4X1YB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 144
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1yB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1yB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1yB01
2RHOA 3HKDA 5JCOA 2BTOA 5MN5A 3N2KA 1FFXB 5GONB 3UT5B 4EI8A 3HKCA 1JFFB 5KMGB 4F6RB 5IYZA 3HKBA 3HKDB 5J2TA 3M89A 5LYJA 3VPAA 3E22A 3ZBPA 4B46A 5M7EA 4TUYB 5CA1B 5LXTA 5IJ0A 4YJ3B 4IIJA 3JARB 1TVKA 5JVDB 5ITZA 5LP6B 4YJ2A 2BTQB 3JATB 5CB4A 4O2BA 4O4LA 3RYFB 4WBNB 4ZHQA 4O4IA 4IHJB 4O4JA 5LA6A 3E22B 1SA0B 4O2AB 5J2TB 3RYHA 3JAKB 4HNAA 3HKBB 4F6RA 2VXYA 3HKCB 3RYIA 3N2KB 5GONA 5EIBD 3JAKA 3JAWA 3R4VA 3N2GB 5LA6B 4E6EA 5MN6A 3JALA 4O4JB 3VO8A 5IJ9B 4KWEA 4X1IB 1RQ2A 3RYFA 4X1KB 4I4TB 4O2BB 4X20B 2Q1YA 3WGNA 3JATA 4TV8A 4ZOLB 5KX5A 5LOVA 1W581 2R6R1 5LP6A 4XCQA 4I50B 4EI9A 1W5FA 5CA0B 3RYCB 4DRXB 2XKBA 3WGJA 5C8YA 5JCOC 1RQ7A 2Q1XA 4EB6A 4I50A 4LNUB 2RHLA 2VAPA 5EIBC 5IYZB 4TV8B 4ZOLA 5KX5B 3ZBQA 4X20A 4I4TA 4U3JB 1W5EA 3RB8A 4X1IA 5IJ9A 3CB2A 2R751 5JH7A 3N2GA 5LP6C 4ZI7A 1W59A 5FNVB 1RLUA 5J2UB 3RYIB 4U3JA 3C8LA 1TUBA 4O4HA 4FFBB 4HNAB 3HKEB 1SA0A 4O2AA 4IHJA 4X1YA 5BMVB 4WBNA 4ZHQB 3V3TA 2GVIA 4X1YB 5BMVA 3WGMA 3WGLA 4O4LB 3M8KA 4DRXA 3VOBA 2BTQA 2RHHA 4FFBA 5LOVB 5EZYB 1TUBB 3JARA 2VAMA 3WGKA 4IIJB 4I55B 3JASB 5MN4A 5IJ0B 1FSZA 5FNVA 1W5AA 5JH7B 3JAWB 3ZIDA 4M8IA 2RHJA 3VOAA 3JASA 2VAWA 4I55A 1JFFA 5KMGA 5EZYA 1FFXA 3UT5A 4LNUA 3RYHB 2XKAA 4EB6B 4EI7A 4B45A 5JQGB 4O4IB 5C8YB 4TV9B 1Z5VA 5EYPA 5CA0A 5CB4B 3RYCA 3HKEA 4YJ2B 4O4HB 1TVKB 5ITZB 1Z5WA 5JVDA 4U39A 3VO9A 5EYPB 4DXDA 4X1KA 4YJ3A 4TV9A 5J2UA 5LXTB 1OFUA 4TUYA 5CA1A 1W5BA 4ZI7B 3JALB 5JQGA 5LYJB
chains in the Genus database with same CATH superfamily
1EFHA 3RUDA 4DCVA 5AVOA 3IJ4A 3LT5A 3BAFA 1S2NA 1C3JA 4JVOA 4ON9A 1Y3IA 3NKLA 3TNJA 1GAQA 4TQDA 1Z0AA 2VSXA 4QJBA 3S2UA 2UYGA 4B76A 5EC2C 3M5WA 1GU7A 3OEEG 3LLVA 2V3WA 1T9HA 1W29A 2OWEA 5FOQA 4KXUA 4Q7QA 1XWIA 1DAKA 4O3MA 2WA2A 3T54A 1KY4A 5ADWA 4GMDA 3U7EB 3WLHA 1XYGA 1JS1X 2JD0A 4QO8A 5JG7A 3HR8A 3KJKA 1OWOA 2AK3A 3ABOB 4LDNA 4B79A 5C5DA 5KTYA 1JXOA 1XDSA 4PC1A 2WJ6A 4YP7A 2QB5A 1FDUA 3LT2A 3RUPA 5E3HA 1T0HB 4HBNA 4EX6A 3FPHA 3DWEX 4J8PA 5TJHA 3LJKA 4K9KA 1WN7A 2RCVA 1I7FA 3D8RA 2ETXA 1GM5A 3SPHA 1JTFA 5KYXA 3HA2A 4JBLA 1BS9A 1QVGU 5DTQA 3ZKWA 4BVSA 4KPGA 1G8SA 1IRIA 3ER6A 3IBGA 4RZXA 4X66O 5DT9A 2C2ZA 1TZ2A 1FFHA 1KU0A 1RYEA 2VK2A 1EZJA 2HEGA 2VH5R 1R0LA 4J76A 3GJ0A 3E18A 2FSHA 2C2HA 1AN0A 4NAVA 5A5DA 1QDUA 4TMFA 4LGMA 4QFDA 5EZQA 1Y4MA 1D4ZA 1C50A 1K4MA 3M33A 3TX6A 1X1QA 2QXYA 4LI3X 3LWQC 1NVPB 5SZJA 4MCAA 3VYTB 1EX7A 3D7KA 1CQIB 3CZRA 5JNRA 2PUJA 3ZEIA 5H3CA 1YDHA 1JEDA 2PQ2A 3BCSA 5FPHA 1R27A 3QPBA 3WLQA 1Q0SA 3VC7A 3IDZA 2YINC 1FFSA 2IHYA 3DCIA 3EDOA 3IPAA 3TMKA 3AI2A 3GVPA 3ROXA 4E0BA 3TD3A 3PFBA 5HKAA 1CIVA 1LLUA 2YQ5A 2P9EA 2H1FA 5TE9A 4LF5B 1P7CA 4GX5A 2O1SA 1PUIA 1K8AW 2QRVA 1G6Q1 4BCBA 2X1MA 4AUKA 5LJLA 1WB6A 1G21B 5AICA 4LEIA 3C8LA 2PLNA 7ADHA 4MUKA 3GD7A 4NWOB 1YZBA 1LKZA 2DQ4A 1H22A 2RMKB 4MINA 3AR3A 3V1KA 4YT2A 1G18A 1JSZA 4FC7A 5DNVA 4QARA 3V7FA 3NGMA 3VJMA 1K5SA 4IVPA 4MVJD 5L3ZA 2BMDA 3LLUA 4N0MA 2PL3A 5CURA 4RJIA 3D6MA 2PH1A 3WLNA 4ID3A 3QKRA 4HXGA 3HLTA 3ZEDA 1H23A 3B48A 3BXOA 3NB0A 3RSGA 2JLZA 1JMKC 5JNTA 2HFKA 1NF8A 1P72A 2JANA 4S1PA 3CPSA 4QGAA 5SZKB 5C7IO 2JLXA 3L7AA 3GEBA 4RD0A 4M9XA 2BONA 4YASA 1ECCA 2CNOA 2G0TA 3C8ZA 4H59A 4J6FA 4NCNA 3CZMA 3HP7A 4Y1GA 3JASA 4UHJA 4WJLA 2XAJA 1TTHA 4GKAA 4KQCA 2JBAB 5BR7A 1TIPA 3R7SA 4NOKA 4AZWA 2FUEA 4DJTA 1JDUA 1PHPA 1Z0JA 2JGDB 3ROFA 3V7YA 4AJOA 1WCWA 1MOPA 3C5HA 4LRQA 1S5PA 2EIJC 3CUSA 3PD7A 4B3TB 1AHIA 3D59A 4M46A 3R9WA 1RNLA 5F5XA 4NJEB 4U8HA 4ZZ0A 4CEIA 2IM9A 2FW9A 3CZAA 4YRPA 2PGLA 3V46A 4KE6A 4E51A 1X4TA 5LBQA 1NQTA 4PAOA 4QFMA 3T3EA 3P8ZA 4MVJM 1W5BA 3CRVA 4TSKA 2DYSB 3O47A 2PA0A 4AKSA 4CV0A 4DLSA 1SULA 