA 1Z0IA 1M72A 1V3UA 1SEPA 5I01A 3I42A 4EKIA 1JHYA 4BMVA 4J2HA 3TZHA 4LHVA 1VQNF 1NJ8A 2G06A 3CZMA 1XDCA 2QVCA 4BKQA 1PJLA 3JQ7B 4M8SA 5K2OA 3PXUA 3RTGA 5KOHB 5E2BA 1BHBA 2YHAA 1L7QA 3L4BC 5EERA 1SCUB 3VDMA 2FWPA 4DM7A 5EXDA 5K3EA 3C3MA 1KXJA 4OB6A 1W1UA 1ODCA 3KV3O 1NW4A 1CK2A 4G4JA 5KWSA 1OW3B 1X25A 2KLHA 2X9VA 4WECA 3EYAA 3OU7A 1NXOA 1YO6A 4F4CA 5HR5A 3VSDA 4TZZA 3WQRA 2GNPA 4IQFA 4Q3EA 4TTRA 1GKLA 2BH2A 4BU1A 1VIDA 3HBNA 4MGZR 1OV9A 4D96A 3T7CA 3RYHA 1RPRA 3JQCA 1X7YB 1IJKA 3CCVV 1IEVA 1EA5A 2AZXA 1JHZA 2AYYA 2LV8A 2A9VA 2DPGA 3KLPX 4KL1A 1J21A 4BNZA 1E5TA 3VPCA 3FB8C 3QKSB 5C51B 2PKCA 3RFVA 3ASOB 1JX6A 1KJNA 4YMLA 4CBCA 3IVXA 3WDMA 4KK4A 5ICSA 3AJ8A 4JJGA 5H3LA 5L40A 2CUGA 2WJHA 4JLDA 5EMJA 2IUUA 3RU2A 4YC7A 5EXTA 3NS7A 3VO9A 1DQZA 4QOIA 4EPWA 5BWNA 4ZYZA 2G0TA 2G5GX 3O4GA 4F4LA 2IYYA 3AC0A 5CR9A 1KVSA 1XLTC 3GGGA 3QWHA 3TUIC 1Z37A 3K3WA 4K6FA 1YKSA 4UVBA 4MWBA 3KPJA 4YT2A 4O63O 3SMVA 4BATA 1IBSA 2D0OB 1SHKA 1NUQA 1X1DA 1PVVA 2OGTA 2PMCA 1Y3DE 2ADQB 4TXMA 2W43A 1HM5A 3K1AB 2FTKE 2JFXA 3D8RA 3PNYA 2JA2A 3T7KA 2CSLA 1OJLA 2YIBA 4PI0A 1EVJA 1TA0A 2V7QA 3KR1A 3NGMA 1OUMA 4TXJA 3JW8A 1TVKB 4XUCA 1NKTA 3LUBA 1O0CA 1Y67A 1M34B 4B3MO 1I5EA 3M9WA 3JATB 4M0LA 1ZL0A 5CHEA 1HF3A 4AY3A 4LZLA 4CQLA 4EY8A 3U4HA 2C2AA 2HQOA 5C81A 1M6WA 1C0PA 2ES4A 2HSDA 3OC0A 4JA2A 1GCIA 2JIRA 3QMWA 1I5YA 2IZOA 4A27A 4ETMA 1URFA 5TPWA 4JI0B 4CT4B 2PMWB 4KNWA 4CIYA 4JOQA 2JF0A 1ZUHA 4RY9A 2DQZA 4O4HB 5HKLA 3W9BA 3HJAA 2OV2A 4CLXA 1YULA 5D1NA 3LYBA 2CLFB 4HMPA 3LVFO 1OC2A 4XR4A 2DJ5A 3FWHA 1OLOA 3RFCA 2NNLD 3D5EA 2X8LA 1KD1H 3INRA 3BTVA 5AVZA 1YOBA 4QBGB 1SU8A 3G5AA 1UI9A 4WAUA 3UAWA 3KFLA 2FEKA 1W0JA 3UBTA 5I9IA 4I50B 1CLEA 1N2CA 2Z2XA 4MVJI 2X8AA 3L2OB 5KU7A 3AVXA 1WDMA 4EOGA 2AR0A 4LBWA 4P58A 4P53A 5ALLA 5K0TA 1KU9A 1TQ4A 4E33A 1O5OA 3HCEA 4D02A 2FEOA 4FLUA 3W5BA 5B5SA 5BVHA 5HIAA 2OK8A 1W5BA 4OU5A 1TPZA 1NMQA 1CYDA 2PDAA 1U3PA 5UKDA 