4MQ4A 4DABA 4LDAA 2WU4A 3KEMA 3MN1A 3V4PB 2P68A 4ILKA 4C8IA 1JE1A 3PPVA 2YYAA 4RKQA 1G20B 5D3MA 1U7DA 2WTNA 3H6KA 5IDWA 1NRJB 2ATKC 3CCVF 4RO0A 5FKJA 1BZYA 1FYJA 1PYOA 2BHTA 3I2JA 1WCIB 1GTMA 1Z4IA 3GFSA 3PFGA 4LC1A 1VSTA 3Q7TA 4V0RA 5CCDA 5G0UA 4IF6A 3B3JA 4PRYA 5FEUA 3T9CA 2OYCA 1PLLA 4YJ2A 3L7KA 2XGGA 5EHIA 1NULA 3DBRA 2CVZA 3H0CA 3NBFA 2C3YA 3FBGA 3F0GA 1U2RA 2QTAA 5TSDA 3VU1A 5JQGF 1X92A 1N7HA 1DF5A 2YVQA 4G2NA 4KOAA 1JNYA 1Q50A 1JG1A 4TUYF 5FPPA 3VMMA 4CR8A 4EH1A 2ZDIC 1MH1A 4FJ0A 4Q9KA 2XW6A 5TS3A 3K94A 1VECA 2Y48A 3EQ9A 4JL5A 2P5TB 3ZE2B 4C7OB 3MWEB 1PEDA 4RTLA 3V97A 1OLUA 3MJVA 3MOSA 5E7QA 4JI5B 3DE7X 2VZ8A 3NDPA 3P4YA 4JA0A 4R9SA 3HJRA 1RMTA 4FLVA 1RHKA 4WFKA 1B6RA 1XDUA 2IVZA 3W5JA 1GQRA 3L4KA 3KT6A 4DG5A 1V55C 1B8OA 1GLNA 2YVAA 3BWXA 2X77A 4GM0A 1Y3BE 4WFFA 1YE5A 5DCLA 3PBKA 1SZJG 1YI2F 3ASZA 2VC2B 4W5NA 2HBZA 4AZ3A 1LQTA 4LFAB 2P2ZA 3NIDB 2RAPA 5D3ZA 4I8IA 5H68A 2A7WA 4RSGA 3G0DA 2GTAA 5KHKA 1H6AA 5EWMA 3ZHXA 3SR4A 3IVGA 1RBYA 2OB1A 4IZOA 4K6GA 4ZYXA 5KYYA 3BB1A 3DLHA 2QA4F 3H1GA 3OT1B 2VKQA 3A9SA 5FTNA 2YH2A 4M76B 5TF4A 2YJ5A 3WVNA 3PNMA 2BDTA 4HYOA 4R2JA 3LVRE 1KKUA 1ZYUA 1DBPA 1L6RA 1Y66A 3AMVA 4W6ZA 5B55A 2PZSA 3O85A 1DQPA 1E18A 3QLEA 4UDNA 2VT2A 5FHQA 3KUXA 1N5JA 1ULHA 1ZRMA 2BHRA 3NHBA 3U48A 3IT3A 5KUTA 2VXBA 3IDSA 2Q5ZA 4B80A 1U0JA 2AOVA 5E6UB 4QOHA 4XVQA 2W6OA 3HZOA 3PVZA 2NSJA 3C8DA 5K0JA 3EUFA 4W8OA 2WSSG 2H2IA 1A4IA 5CX4A 3URKA 3TBHA 1FY2A 1XTVA 1XMJA 4LJ6A 5IT5A 5DTIA 5C8DA 1MQSA 1XSEA 3WNDA 5KTNA 1J0EA 1EHYA 2P9QA 2VOEA 3Q7RA 4TKVA 4H7FA 1IWPB 4OYYA 5GANK 3HR4A 4TLDA 5F9HA 1MJGA 2R6CA 5AI5A 4FLTA 3SYLA 2VJPA 1D03A 1SCKA 4XR9A 4TKZA 1KEZA 3SZGA 5JAHA 1J5XA 1XQVA 4ZAGA 2QLNA 4EAQA 4YTEA 1X1EA 2W8BA 4N21A 3NYQA 3NDRA 4IDHA 3ZCQA 4LP8A 2HL6A 2QV0A 3DFUA 1DC3A 3A4YA 5A1JA 4LQ4A 1PR6A 1F7VA 1E20A 1JKXA 3WG7B 1M2OA 1JIJA 2WF6A 5BNZA 1XKQA 3NDIA 4OSPA 4OLFA 2X41A 5FB3A 3BN3A 2D0IA 1V9SA 2JGRA 3C98A 4IPTA 5IAGA 3DONA 3G85A 3U40A 4JI6B 4ZIBA 1QG0A 2HHAA 1Y76B 5BT8A 1YFZA 4J91A 1VF7A 3X1XA 4AQ7A 5GAJA 1R8YA 3AB3A 4GYCB 4M0MA 5DTRA 3ITKA 2ZQ5A 1K73W 1K3UB 2V7GA 2GWRA 4GRAA 2CV2A 4ZPJA 1H1DA 2B8JA 4H7HA 1G7TA 4RL6A 4CIXA 2F59A 1WTCA 4PXSA 1MAAA 1QZZA 2FNAA 3VPGA 1N9GA 3V4OA 4OQQA 1RYBA 4RNDB 3WLMA 3OONA 1G7RA 1JR3E 2PX8A 1KMQA 1P2TA 1S1CA 3L9WA 3OEHA 4YN3A 1WXHA 3BIFA 1DQYA 4TVOA 3C3BA 3WV4A 4GM4A 4MRMB 2PRSA 3FSEA 3ORQA 5F7OA 1SZXA 1X8LA 2VPTA 2GZ2A 1X52A 4PSCA 4R1MA 4OBXA 2ZROA 5CDHA 2XITA 3ZCXA 4ZGWA 3JAKB 3LDHA 2GZ3A 3QKTA 3FUCA 2OY0A 1CF9A 2Z9DA 3P2JA 1FTWA 4WHMA 2QX7A 2SECE 1MA3A 4GZMA 4LXTA 1L5QA 3UAVA 4XYEA 4GYJA 1T4GA 4F2PA 1F8UA 1NPTO 2HNKA 4REQA 4YRAA 1NF2A 1ZR2A 1ZS9A 4PV7A 2J45A 4B44A 2A7QA 4HDOB 5CFLA 3J81M 2W43A 4CF4A 5KX5A 4XGRA 3W5HA 3QX3A 5E2BA 5LP6A 1WV0A 1KEKA 1LRLA 2X8JA 4FMDF 5KVAA 4DANA 4L4UA 4DW1A 4BGDA 1J1UA 1CDOA 2EYQA 3PDCA 2PZKA 2SCUB 3D3JA 4MTGA 1KEWA 2H4ZA 3HSKA 2PV7A 5FL3A 3WNQA 3G23A 4L57A 1ESEA 1Z5GA 2YASA 3MOIA 1I4WA 3QXHA 4RHCA 5ICGA 1KS9A 1SN7A 1Z6YA 3OLXA 2HDOA 1K7YA 3RTEA 3N27A 1U2ZA 2FPLA 2SNIE 4MPJA 1T26A 4A8JC 2ZYWX 1WHTB 1CU1A 4WOJA 3HXOA 2Q6IA 5L7WA 1DSSG 3RM3A 4ECEA 3H2SA 3TLGB 3N2YA 1ZKMA 4JY7A 2FAXA 1PJ3A 3IDAA 3C6ZA 2I9PA 2B99A 3SJBA 4BO4A 2I1WA 4XA8A 5FOXA 4LX0A 3FYUA 1RWOA 2PH7A 2DMRA 4YAEA 3A0HZ 4E5YA 2IRWA 1NE2A 3BX1A 3TLMA 4KN6A 4LZZA 4DLYA 1NBME 1GNSA 2ZYTX 3SCZA 3IKVA 3O5AA 4OHCA 3BKXA 4D92A 5K45A 3PNSA 1ZOOA 4IFEA 4AYXA 3TTXA 3KBOA 2RHHA 4WN3A 3WGKA 1XC7A 3QF4A 2BKLA 5CLGA 4I3HA 1F23A 4K0KO 5KTRA 5L4SA 1P6QA 3JASB 3NM4A 4FGSA 4KO4S 4C08A 5I7HA 4NCAA 3CINA 3KB8A 4QEDA 4RULA 3GC6A 2RDMA 5HBRA 4BHTA 1P39A 1IHYA 2EWMA 3OEEA 4PZPA 2IPOA 2QEQA 3ABMC 3SJAA 3VPCA 1TMKA 3MXOA 1CIJA 1ZCAA 1K9SA 3SBOA 5I7FA 2C4HA 1NKSA 3IOCA 1DXQA 2Z4TA 2ZREA 3B5EA 3ZN2A 1SBZA 3WYBA 2VNSA 1I0HA 4PICA 1NN0A 2QTMA 2X2EA 1K9VF 4MI6A 4CLXA 4F6LA 4V39A 5KPJA 4HLNA 1RC1A 2A7XA 1HKHA 5CTJA 3OE7D 4AC9A 1VE9A 1DINA 4JJIA 5H81A 4C3VA 4EY8A 1X0VA 2FZEA 4IYIA 1HW7A 2AFIB 1QR2A 4BQQA 1FVXA 4GOXA 5I3ZA 3WLSA 3D01A 4BNVA 1G1AA 4LF6O 3G9ZA 4V1CI 3QZUA 3TXQA 3CD6V 2UXNA 1E8MA 2G4LA 3F97A 3H7AA 1O4WA 3JQAA 4HNRA 4X6LA 4LHXA 3GVCA 2YDYA 4MWEA 4WNYA 3TLCA 2DERA 2NMVA 1YL5A 1CJBA 1ZMOA 4URYR 4B6QA 5AK0A 2GAAA 4MVJP 4ZVTA 5K0ZA 1NR1A 3GYQA 3RUEA 1GKYA 1YV9A 2C3OA 5AJXA 4DV1B 2OGWA 1PZEA 2ZAGA 5DNEA 5HYVA 1Q0LA 1WAMA 3VSEA 1CY6A 1OF1A 1EP9A 5GOZA 2BEVB 2FN8A 2ISSD 2P1DA 4P98A 2ZVPX 1S2DA 3RW0A 3CYQA 2D2XA 2DPLA 1MA1A 4BT3A 3VQXA 1FPMA 1E2NA 1GZDA 2P35A 3ANMA 2CL6X 1AQYA 4H0FA 4LHVA 4J3NA 4XX0B 1UF9A 1YS4A 3MWLA 3PXAA 4LTNA 4Q18A 3TRFA 3SJCC 4TTAA 3AIMA 3RYHA 3AM5A 1VRWA 2MTBA 3FOWA 3HU3A 3ZKWB 3DT6A 3AKZA 2V5VA 1QHHA 4BRUA 2J3MA 5IPFA 3DKKA 3WRVA 3PC8A 1OIWA 4TROA 1HPLA 2FUKA 3H5VA 3SVZA 2VWPA 4DNQA 5HGJA 1OCOC 1Z08A 1R4NB 2G17A 5A9TA 4F8EA 4B33A 4HQKA 1V37A 4ZP1A 2AHZA 1NAIA 4H0NA 2BBSA 2DEUA 1IVYA 2F4NA 2GN6A 4UUBA 4KMMA 1UKYA 1Z4LA 4RTQA 1I80A 3MCVA 5JADA 4LE2A 2N47A 1UFYA 4H4DA 3CZQA 4BQOA 2A88A 4CEJB 1QV6A 4C0HA 1L7OA 1G8KA 3F0EA 5EEGA 3TTSA 3I7TA 2GCIA 5DBGA 2CMKA 5KKAA 4IBOA 2FTKE 4A8JB 3E7XA 2DT5A 2HA5A 1DPFA 2O7SA 4HTFB 4BNYA 5EG5A 2NYUA 5KJFA 4L27A 2XA9A 1PL4A 1WCYA 3BMXA 1NG9A 2L35A 3WG7C 1N34O 1IOZA 1GUZA 3GB9A 2H92A 3LK7A 1CQZA 1CRQA 2XUFA 3PR3A 4RPHA 1YUBA 5EIFA 5J5AA 3T34A 4HNAB 3WDMA 2GEBA 5HOEA 5K7SA 3M34A 2ARHA 3V4RA 1QONA 3E8BA 1WXDA 1VZ3A 2CDRA 4YCDA 5K3SA 1QP7A 1G19A 4HAMA 2HRBA 1A2BA 3BXFA 1HT2E 5DHTA 4DREA 4G1CA 4I4LA 4HDKB 4IQ0A 2A5LA 1CUBA 1JWAB 2QG9A 1QG4A 3VJLA 2P6RA 4D8VA 1EM8A 2B61A 1NXWA 2Q2VA 3HADA 4ENQA 4DCNA 1AKRA 3DL7A 2HU7A 2R9VA 3ZNNA 5K0LA 1KYIA 3EPLA 4QUJA 5FLYA 1J5PA 2QE6A 1ZO8A 4NMHA 1K7EB 5FBLB 4R9RA 5C4IA 1Z4KA 5C8YF 4I9HA 1F2TB 5JJ5A 4ZGBA 1JA8A 1SKAA 3FNIA 3FWPA 2BHSA 1CXZB 1JG3A 1V95A 2O50A 1Y8QA 2PYDA 3SLRA 4BFYA 1KJNA 1ODKA 2NUTB 4MUAA 2P6NA 4QOEA 1XFDA 4QE9A 4RY2A 1LY1A 3IUYA 3HY3A 3AVXA 1WZIA 4IGIA 2COKA 2CF5A 4MQEB 3CNNA 4MUFA 3E9YA 2RGYA 5EKTA 3ZXYA 3RYCA 4AX8A 2H3OA 1A9SA 3UXMA 4IZHA 4ZMRA 1LK0A 4NYKA 1ZL0A 2GUGA 5KSWB 1JPUA 1U0NA 2LZ0A 4JP8A 2ASEA 3E0XA 4IDGA 3BSWA 1ISRA 2B4RO 1I4EB 4X45A 1Q7TA 4BQIA 4MR7B 1T0IA 3WTCA 3FOEC 5D6OA 2KBEA 1KNXA 2QQGA 3I0ZA 2O3JA 3HCCA 1UPFA 4DW8A 3IYLW 3ZZNA 3UT5B 3R66A 4I1SA 2HM7A 1P77A 1SR8A 2BDEA 3WAGA 1CXZA 4M1KA 4ZO7A 2PUCA 3PXEA 4X62B 3VPAA 2B7LA 3KKNA 1Y42X 2Y0BA 1XZLA 3PICA 2Q0HA 1LDNA 4IJWA 1ONSA 2Z01A 2JNWA 3IPYA 4QXMA 3HXLA 1GL6A 4FC6A 1I94O 5C4GB 1Z2NX 1H2EA 2P2DA 5TQVA 1ZUIA 4MCJA 4F92B 4KTVE 1T13A 1D8TA 3K58A 3CF4G 1KY3A 4ZVSA 1AKNA 3GFRA 3D1JA 3EZXA 4C2TA 3CX4A 4EKGA 1UOOA 3OOJA 4EGAA 4HAXA 4ZYLA 3ZGXA 3JX9A 2HT1A 1YVUA 1JQEA 4RZQA 3BULA 3V8VA 2FWMX 2P6UA 3KLBA 4XTCS 5AI8A 2JBWA 4BB5A 2DYRC 3V7QA 3ORHA 3UKOA 1WX1A 2N9UA 5AIBA 2ODMA 4KVAA 4B62A 1TU3A 1TZJA 1WS6A 3BJMA 5GM1A 4JI5O 3ZWKA 5EJ9A 3C41J 4NAHA 4L7VA 2GEVA 2PPVA 1J5EB 1JILA 1PGQA 4X3OA 3EAGA 3MHTA 4OXSA 2I2XB 1W581 4RDCA 3PKJA 3D4BA 3KQWA 2Y27A 4JI4O 3EPPA 5CG1A 1O9GA 2BOVA 2PL9A 1Y7HA 3FB5C 1V48A 3CRZA 3H65A 4FIDA 1G59A 3DBVO 3YASA 3TAHA 1TC2A 2HO4A 4ZEMA 3GFVA 2UUBB 3A4TA 3NIWA 1RI4A 1YB6A 5FNVF 1MSDA 2Q1UA 1SUCA 2H1RA 1V54B 2Z0MA 4TTJA 3K9LA 3FOZA 1ACLA 3LKZA 4FOPA 3OPVA 2X4LA 5F3RA 4MW8A 1EGMB 1YOVA 4GVLA 1G4AE 3KIZA 2CUZA 2ZJ2A 4E5KA 3TLZA 4OO3A 3OO1A 3IEMA 3QU9A 2GCOB 2QUIA 1ZHFA 1OA1A 4YUZA 3RWMB 1ZESA 4CMEA 4FZ3A 4AW9A 1I7LA 1QU2A 3PD1A 1CQPA 3CVXA 4X3LA 4WZBB 1IBLO 1WE2A 3PF9A 4JZYA 5HOQA 2OLJA 1AH2A 4WKNA 2WFZA 2QN9A 3MTBA 2J0UA 4ZAXA 5K8CA 3LCRA 3O4JA 2QYOA 4N65A 3FBTA 4DQ0A 3WGLA 5I8PA 3WJQA 1JU9A 2N48A 2O06A 1SXPA 3L0YA 4COKA 4HAWA 2GNPA 4KN8A 1OVMA 2G4VA 5UKDA 3K8ZA 4DE5A 3SPIA 3IC5A 1QFZA 5ALYA 4OATA 4Q01A 4EHDA 4ZCRA 4ER6A 4F4CA 1EK1A 2AB0A 3NBUA 1U1DA 4G97A 3O2NA 3JAWB 4H6VA 2AWNA 1Q1ZA 3OU7A 3WL8A 4BP9A 4CQNA 4FP9A 3BRWD 