1RCUA 1PT7A 2QX4A 4UXHA 1N9GB 2ID8A 4MA4A 4KB5A 4Z54A 5AK6A 4D74A 1G3UA 2BFPA 1MGPA 5G4UC 1PSWA 3IP6A 5DULA 3CVWA 2E5LB 4JJIA 5GOZA 2ZULA 4RDCA 3UC9A 2EJVA 2XDQB 4PANA 4FPPA 3IUEA 1I0HA 2CDBA 1QWOA 3IUPA 2MSWA 3RVRA 4X8MA 3R5HA 3VHLB 5SZHB 4B48A 2Q62A 5ELXA 4GWGA 3HYTA 5C32A 4OPAA 4ZRNA 5IJWA 3ZDEA 3OE7A 1WBDA 2ZVZA 1KRXA 1D1SA 1Y8RB 1W4RA 2JEZA 2P1DA 4GYKA 3EOZA 4JC8A 4TMFA 1N0IA 2I3ZA 1QCEA 1K34A 1E3QA 3TFQA 3B5JA 5ESWA 3TQRA 4H7PA 2G28A 4GRDA 4JZGA 2XECA 2YNMC 1N8RH 1ESNA 2Z4SA 4LI3X 2WP0A 2ZSJA 4O2AF 4B6EA 3TJZA 4JXJA 4S05A 2XTMA 3UG6A 5K8UA 1Z35A 1GGFA 2FPRA 2FDXA 4IKPA 3K71B 1NW7A 3F0TA 3RYIA 2VCYA 5F21A 2H9AA 3E5RA 2XCIA 2ZUFA 2ZE7A 4EFBA 4WBSA 1M5UA 2DWCA 1R4NA 4HEA1 3CKMA 3AIKA 2YWXA 3ASZA 3C3AA 2ZIGA 4S2EA 3TL3A 4C1NA 1F2DA 2VAWA 1EFVB 4FLWA 4I9HA 4IS3A 2H1LA 2BTUA 2C07A 4G4YA 2XB4A 2P4KA 1M5RA 1E58A 3ESYA 2LFSA 4L8VA 3LX5A 4QU9A 4YJGA 3ADOA 1SQQH 2PT5A 5HDQA 3WSTA 1JPVA 2HPAA 3L7KA 1T5LA 2WB2A 1JAIA 1NNLA 1UWVA 3PC7A 1RJFA 3EW9A 1WQ1R 3AJ9A 3GWGA 1XNRB 3FPSA 1JH8A 3ITKA 2HPVA 3UW3A 4E30A 3PTLA 3EVFA 4RF2A 1ZW6A 3WDLA 5LJIA 1JQ0A 3A2LA 1EFRD 2HKOA 4TXLA 5DYNA 5HCNA 4KQIA 1U0NA 1PE0A 3WDKA 1QS0A 3DOJA 4BEJA 3LQKA 2G80A 2P06A 1JQJC 2QM0A 3PVZA 1N9KA 4HH0A 4X84A 1JSXA 1KC8H 1CR6A 3H99A 3KDAA 4H3HB 1SC5B 1R1DA 2D2EA 5DP1A 3SZLA 6CHYA 3RWOA 2BCCH 1IV1A 4QRHA 3V4PB 2XXJA 2A1UB 1VQOV 2X5JO 1Y42X 3GUUA 4L5AA 5A7GA 3E8SA 1MQ8B 2XWSA 3WJRA 2HXSA 3EQ7A 3MT0A 4I08A 3UFXB 2IU4A 1SVIA 5T7BA 2NLOA 1PJ2A 1E1RD 1PJSA 1V26A 2IX9A 3FY4A 4HH4A 1U5AA 4RLQA 1GAWA 3B36A 2QRGA 1R3IC 3G6WA 3Q2IA 4TMTA 4MVMA 4V1CB 5FTNA 2QNIA 3DW3X 3I30X 3PHLA 2GESA 3EZ9A 3WPWA 2ZIWB 3MCTA 4DLYA 4M86A 2YYAA 5DEDA 3WLEA 2LFRA 1W57A 5U4QA 3R23A 4QU0A 3VR3A 1KOGA 1IY0A 3G2JA 5KSZA 5KYTA 3R0XA 1JFSA 2TMKA 3O84A 3OH8A 1P1CA 1Z7BA 3HYSA 3K9LA 2J4DA 1ODKA 3LUAA 3TI7A 1GNQA 2P2YA 4R4JA 3UCEA 2BHSA 5C8DA 2KSQA 1KC3A 2IBSA 3H1PA 2VF4X 3QEMB 4KPEC 2FDCA 