2NUBA 2UZ3A 3IQDB 5LOVF 2C54A 1T2CA 3FD6A 5KOYA 1BQ3A 4J0JA 2IHVA 4H6PA 1UAYA 5F73A 1DKOA 4BL5A 3U7FB 2BSAA 1PD3A 4BW0B 1M1NA 2ZYSA 1B06A 3OLWA 2GD2A 4DNPA 1YCHA 1Z5UA 5JS1A 1JKJB 2WKWA 1AF4A 4MVJF 3V9PA 3G2HA 2J9FB 2NG1A 3GJRA 5IXSA 4XARA 1TFUA 3A7EA 3SKVA 5JI2E 4DWVA 1QTIA 1LPAB 2YXEA 4U5QA 2JF0A 5C18A 2I03A 3OX3A 5KYVA 3C3WA 4GOKA 3W5AA 1H3FA 2BPOA 5IAEA 1KRWA 4ZHVA 5K3AA 2OHVA 3T80A 1DUVG 4XYGA 3WG9A 2HRCA 1LZLA 1AJQA 2D7JA 2Q0QA 3QNWA 4V3CA 1MUUA 2ZRJA 1GNVA 4B8YA 2BFPA 2C95A 3MB8A 1C7IA 3R3YA 3WIDA 3TSYA 1QHIA 1NUUA 1VK3A 4OK3A 4KGXA 4OHUA 2WABA 5K0FA 4B7KA 3G1TA 3LUBA 4P3YA 4H3HB 2F17A 1ZD9A 4JX9A 5JJKA 3BA9A 3W7XA 2FWJA 4YRCA 4CJXA 3E3NA 4U7DA 1OZHA 1C4KA 4AVYA 3TUIC 1QR8A 3K6SA 4AF7A 5LKRA 1W0JG 1W88A 4PLFA 2R7MA 4ZRNA 3D3WA 1OV6A 2I54A 3OE7A 3CP1A 5CCEA 2RAFA 1E4OA 1VIVA 2CXHA 5AW3A 3SYTA 2EZUA 3U1TA 4L8GA 2GO7A 2XAQA 1TQ4A 1IZZA 1FNBA 2JGIA 4IDDA 3IAHA 2HS3A 2RK3A 4R01A 4FLWA 4YRFA 1WHTA 3A2KA 1E6LA 2NV0A 4RESA 1QGDA 4D0RA 1PT5A 4BZQA 1EK6A 3MCWA 4FILA 1SZDA 4JBGA 2VJLA 3QOXA 2BKEA 3U9SA 1EEXB 1QYVA 1G2OA 1VHQA 1JIUA 2WLHA 1XXHA 1Z7BA 2AQKA 3ADKA 1BS1A 3E9MA 3NC4A 3PRJA 3RU7A 3VR2A 1RA4A 5DHSA 1AMNA 3AFNA 5TMPA 4CU2A 4ZJUA 1C0KA 2JGJA 1Z06A 3H2YA 1OBOA 1SHLA 1BDJA 1E5DA 5B5EZ 1H05A 3IIJA 5KX5B 3PRHA 4QE3A 5CH5A 3KHTA 4LKRA 5D3KA 4NE7A 5DXFA 4X1IA 2ZRAA 2N0SA 4PFKA 5HIKA 3F7OA 4LV6A 2GASA 3QMPA 2B5UA 3MINB 2J30A 5CVJA 2CJFA 1Q16A 2D3OW 1K7XB 1WDTA 2WKSA 3KS9A 2HPAA 2QROA 1XTJA 2CEAA 3I2YX 4KVZA 4LWZA 4QDTA 3AVWA 3FTDA 5T41A 3PUWA 2FXVA 1W55A 1PSWA 1RM0A 1BVYF 5CXXA 3WRYA 5MF6A 1G8HA 2MHCA 3KHNA 2PGOA 3P2EA 5BMVA 1KEPA 2ZR2A 3HVHA 3GPBA 3NIGB 3HAXD 3Q7PA 3ZTYA 2MYPA 3G7UA 3LKVA 1NP3A 5CBKA 4J80A 3I58A 1OV9A 5EKSA 3JARA 2I7DA 2WB4A 2YHBA 5G40A 4IKEA 3GP3A 3FCSB 5GTHZ 4I50F 4AZTA 1W57A 2DVMA 1IG3A 4KDFA 3IVMA 2DBRA 2WSMA 2ZI6A 2EIMB 1T9GR 4ER3A 5G3YA 1QKJA 4ZCPA 1KJQA 1U1FA 3K2XA 2P7HA 1NVVQ 2X0IA 1U2PA 4CTJA 4QJIA 2OEPA 5ITSA 2GXQA 2WI8A 5EMKA 1ZUD1 1Y5IA 2V03A 2AVDA 4DDHA 1VF5B 5M29A 4GI5A 4EVIA 3U5TA 1O95D 5HY2A 2H16A 4BEVA 4POAA 1VHAA 4ESEA 2WKRA 3R3SA 4R0MA 2QWNB 2CFIA 5BW4A 5KVSA 2QVYX 1NJIW 1PT8A 1P1CA 3NBYC 3K6JA 1K0UA 1YXMA 1ABBA 3KJIA 4D3FA 3REFA 3BTOA 1VFPA 4N76A 2QYSA 1OFVA 4GRIA 4K7JA 1L8OA 2I2BA 4HB4A 1W1IA 1Z8HA 3OICA 3S1SA 1DQZA 3AK3A 3RFTA 1TADA 3BORA 5BW6B 2AC7A 1JD1A 1A9YA 1J8MF 3SXUB 1LB1B 1Z22A 3G7SA 1P1JA 4NOJA 5EFOA 2OBBA 1NHGA 4BNZA 3QOFA 4KVFA 4TKMA 3E5RA 1EUDB 4HWKA 2P77A 2YV3A 2BSXA 3LX4A 4LOHA 1RFGE 1USVA 3PGVA 2AEMA 3T7DA 4DEYA 2O6HA 3GA0A 1VIAA 1G42A 4IG4A 4Q34A 4LZAA 3GCWA 4ZVUA 4TKVB 4ZALA 4D3XA 1A8SA 2IGBA 2LJ2A 3B40A 2O48X 3QHDA 2UVDA 3AEYA 3RIEA 1YFLA 3B77A 4OX9B 4EPTA 3GD5A 1WP8A 4K88A 4J9YB 3A2LA 3V1UA 3R6GA 3QBJA 4XIJA 2EJUA 1JDNA 2JIZD 4X1OA 4QEKA 5ESWA 2NTEA 1XMQO 1G3IA 2YNMD 3OQIB 4G5XA 2ISCA 1ODSA 4IRXA 2XMBA 1RPJA 3RIYA 3N8GA 3ZZ0A 1DC5A 4R51A 4D81A 6REQB 1Z0ZA 1YIDA 2ZBPA 4M0FA 1OH7A 3U10A 3ITDA 5DRYA 3FYEB 3ND6A 1E3LA 1SKQA 4CM8B 4O08A 5GONA 2Q0OC 1J06A 4F11A 3HA7A 2X0NA 1Q0UA 1SU4A 3M1YA 1KVSA 3NHKA 1HV8A 1T35A 4MR7A 3WZ2A 1O7JA 3QUCA 4OGGA 3FTEA 4LDZA 3CW2A 5J1TB 4HHEA 1ONIA 1O54A 3OZEA 4ROTA 5CUQA 2ZI4A 2ZJOA 1UK8A 5AKYA 5EC8A 4ZVQA 4A6PA 3KQHA 2ORIA 3CUWA 1E64A 4M3NA 1E1QG 3U4AA 5BSVA 2I22A 1VJTA 4OMCA 1W5SA 2VT6A 4PS0A 3K8QA 3WYEA 5FPKA 1D04A 2PR7A 3QA3E 1YQXA 1MVOA 4BVAA 4EG8A 1IMOA 5CN0A 3NM6B 5JLAA 3UJPA 4PZLA 3KQVA 1JRLA 4J7XA 4CM1A 2K4MA 1E7WA 3EH2A 3LGXA 3PX3A 1I3CA 4P34A 3ZJVA 1X59A 4TTVA 4TWBA 1R8JA 2H2WA 2VO1A 4LF9B 2PVCA 3BDAA 3IE2A 4AO7A 1W30A 1Y1PA 2E4YA 3BMOB 4ND5A 4UZFA 2FUG1 4XDYA 2XTZA 2Y2UA 5DISB 1E3EA 5HIIA 5JHGB 2X6TA 3L77A 4L5BA 1YOVB 1NY6A 5JECA 1X7XB 4GOND 3ZP7A 3G67A 1W46A 3APOA 1Q15A 3ET4A 2GJ9A 3NH6A 3QGMA 1U8TA 2YV5A 4Z7QB 3OVMA 1E92A 4O2AA 2W6IG 3DV9A 3LCUA 3B89A 1R1DA 3OUZA 5B7PA 2VPIA 4GKJO 2ECKA 2ZJYA 3PPYA 4R8VA 3ZD7A 3U4IA 