3K08A 1CRWG 2VBCA 4E5VA 2C3OA 4X66B 1R4ZA 4JI2O 4P54A 3ELBA 3NM5A 2YWFA 2CXUA 2BWJA 2ZD9A 2AEFA 2J3HA 3F8TA 3NWBA 1VBMA 5ICGA 1SELA 1H05A 4Q1FA 5KHIA 1G21E 1COWA 1TTTA 3TSYA 4WN3A 1JDNA 1TJPB 1XZJA 1D2MA 2BW0A 1MQAA 4TV9B 1Z62A 5E2IA 3C4VA 2VDUE 4U3JA 3C9TA 1XCMA 4OPMA 4PJ0Z 4RD3A 4UE2A 3LSQA 3MGCA 3AY3A 4ICIA 1WOYA 3RGGA 4PM4A 3G2LA 1M56B 3BH0A 3QEMA 2IGBA 3ABLB 3OE5A 4KJZA 5DEOA 3TCNA 3O95A 4ER5A 2PF4E 4P82A 4W6ZA 4LSZA 3EXEA 1R4MB 4EP1A 2YHIB 3FYUA 3NUQA 4OHPA 3W8NA 2RGBA 1M76A 1Y48E 5B1AB 3OIYA 4N48A 4OG2A 3HTNA 2GWRA 2QE7D 4Q24A 3BL8A 4UQLA 2GA8A 3RVLA 5LR6A 1RM4A 4OOEA 1E5VA 1KAHA 3BXGA 4ZQFA 1LW6E 3J7TA 3REQB 4LVOA 5HEKA 3JWPA 4DBVO 2A0KA 3M6WA 1MHTA 2J0QA 1V16A 2CMFA 1X7GA 4R3WA 3U7FB 4DR4B 1VL5A 2H9YA 3DYVA 1M6YA 1Q3EA 1REQB 4HWKA 4I9QA 5A7HA 2JJMA 2R1ZA 3FTEA 1SBCA 1SCQA 4UCSA 2OTLV 2BO1A 4FPXA 5HSGA 5JSZB 5FKJA 4B3CA 1VQ9F 1KMIY 1N0WA 1V25A 5BNIA 3ER9A 3TKYA 3QQ5A 2BTEA 4U7WA 4B2YA 5EJEA 4D0GA 3AW9A 4LJ9A 3QFFA 5J2TA 1PFVA 4RFLA 1S4QA 2ZRJA 5F23A 4AHCA 1H8EG 4P9PA 1G2OA 1HDJA 1CRQA 1RJ9B 2HWXA 3IV7A 5IX8A 3QVTA 4QGSA 2XX3A 4HY3A 3DULA 4GE0A 2FB5A 3GDWA 2C0PA 4CM7A 4RAOA 5HY2A 1GD1O 1KEWA 3MQ4A 2IS2A 1OX6A 1K8XB 5F51A 3UUFA 2GEBA 3HM2A 4QYXA 2JFUA 5JPCA 1KEZA 1Z45A 1J2YA 2SBTA 3MEQA 3D7MA 3DNMA 1GAQA 4XLZA 2ILMA 3GYGA 2PANA 5CIQA 3KS9A 5FD8A 3AB3A 2DM6A 4ZVNA 2R8RA 1Z73A 4M7PA 4NJEB 1TA9A 5E3IA 3CNOA 1QZXA 1ZHHA 2DHEA 4PZAA 4LFCO 3RN4A 2WVAA 3KUCA 2CXHA 1CFZA 1WA8B 4NJEA 1JKJA 2GBIA 4OAPA 4IIBA 1MX3A 3KOUA 4B62A 1NWHA 4FM2A 1YOVA 2CXNA 3OOEA 2C2ZA 3FNBA 4ZCQA 5CD9A 1QZTA 3RJ5A 3ZMVA 4LDRA 2EVWX 1OQAA 1KSHA 1MPXA 1STOA 1M1YA 1MW9X 2PZAA 1GGMA 1DQPA 1G19A 3GA7A 4MX8A 4PSVA 4UV9A 3WGOA 1P1FA 2FPXA 1PR4A 4IV0A 4LC1A 1OYOA 5I3CA 4NE2A 4A6DA 1YZ3A 3FTPA 4XJXA 3ASNB 2VP0A 2BKVA 1DMRA 2C5LA 1V6AA 3FSEA 1KI8A 1KMHA 4NTZA 4WNAA 1Y9EA 2D4HA 4X60A 2NX2A 4EEXA 1YB1A 5IJZA 2YZ2A 3MTJA 3TZQA 3I8OA 4BS9A 2HA3A 