3W5VA 2WFLB 1X86B 2IXEA 3AUXA 4NMXB 2BSKA 4EUSA 5MFZA 2CK3D 2C07A 3ZRXA 3L43A 4FFMA 2V6IA 2RIRA 2BI8A 5K5EA 5H4HA 4F38A 3THWA 2RHRA 3AF3A 3MB5A 4LECA 1D9ZA 3QVGB 3ANYB 1DAFA 1MJ5A 4ZPXA 3KHSA 2IZZA 4BJHB 3QVGA 2EZ8A 1Q2UA 2XPCA 1H2FA 1IONA 4X94A 1HEUA 3ZV6A 4EPWA 2YWBA 4M9CA 3SBXA 3DSRA 4YMWA 1Y81A 2I7CA 4GVXA 1N5OX 2CXUA 1KZ6A 1SQVH 1KUQA 4UFPA 3FZYA 2Z8ZA 4YO7A 5AI0A 3HXKA 3JXEA 3QYJA 3THYA 2NAPA 2AR0A 3DD5A 3NYRA 3A4NA 3OX4A 1KBHA 2UYCA 1XKXA 1MABB 2H2HA 3GJZA 2VR1A 2OV8A 2GYVA 1EVLA 4TQGA 4X1KA 3ABTA 3D8HA 3EZFA 5DE3A 3F8SA 4ZI7B 4FM9A 3RABA 3K0DA 1FTGA 2KG4A 2VZ0A 3A1VA 1EFRD 2Y1XA 2G5CA 2R44A 4BQNA 1X1DA 4CNBA 1GTSA 5DGTA 3D0QA 3ZNOA 2W2KB 1KSJA 1W35A 4OF4A 1VCIA 3BIOA 3K6RA 2VS1A 3MF4A 4QODA 4UHBA 5BRNA 1M6VB 4M4SA 4MYHA 5JZVA 3OBWA 4RMJA 5BUCA 4UE2A 5GAPK 2XT9A 1KZ4A 1OIXA 4J0QA 3LDUA 3DNFA 5IBRA 5IDVA 5KDOA 3WNVA 3AR6A 3SLGA 4D0SA 2DTDA 4LBZA 2EBHX 3PJSK 1TCBA 5EJ2A 3UHAA 4G25A 4UHHA 4MW4A 2ODAA 2Y99A 2GXUA 4DHEA 3FW1A 2JLYA 1UOPA 1R5OA 4MVJH 1NX9A 4DUZB 3CY6A 4RS3A 1Q86H 3AESB 4DXWA 4J0GA 2ZIFA 1H2KA 4V0LA 5HKBA 1MG0A 1SUSA 2A9OA 1JI3A 3NP7A 4V2IA 4ZDKA 1A0OA 4HPWA 4I4IA 3K08A 3M9LA 3GPCA 3K9HA 1VARA 3G68A 2DLCX 1RWWA 4KFTA 4ND6A 2NYRA 3IQEA 2HXSA 3A58B 1VF6C 2V4ZA 4BVHA 4QXAA 1CDZA 4OIMA 1SK9A 3HV2A 3HN6A 121PA 1RJ9A 2Q62A 3ITEA 4GPZA 4TV8A 4OAQA 4ZXPA 1Y5RA 2LPMA 2QTBA 2BR5A 4UU8A 4P3NA 3LHIA 1RU3A 1OAKA 3WPXA 1ZJ4A 1S9DA 4LQDA 1CNEA 2IEDA 2R00A 3IV6A 3E15A 2FXIA 4FDVA 3ILXA 4XIFA 2BLNA 3NBXX 1FKAO 4U7HA 4X8LA 3P0FA 1XD2A 4CF6A 5LZ9A 3Q7QA 2V5UA 5AOAA 4PIMA 5CYPA 2P3LA 3WFIA 3HJGA 2IHBA 2IQ5A 3WA6A 2WQ6A 3E8GA 3D3KA 1UK6A 1G9XA 1R5BA 4TS9A 5FEMA 3RK4A 3Q2OA 3R65A 2VNIA 2Q2QA 3EEOA 3FDZA 2Q1SA 4DYLA 2B3TA 2C58A 2ZSAA 3NUGA 3K9WA 5AKIA 3W3ZB 2BF7A 2E3JA 4IX9A 2Z6QA 1OFGA 1SXJB 4JK3A 1QBZA 1DL5A 2X3YA 4G2TA 5TT0A 2OAQ1 1JR2A 2IZ0A 2PZLA 1UWCA 3UCFA 2DKOA 2FSVC 2P3QA 4PNZA 3IQGX 1N2HA 3NJ8A 4AQYB 1S3GA 1TF7A 4NXMO 4M89A 4FN4A 1ZXXA 5TGTA 5BN3A 2EW1A 1UBLS 1G291 1PTKA 2C9YA 2OLKA 3HNRA 4K9NA 3KEQA 3TL6A 1XZGA 4PGMA 3GYGA 3TQSA 2I7XA 5LQNA 3OCCA 3OF2A 4IIFA 4Z9XA 4FD2A 4B5CA 2W2LD 4OHZA 1WZCA 3C0KA 4E70A 5A3VA 1J2RA 1K0FA 3V7EA 1NC3A 1NJ2A 4CQLA 5JQWA 1NBEA 3TQCA 2AZ4A 1LLCA 3ZMVA 5IYDO 3D2BA 3FMPB 3DMTC 4LS3A 3ZQJA 2P1RA 1IZYA 1XTUA 1NOJA 2FY8A 2AZ0A 1JX9A 4PQYA 5FL7G 1E9CA 2QV7A 5G2OA 3H2JA 3KZXA 1BCSA 4BRZA 1NAHA 2AIRA 1DRVA 4YNBA 3T3OA 4PO1A 2FQ1A 1S0VA 2VWKA 1RAEA 1SD2A 4CG0A 4IIHA 3CJQA 3ODGA 4IM7A 4MCHA 4A2CA 1TAUA 3F0FA 1UFVA 5TDHA 1BE6A 5DN6G 2WSLA 1SU6A 2QA4V 2GUZB 2HCTA 2Y92A 1I5XA 1AA9A 2UUCO 2A92A 2GNOA 2HSJA 1Z2OX 3D6HA 2QR4A 1NLFA 3DYVA 2GFIA 3G49A 3R5SA 4WLEA 5TGZA 3U49A 5C8ZA 1F51E 2IIVA 4IR7A 5MGNA 1OR8A 3WQQA 5LPNA 3HR7A 2G9VA 3I34X 2QUKA 3VX3A 3M99B 2IXDA 4IUCS 1RJFA 4KBYA 5FA5A 5A1TA 1XF1A 4CQJA 3HPQA 5KSZA 4OP3A 3K5LA 1E89A 1LH0A 4LZNA 5IARA 2QE7D 1AS0A 1KI7A 4CCWA 2ZJBA 4EITA 1DC6A 3Q9LA 5LUBA 1XCGB 4L8WB 2PMEA 2HADA 3N2LA 1QH1B 4OJTA 1WNTA 4NFLA 1C8LA 4N0DA 4PC3A 5T4EA 5C35A 5FWAA 1XMOO 3RADC 3ZBTA 3IE1A 2F2TA 3LYLA 2Z2JA 4WN9B 3SZUA 1FE8A 1CZHA 4IHJB 1NDQA 2CVQA 2CD9A 4M83A 4EFKA 4ESHA 5DYIA 2ZZNA 2BR3A 2JRCA 3F90A 2QW8A 4N0PA 2XAHA 1K3EA 4L72A 3ECAA 2UXCO 3LFUA 5SY4A 5LQUA 1J7JA 2WNIA 4GZRB 2DAPA 3CKMA 4ID9A 1TU4A 2JVDA 1AO3A 3HCRA 3IP9A 3N7TA 4P80A 2GZDA 1NVFA 2YS8A 2YJ6A 4Q7KA 3PJGA 3QIVA 3D54A 1WULS 2WDPA 4B34A 3JRNA 1RLGA 3AL0C 1NMSA 1TA9A 3HCPA 3UB2A 1R12A 3LDCA 3OQNA 4I4TB 5I9IA 1S3JA 5E1OA 1HH4A 3ZD8A 5FWDA 2FL4A 4XQ9A 1KAOA 1Q3HA 5L8VA 2EX4A 1K9MH 3G0GA 1JLKA 3QTCA 3SEFA 2X9LA 4V2UA 4R2HA 4JAVC 4N3CA 2FB5A 3RWBA 2XB2A 4IIYA 1QGUB 4XSGA 3B1WA 3NQ41 4GX0A 4MW0A 4LNUB 1YE8A 3FNFA 4FJ1A 5JRJA 1OKKD 4I81A 4TKLA 2HA3A 4FM1A 4JT8A 3NWJA 1NW3A 2PZMA 3WFJA 1FUUA 4L2IA 4UXJA 3UQ8A 1AVMA 1U3GA 2V1DA 3AF1A 3FDXA 4B3TO 2AX4A 1QR9A 1GHTA 2HD4A 3GRRA 4Q3CA 5G1OA 1E2KA 1UC4B 2RNBA 1QVZA 1UDAA 2YN4A 2YNMA 4IHJF 2PL5A 1K8YB 3CM0A 4Z8XA 3ZNQA 2AN1A 4UJ3A 3OE7G 3ABKB 2GYYA 1TPYA 4EY7A 6CHYA 5CDFE 1A9XA 4EYOA 2OHWA 1R8QA 5D51S 4N39A 4PLZA 3E5HA 1VCOA 1P5FA 4GU5A 5TIIA 3QKSB 3GMIA 3H5RA 1RXVA 1XLTC 1AKTA 2B33A 4PZYA 4B35A 3G71V 1IAVA 2Z3WA 2GVNA 3OFSA 4RGBA 3A3PA 2XYPA 1SKYE 4UXHA 4D57A 4JZGA 1VXOA 4HK4A 1DAOA 3R75A 1W5AA 4DLBA 3I3FA 3UMMA 1SC6A 3GT3A 4NBWA 4QOSA 4B3MB 4I1RA 1TMGE 3OETA 2CV0A 1G4HA 2JAHA 5B1SA 5IUKC 4BWFB 2GESA 1VHJA 4JT4A 1BH2A 1E3SA 16PKA 1HWYA 2AN4A 3KCNA 3LZCA 4MMXB 4OU4A 3CE6A 2XZTA 4PG7A 2KBFA 1PFYA 2D59A 3L8CA 5FD8A 5BURA 1VQ4V 3CVWA 4F5DA 1AZTA 1U2GA 1U3DA 2R85A 4AZ3B 2PUGA 8AT1A 1Z5ZA 4EB0A 4L5JA 3WL6A 5AW8A 5CFMA 2YS7A 5ERYA 2NU6B 4BZWA 4IFTA 1P19A 4L3OA 1RAHA 4CKWA 1U9IC 3ADPA 1YRQA 2OCLA 4MV8A 4C6HA 2QE7A 2B0JA 4X3PA 4FHDA 3AVYA 4E03A 4C43A 4O4LF 1CYDA 1S3FA 4G0UA 3LH5A 2VHXA 4BT5A 3E35A 4AN4A 4C7OA 1VP9A 2CLMB 2ZP1A 2X6BA 2D2CB 5DGXA 1GU0A 1ZUHA 1NTKH 1GP2A 2ZRDA 3GRCA 1PNLA 3ESAA 4K2AA 3M6AA 1G5RA 1IXRC 1RPOA 3CTPA 3VNVA 1RPTA 1E3TA 2ACVA 2FPXA 2GTIA 5G4KA 3EGDA 1STOA 1QX3A 3AL3A 3PEEA 1PCXA 4FIPC 5JFOA 4YCCA 4DSTA 3DMFA 2R47A 4EYKA 1FAFA 1ZD3A 2PNFA 3KQQA 1M7GA 4UTXA 4O4JA 4A0RA 2XGJA 1LLDA 2KLBA 2RGCA 3QJ5A 4E13A 1VA5A 1E2QA 3UCXA 5A9SB 3N2ZB 1FSFA 1W4CA 3HJAA 4F4LA 4X64O 4ETWA 1IAQA 1GX1A 1FRZA 4JJFA 2C2GA 4FKMA 4QUHA 1PAUA 3NFYA 5JVDF 4X3CA 2B5WA 3BWDD 4HRVA 4HZUA 3WP0A 1XPUA 5IKEA 5DPMA 3NCHA 2V3CC 4J7AA 4ETIA 5IT0A 4KIUA 5BMOA 3QWIA 4QYXA 2RDCA 2UUPA 1Z4JA 1GPDG 5CAEB 4WZBE 1X1RA 4P4TA 4AS3A 1AOXA 3C3DA 2B1RA 1Y6ZA 5LZ5A 5DBIA 5HSGA 1ZQ9A 5J4KA 5F33A 1IM2A 5TMDA 4WT7A 4KGVA 4EPYA 2Z1FA 1GA1A 3VTZA 5JATA 3NO4A 1AKEA 5COBA 1V16B 3ASOB 1VL1A 3ABRB 1U3VA 221PA 3R3JA 4I2NA 1UPXA 1RWXA 1VQOV 1M5TA 1RHMA 4TGLA 1X7ZB 4ODIA 4EL5A 1BMDA 3DC6A 5BVGB 3F78A 3L74H 1C9KA 2AVNA 2CLLB 4JI3B 2UKDA 3BABA 4NABA 2OAP1 3WO1A 1XVUA 3WLPA 3JQ7A 2Y4TA 2FZVA 3LUPA 2J5KA 1F14A 4OL0A 4NXMB 3PLRA 1ZX1A 3MWKA 4GS5A 1WB9A 3L8GA 2BEUA 2IV2X 4A5OA 1ZGGA 5FJJA 2GQ0A 2HSEA 1EXDA 2BCJQ 5SZHB 5CDYA 1UANA 3M3DA 2Q0SA 1IV3A 2BFFA 3GGDA 5JJIA 1E79G 1Q0RA 2VXCA 3M81A 4JVLA 1DUIA 3F8TA 3FNBA 4CTNA 3DUWA 4DV3B 2I4RA 1L5FA 1GNRA 1N32B 3D3NA 4FGZA 1QGYA 4G0NA 4PA9A 3WGMA 3SS8A 1XZQA 1LPPA 3LPMA 2H4JA 3Q4GA 1A2OA 1OVGA 4KWHA 4DA6A 3ON5A 1SC3A 4XI9A 4NU8X 1UT6A 1WL8A 1G6OA 1OU0A 1R1BA 3ZO8A 1VQ5F 2EP8A 3D5QA 5JPIA 3SYAA 3QW2A 1VM6A 3VYUC 2VCYA 2VRCD 2HVKC 3OQBA 3TCUA 1VHDA 4DLUA 4EZEA 5CHEA 2HPZA 4M1TA 4R1SA 2VK8A 2IIBA 3HZHA 2XNJA 2RHJA 2IW3A 3UXEA 3Q5GA 1D07A 5BVHA 1VJ0A 1FUYB 5KNDD 3VQYA 2Z8YA 1XRPA 4BO3A 1B15A 1KMHB 1E6CA 2JGEA 2CNKA 2Z4SA 3JQ8B 4HJXA 3TDKA 3WB9A 2FJ0A 4YDHB 1N0WA 1GV1A 4INPA 5IH3A 4EQZA 3WQSB 1IHPA 4QYSA 3ULKA 3ZY6A 1Q22A 2GBOA 4P7KA 1S8OA 1XD9A 2P9CA 3G1UA 4RVOA 2MINB 1GQOA 3H1LH 3G6EF 1E6WA 4FT2A 3SPCA 1T3TA 2F1RA 3NHMA 3Q7IA 2O8BA 3KDSE 4H1WA 3V4LA 4ZU1X 4ZOCA 3PDIB 2O2GA 2AN3A 1Q0QA 1V6CA 2ZTHA 1VSBA 2QJ1A 1HFJA 3TKLA 1OE0A 2BEUB 2SHKA 4R1QA 1OYOA 1TK3A 1WCIA 2ZBDA 1MT3A 3W05A 3G59A 1WMBA 4INJA 2XCTB 4JBYA 2Y1WA 2QM8A 2BRUA 4ZHYB 2W37A 2HSDA 1IDSA 2W0XA 4I4NA 2CL7X 2C9CA 3NOOA 1DIGA 3WIBA 4YB8A 2G1AA 5L4LA 5IM4F 5K0NA 1AQLA 1Q74A 2FSSA 3K79A 2XGSA 5ALKA 4EVSA 1YJNV 2OLEA 1AKQA 1IEXA 4OJYA 4XWGA 1XL6A 1YRLA 3EUEA 4RVSA 2EZTA 5ITZA 2OORC 5ALHA 3WAKA 4CTMA 4J3FA 3VZSA 3U19A 4PV1B 1E79D 3D8SA 3G9TA 2GM9A 3SQOA 3ESCA 3VR5D 5JTUA 3DJYA 3ID6C 1Q0HA 2AEFA 3QVLA 2IH4A 2FWRA 4J7JA 3D6VA 3F7NA 3KSRA 4NS1A 2V7PA 4PBSA 5AK5A 4YI3A 3L84A 1ZN7A 4ZZ3A 3HYRA 2BELA 1HI9A 3IDFA 3KP1A 5J2TB 1CVLA 1H8HA 2VHVA 3FETA 3O94A 1KTIA 3ZQUA 3LX6A 2CUGA 1KOFA 3A3OA 2CXXA 1CNMA 4JUIA 4LXYA 1K5GA 1VFNA 4WLVA 2HC9A 821PA 3RJMA 4CV1A 5BWCA 2CSUA 4B43A 3N70A 3FPLA 4EMUA 5KYKA 4OH7A 4I1PA 3RVSA 3QOWA 3UJ7A 1QKIA 3H75A 5JAIA 4UCQA 1T1EA 2WFMA 4B6FA 2R79A 1PEKE 1RYNA 1EGAA 1SU7A 3G6EV 2ZYVX 2OR3A 3E1GA 3JQBA 3M4ZA 