2EBOA 5DMXA 3DEKA 1A98A 1E2FA 1W2BF 3KQVA 5ADWA 4WFJA 1XL4A 1UDWA 2GJAA 3A4NA 4R2MA 3PXAA 1SQBH 3ZCTA 4PTZA 4FMTA 3BD6A 2QX9A 4GOND 1KBQA 2RI6A 3DLTA 3MWGA 4JLKA 4D9CA 4IM7A 2C98A 1U7OA 3L93A 2KTUA 5JNUA 3MBMA 2JLBA 3VH4A 1N2XA 2UZHA 3QTLA 4HX5A 4DLPA 1S3FA 3NTVA 3TE7A 2GKGA 3FF1A 3NAZA 1IH8A 3OAAA 4KYIB 2HQRA 2VRBA 1G8FA 4XYMA 2DB3A 2VZ0A 2VPXA 3AYXB 3AMVA 2BGGA 3QNEA 4JFAA 4O4LB 4HVAA 4JN6B 4BC0A 1WJGA 4OFWA 3REQA 3T7AA 4OUDA 2OFPA 3OOYA 4HDNB 4UBMA 3T7DA 4CLRB 2X42A 3SJ7A 4DJ5X 2GETA 4RJTA 2NO1A 1YAJA 5LP1A 1BROA 4REMA 4BRSA 1GA6A 4C30A 1TYBE 4DMUB 4X1IB 5AK4A 4R84A 4MV4A 1CQZA 1IPHA 1EN6A 4X65B 2BF7A 2FMIA 3CFYA 3G80A 5CA1A 4N40A 3WJ2A 2FPSA 2B98A 1S8NA 2JFOA 2OGUA 2RK6A 3EE6A 1WM1A 1QNMA 4FDAA 4HB3A 1HUQA 1Y63A 2FYUH 2DQSA 3OGIB 3UH1A 3SVLA 1H42A 4KOEC 2YIBD 4R40B 3UGKA 2I22A 2VJMA 2GHQA 3L9XA 3NTQA 1VKHA 2JAQA 1EUCA 3BTOA 3TQSA 2DWQA 2EX0A 2I1QA 4R1LA 2D74A 4X20B 3O91A 4HDMB 3AIOA 2NZ8A 1Z0DA 4HRYA 4HNAA 1Q0UA 1NBMA 5COBA 1X4TA 4BQEA 3L8ZA 3U4QB 1KRWA 1XTBA 2AUTA 5AXAA 2CFCA 2KQXA 3RSOA 3ENQA 2P6NA 3LYUA 3GUCA 5ERYA 1Z0ZA 2X0NA 3TIVA 3ZD9A 3OX3A 1VH8A 3TUZC 2B7LA 1KZGB 1YL7A 2G04A 3LPAA 4FBGA 4HUJA 4LN1A 4RABA 4RSGA 5A6SB 1XLWA 2G9UA 2FZEA 2FZVA 3ANYB 4RPHA 1Y3IA 2I1WA 3OQJA 4QNNA 2JFNA 2TMYA 5CH3A 2IK8A 5DN6A 3WWZA 1QVZA 3ABTA 2UUAO 4UNIA 1XZBA 1ODLA 2QZZA 5ETJA 2FN8A 1KFCB 1SBQA 3CIOA 2NO5A 2BHRA 3K14A 4FZJA 4H7IA 4EJ0A 4TN1A 4ZYVA 3FUUA 5CPBA 4YONB 3VMFB 4LRQA 1U2SA 1OI7A 4GQBA 4PG4A 2IZ6A 4V0MA 1DQSA 1I32A 1A4RA 1LBHA 1Q82H 4J7KA 2XB6A 3N07A 2J59A 1UOEA 3KQWA 4JVNA 1IN8A 2ABWA 1OCEA 4L5CA 3W1WA 1PT9A 4FZ3A 4RGYA 2VUUA 3WL3A 2QZ4A 3P52A 3VYSB 4YPVA 4IIJF 4E2ZA 1QC5A 1EGVB 1W88B 2XQJA 2HU7A 1CJSA 3I9V1 3K4QA 5EESA 4Y2XA 5E1DA 4Y1GA 2V4ZA 1E77A 2FPWA 1JDPA 2N47A 3LDTA 5GZ1A 3ZH9B 3TQQA 1W3EX 2NXEA 1ABBA 1XEWX 4TZKA 2LNDA 1TCVA 2R44A 1DBQA 4Q7MB 4DWOA 5KC9A 1TL7C 1QPGA 3BZBA 1HNXB 1QK5A 1V95A 1Z4MA 3DO8A 4E2XA 4BJHB 1NKDA 3T4XA 2F3TA 2O0JA 1HNZB 3VJKA 3Q41A 3VJLA 3KO8A 4M0EA 2DHQA 3D9QX 1NLUA 1CV2A 1JHRA 5HFAA 3SDSA 1JOYA 1M7BA 1QIEA 1P7VA 2RFLA 4WUTA 4AZ0B 4JZ2A 1QX4A 3NX4A 3QMMA 1PR3A 3WO1A 4FFBA 1QHGA 1QO7A 4CM4B 2XMRA 4CQMD 5F12A 4CKEA 1FSPA 3K57A 5AKKA 3B7WA 1UC9A 2DBYA 1EFVA 1PR5A 1XALA 2JBWA 5EZ5A 3IKTA 3PEVA 4LV8B 1KYZA 3MPUA 4LWOA 2VQ3A 4TS3A 2OFXA 5LL6P 1QAQA 3G6BA 1P2DA 1Y3FE 3H13A 5DXAA 4MH0R 5FOVA 1EWVA 1D5WA 4BVTA 3LOQA 1JQBA 3LNNA 1WP9A 2Q3FA 5T57A 3UGTA 2GLZA 3R5TA 3K92A 5CCXA 4JJKA 4AS1A 2ZI7A 3CZAA 3HDJA 3ZWQA 4U4AA 2ILVA 4MV1A 4UEJA 3WQBA 4FSDA 4B47A 4KGZA 4YXFA 3HBMA 1FS0G 2FRXA 3K0CA 4JYZA 1X3SA 3H5IA 5ALVA 2FGYA 1CZRA 3CS3A 2OV3A 4MQMA 3E1YA 4TLEA 3O26A 3DAOA 3DONA 5L51A 3DF7A 2VHZA 5CK5A 2ZRDA 2PWBA 2XMQA 3IJPA 5CDUA 1FNSA 5IDJA 2QTMA 3KTAB 4O29A 1FDTA 3MOGA 1WW3A 1Z0AA 5C7OO 2Q7DA 3KEFA 3DV2A 3RU3A 4GU5A 1T3LA 3ZWVA 1CEYA 2G1JA 1SC1A 3PQ8A 5CFLA 4Q6BA 2X9QA 3Q5DA 3SYNA 3A1DA 4DLTA 2RHMA 4J0JA 1XDSA 4GOLD 3P10A 4M1OA 2IYWA 4LF7B 1CR2A 1DFGA 3GOHA 1EIZA 3VAYA 5L3CA 1JYSA 3N0RA 2Q29A 4AJNA 2DPYA 2XB8A 4NENA 3JX9A 3KB8A 1MD9A 2BFMA 4NZZA 5EJ4A 1DIAA 2MTBA 4ZZ2A 3F47A 2DN9A 4KR0A 4A6PA 5C53B 1DJQA 4IGKA 2DBRA 3VKUA 5KYUB 3OFKA 3ZW8A 3L5KA 1QTIA 4DV0B 4LF9B 4G4XA 1U5BA 2A0FA 3BWEA 2OVFA 3BVPA 1GNLA 2O5RA 1S0VA 1I1NA 3EZYA 5F9FA 3JVIA 2ERYA 2R6FA 4FKMA 4JQOA 5DKFA 3RRNA 2MSLA 1M5TA 3OLWA 4FIZA 4AQYB 1NBHA 2ZVYA 4MS4A 2OORA 2W2OA 5D85A 2NYUA 1J8VA 2QV7A 4LBYA 5BOVA 4K9QA 1ZAKA 1YBAA 3U4DA 4IDHA 1TMOA 4MKRA 3NU1A 1EGAA 5TB5A 3FKSD 4Y6LA 2ZBPA 4ESOA 1U98A 3REOA 4P84A 4LYHA 5G4KB 1AHHA 2Q2WA 2QRNA 5DTEA 2ZR3A 4JCOA 1GGEA 2Q5JA 2W98A 4KO8A 4JLJA 1MA0A 1B06A 5AESA 4S04A 1FD9A 4JDUA 3WFZA 2O3SA 1SZQA 3VKGA 1A9SA 1S72F 1GUBA 5GJVC 1FW8A 5AW0A 1RRKA 2YN4A 3PNPA 2IJIA 4IBOA 2WHYA 3C1TA 4UV8A 4GNRA 4D9KA 5LP6F 3CN7A 2ET6A 2QNBA 3IHLA 4F6EA 4QFDA 3KD2A 5EO3A 3L0OA 5BYBA 1KKDA 1NW8A 3VI6A 5ALZA 1VLQA