4ASUD 1PJZA 4XWTA 3CCMF 3A9UA 5I9SA 2MINA 4EFMA 4OA8A 2GNAA 3WLEA 4JU8A 3MLBA 1KAQA 4I8DA 3A9TA 3CRCA 5KAFZ 3HGTA 3F6MA 3IC9A 3Q5DA 2E76B 4G0OA 3TYXA 4BVLA 2OGTA 3FTFA 2B30A 1XU7A 3E84A 1RACA 2I65A 5I7AA 3FGZA 4TV8B 1CZRA 1VQ9V 1GTG1 1US8A 4QBKA 3HZZA 3GEDA 3KO8A 2FCAA 5EXTA 2RC6A 1IUOA 4HGOA 4MP8A 4W63A 3L6UA 2FI1A 3JQAB 3RS3A 3LU1A 3VR1A 2K5UA 3T5BA 5ESRA 4GBED 1W93A 2OXTA 4F86A 1KC1A 1GZ5A 4HAOA 1P91A 3W34A 4W5OA 2CJXA 4E5NA 1R2QA 2CLFB 1MABG 3CCRF 2HS0A 1U28A 4JMLA 2QTSA 3AVPA 1GL3A 2WILA 1E9FA 3IMKA 1JPNA 4LJ8A 2KGWA 2ZBRA 2ZUWA 4UPVA 1E4VA 1MNGA 2NWQA 3GGCA 3LE8A 1R6DA 3L92A 2R9RB 3P9YA 3R0VA 3HR0A 4KREA 1NL3A 5MN4A 2A67A 1NDHA 3IAS6 3DZCA 1T2FA 4AU1A 3QI2A 1Y4SA 2F3QA 3B12A 4F84A 3ZH2A 3U0BA 4X00A 1ZICA 4RY8A 4IDCA 1J07A 3OTGA 1ZH2A 2AG8A 1RWNA 2A86A 3GLHA 4B2YA 2FPIB 2P69A 3PHHA 2GPNA 3FYHA 4RYDA 3ST7A 5AH0A 1R9JA 4NONA 1Z8DA 4UB8Z 2A0UA 3K0CC 4DZZA 2QL5A 3CCQF 5C8YB 1S76D 1WMSA 1DXOA 1GPMA 1P1HA 2VDWB 3CC7V 3AV3A 1H0RA 2IH1C 3GBPA 2CHVA 1IRXA 1H2SB 1B0ZA 2C78A 2I1LA 3HJNA 5AJUA 1U2EA 4DJAA 1QX4A 4KOEC 5H83A 3VBEA 3IMEA 4GGOA 3VHQA 4RSRA 1U5BA 2FMIA 2UUCB 4L5IA 5AVJA 1YQTA 2P5OA 4H7DA 4A15A 3JALB 4OQEA 5JAMA 2Y9PB 4TLCA 4BVBA 4MEJA 3VR5A 2YFHA 3ASOC 1EX9A 1YA8A 3MM4A 4NYJR 5DZSA 4AT1A 1UQTA 4DILA 3R3UA 5CB8A 5LLDA 3LL7A 4OQMA 4IMIB 4GZ3A 5I5EA 4X5OA 4OFWA 1CEZA 4QHSA 1YMUA 1OH8A 3WOHA 2WU8A 1OCRB 3CZCA 4EHJA 1GPWB 4W6QA 2HF8A 3RVDA 2Y4UA 4TSFD 2X76A 1QE3A 3SEAA 1YL6A 3F5SA 5C1IA 1IBCA 4X64B 1Z2CA 5BQFA 3ZDAA 2PTGA 2CY0A 3EF0A 3O4RA 4Z4FA 3K9QO 3SZ3A 4Z5XA 4QLAA 2ONYA 2WFLA 4MV3A 2F9ZC 4G89A 4R2KA 1TCUA 2NGRA 3T1NA 4WBNB 4HXYA 4BFSA 5IZCC 4MTFA 2B8EA 4DIEA 3C3MA 3DOUA 2F55A 5HKLA 2QN3A 3HY4A 3FJOA 1L8XA 3W3AA 2AOUA 2W2XA 4QA9A 5JJBA 2YV2A 3H8VA 5I5GA 2V9ZA 4IAOA 4D79A 3NMUC 2RCYA 5B1AC 1H48A 3CXHF 3TIVA 2QG4A 2REQA 4E6EA 1K27A 1UPCA 2DFKB 1YHZA 2A1UB 3QI7A 1ZRNA 3NHJA 1KMMA 2KW5A 3GT0A 4KAFA 5BWBA 3MQ4A 4HAZA 2PY5A 1FS6A 1KEEB 2H52A 1JIKA 1ZOPA 1GYRA 2YZMA 3HCAA 4NFSA 4EYGA 2CGNA 1E4YA 5EKUA 4Q3DA 1LRKA 1PW5A 2QQEA 4TM8A 2EEZA 3DAOA 3O8QA 1VE7A 4KZKA 4RV4A 5CM9C 1GY8A 2BIFA 3BA1A 1K5PA 2Z43A 3MG9A 4TKUA 3QY9A 2QKAA 2IODA 3AB8A 1ZVKA 5H80A 3ABSB 4DV1O 3SWWA 1H2MA 1QVAA 2QN6A 3BBPA 1GLGA 3DMTA 4RPGA 5I7VA 4OHBA 4KQ2A 2XOKA 3G7NA 1BKDR 1W5EA 2V7BA 3C7CB 4LY9A 1K2VN 4X24A 2FUCA 1MC4A 3B51X 3FZNA 3H2HA 4M60A 4UHDA 5EL0A 3ZDRA 2QU8A 1W96A 2P4UA 4E5MA 2IS1A 1H1LB 1B3RA 4IDOA 1JPVA 4B6SA 5L4NA 4DPLA 4UCSA 3AKYA 1PS9A 2AEJA 1A7UA 1AT1A 3RODA 5F4ZA 3A36A 3KTFA 5FUMA 5JS7A 3FFMA 2PKQP 5BR8O 2I33A 3C3PA 1G6HA 2DOSA 2CXSA 4LVCA 1TAHA 3H18A 4DN6A 3B1YA 3CURA 5K3OA 2PYLA 2EKDA 2QE7G 1ZBQA 2V96A 1RRCA 4RZSA 2ZUDA 5TQJA 1L6IA 4GAEA 4BX8A 1UFQA 3EWIA 1MHTA 1OWPA 2PCLA 1E62A 4OXRA 1FRNA 1HDZA 3ZE8A 1HTWA 1ZLYA 4XD7A 1T2AA 3JW8A 3OTHA 1RE0A 4IOLA 2W6NA 3PT5A 2JKZA 1GN8A 1Y6RA 1I8TA 2GM3A 1Y67A 4U8GA 1F9AA 1YTUA 1G64A 3P3PA 4EFBA 1GVNB 2QG6A 5KI6A 1Y8ZA 1QAOA 2C1XA 4MQFB 1JIIA 1PRYA 1X9IA 3K6SB 1W1UA 3QFRA 4IJKA 1HNZO 3T0IA 2HEPA 1L7MA 2IHKA 3T12A 2ZZMA 1ID8A 4J2OA 4NI5A 4WSOA 4YFVA 2PT5A 3H8WA 3RKRA 2BZSA 3AEUA 3AO0B 2C0PA 2H8CA 4JFAA 2H4HA 2WU3A 4L0DA 3IE0A 1UJCA 3MGBA 4CIDA 3OMXA 3K2IA 2A59A 4KQ9A 4DARA 5DFAA 5ICFA 4JVSB 1IXYA 3D36A 1VQNF 1U8AA 4LI0A 2IHUA 1M6HA 4A27A 3KOOA 1AI7A 5F2KA 4C4OA 1SG0A 2AFRA 2OXRA 4TLEA 3VSDA 3E23A 2R4QA 2XAAA 5ALSA 3DZHA 2GHQA 4M99A 5FR1A 1DV2A 1ULZA 1ZVJA 2BT4A 4QOIA 4F96A 1RSOB 3ZX6A 3N3BC 5LVAA 4WJZA 1PGPA 4I5FA 4NR1A 1WHSB 3BL8A 4E07A 2DLDA 3QE0A 4L4YA 1QWSA 1GK9A 3TXAA 5H5NA 3GR6A 2BCCH 4U7JA 1JYSA 2J3LA 3GGOA 3UAGA 4DCMA 1GPJA 3NNDA 2HV9A 1NBMA 5CT8A 4EG6A 2NSYA 2Z5VA 1HE1C 3CX7A 4G0VA 4G85A 2HWKA 3ORYA 2Q3BA 3QFSA 3SPXA 3PCXA 4BMSA 1D5WA 1Z3IX 3AW9A 3BG5A 4O4LA 3E0QA 3LF2A 4FOSA 1L5HB 4YH1A 5IJWA 2HHLA 4RTJA 4ZHQA 1SXHA 5J59A 4N82A 3OCVA 3OQHA 4PRLA 4E94A 1PWYE 1WIWA 3COWA 5BN4A 1E0DA 3DXRB 2HA4A 3GQBB 4FHEA 4Q15A 2BFBB 3KSUA 1IE3A 3V4FA 1S0UA 5HZGA 2H8EA 1KI1A 2BP7A 1SKBA 4AJJA 3BAAA 2P79A 2JJ1G 1ANKA 2V4MA 4J10A 3IV7A 4Z2YA 3RVLA 4MSWC 1DK1A 1K08A 1SQ5A 3BMQB 4QUIA 1W40A 5EPOA 1NXTA 3W4KA 4MHTA 5C53B 1XAJA 1TE2A 3T99A 4EI9A 3SYPA 2GCEA 1P18A 1X7YA 4ZVRA 1GZHB 1JWBB 1G3MA 2WJYA 3CV3A 4K9QA 3RS9A 4RMHA 3NEPX 1AC5A 2O5RA 1T1RA 3RUCA 3IAM1 7REQA 2R5WA 2QUHA 3I4CA 2Z8XA 1XXHB 1EFCA 3QELB 4IF4A 4ZVKA 1M0EA 1Y37A 2ORVA 2JS3A 3OPYI 4KI7A 1Y6XA 3DHVA 1ZUNA 2IDZA 3PHCA 3A1UA 2UVPB 4KKXB 3ZVRA 4D0NA 5EE5B 1JDTA 4BX3A 4RTOA 2O8DA 2ZJ4A 3M4NA 4EA6A 4PDMA 1RPRA 4E4TA 2AKEA 4Q1DA 2OC9A 1HQDA 4QL3A 4DCPA 2WW8A 4EEKA 2AJ8A 3TQQA 2G0NA 4AWAA 2OO3A 3C90A 5CVEA 3ZDYB 1VL0A 4WXMA 3ZWDA 1W88B 2Y1CA 2FE4A 2GXAA 2FX2A 1YVWA 3B1JA 4Y6QA 4JOSA 3CCVV 5TISZ 2H48A 1H2NA 3ZWPA 4B7CA 5I7OA 4RUKA 4BMPB 1BMFA 2JKVA 4C7UA 2P5UA 1XQXA 4QUDA 5FWXA 1S89A 2VTBA 4CMKA 3E8FA 1TUBB 2Y3IA 3HUFA 3F6CA 3IEWA 5FWYB 2OFFA 2HRDA 3FH0A 4CR7A 2YFQA 1RQGA 2QX8A 3PE6A 4NCXA 1EK2A 3LRPA 3CYOA 2YMPA 4XXHA 1C1XB 3UY4A 5GZ6A 5HJEA 3THWB 1OX4A 3VNQA 4YP5A 5G0TA 4DVJA 1CERA 3I3OA 1AN9A 1JB9A 3IKEA 1BRTA 3I04A 1W19A 3A1CA 3QKRB 2HQRA 4KDCA 3KWFA 4NG5A 5IULC 3AHCA 5EXPA 3GUZA 4CE6A 3EJWA 3AG2C 1CR2A 1IHOA 4WAUA 1L5LA 5FTLA 1H9CA 4NZNA 3JZFA 4DLPA 2OK7A 4F8JA 1C0LA 2WE7A 2XMGA 3GOHA 5CITA 1T8WA 4AMZA 2GF2A 4Y67A 2Y2VA 1QTNA 3BRSA 3S2IA 3DF7A 4TX1A 3WLAA 4FYXA 3OJEA 3EC2A 1LV8A 3MS4A 3VAZA 1Y7IA 3DZDA 3CCEF 2OQRA 4KH1A 2PEYA 4LG1A 4N5NA 1PFUA 1L5OA 4RF2A 1NX6A 2GKOA 2H65A 1Q17A 4MS1A 5FUBA 4CC5A 1P4RA 4H1UA 3C70A 3WIUA 4DA4A 4ZOAA 4FB4A 5GZ1A 3OZCA 4DSOA 3PGKA 1NLZA 3P0HA 3CLVA 1KK1A 1CULC 3PQEA 2A84A 4HF7A 5LXTF 1JJFA 2YWRA 3OTOO 1BO6A 3ZU2A 2R72A 1I7DA 1E0AA 3CXCF 1XTSA 1QQAA 3A0BZ 4ND3A 2MMCA 4MS3B 2ACKA 5I9BA 5LMZA 1HA3A 2JK5C 1XJ0A 3DDNA 1EEHA 2X4GA 1FFGA 3EZ9A 5AOVA 1YD7A 2PD6A 3GLIB 2J9ZB 4MIYA 1UJMA 1AKYA 1Y1QA 2ONCA 2OWOA 3LLMA 1O87A 3PKZA 3PNPA 5H9CA 1TIBA 1SCNE 4RH0A 3BRWA 4FOTA 4AUMA 3VCZA 3ABKC 3BHMA 3O4FA 4XASA 1WY5A 4G0MA 4ZBMA 4MQEA 4EUEA 1U7ZA 1XVIA 3DTVB 5KOJA 1FIUA 1DFIA 1Z0SA 2GZAA 4GXRA 2XMRA 4BN4A 5IFKA 2VDVE 3ZIAD 2JEOA 1PX2A 1XZHA 3RKUA 2GA9A 2JZNA 4INOA 4EB8A 1FP1D 1X25A 3KZ1E 1H4TA 2G9NA 3RK1A 3QH4A 4WE3A 4BLVA 4GUNA 1E1CB 1CJTC 4A5UB 4K8OA 3ZKAA 1ZX3A 2HP3A 1DC8A 1IBSA 2FFQA 2RBEA 3E7FA 3EZ7A 4ATNA 4EG3A 1RYHA 3GHZA 1SKMA 1KYVA 3SKXA 5ENZA 3RFVA 1QG6A 1R8XA 3I9JA 5IUJC 3ML1A 2BFCA 1OC4A 3W2GA 4I50B 1H1TA 2X7HA 1EM8B 3PTZA 4IVQA 4K81B 1HLPA 3VTFA 2JIDA 3ZBHA 3NM5A 4FZRA 4HDKA 3PDHA 1GGMA 4J0KA 4WADA 3H1PA 1NJ6A 5AXBA 3MRVA 2BMJA 3FDFA 5ER9A 4RAIA 3UK0A 1OLOA 3PFWO 4RVFA 3WTBA 4Q00A 4TXMA 4CCSA 5JUWA 4YDRA 1ZH0A 2IDJA 3UFXB 4FYIA 2YUTA 1CX9B 1H2GA 2H7XA 1GAXA 2V7QG 4R6ZA 2C2WA 2WF8A 1Z36A 2Z1MA 4H7KA 2H8KA 2SKEA 2ZXUA 2OFWA 4K8RB 5CDTA 1G8PA 4HGPA 4B84A 4NZOA 3K30A 3UPUA 4J07A 5U4XA 4MVCA 4WCDA 1FFWA 1IN1A 3CEJA 2XMPA 4WINA 1HL3A 1Z0UA 3PTLA 4NE2A 2AYYA 1OI4A 4ZCSA 1QANA 5FH9A 1F20A 4EVQA 4HNHA 5L95A 5JROA 2GSMB 1HT1E 2HCBA 3GUYA 1VJDA 4EFDA 2DHQA 3WBKA 3UATA 1H6DA 3AF2A 3VZRA 2Z30A 3QHAA 4QU5A 2I6SA 2OORA 3OX1A 2JCGA 4RA6A 3DZIA 4J0IA 2ECFA 4H7PA 4IH1A 2Z2IA 2QAGC 3DNMA 4YCBA 3BFVA 5HCNA 4F12A 2AZDA 1AHPA 4C7KA 4CVNA 3BC1A 2ID4A 3NAQA 2QXUA 3OJOA 1TGOA 1ISIA 3ASVA 4BVFA 2GFQA 1USIA 4TM7A 1CZUA 4PWTA 2ZYHA 4TV8F 4NBSA 4EYSA 1N0JA 4JZKA 4TL6A 4EB6B 4TMYA 4ZAYA 3Q0IA 3R3ZA 2V97A 4BB0A 2R8OA 1DEKA 3TIGA 2A9VA 1BSVA 2G63A 3IELA 2JD1A 2XJ4A 1II8A 2GBPA 4MRVA 5C37A 1OBFO 1XPRA 4JXKA 4UBOA 1PF5A 2VQ6A 3Q5EA 5KBYA 3FGOA 3MJCA 4IQ8A 4JHXA 1NRIA 2IHTA 1GCUA 4FUQA 4MEAA 3RSLA 5A4MS 1CE8A 1YKGA 2BM9A 3WLLA 3HJWC 1T5IA 2J09A 2WT4A 1LJ8A 1ZRHA 3BIWA 1CEXA 1VB5A 2JASA 4US0R 2VQEO 1VBKA 4GUAA 2PM8A 1Z2DA 1QK3A 2QI9C 3A1SA 3KPJA 5HVNA 4EBBA 1F0PA 3PC3A 5A9RA 4MW3A 3PNOA 4PX2A 4G41A 3S1AB 1F2TA 2QM0A 4UQLA 1KEUA 1Y4DE 2GPTA 2VLBA 1G1MA 4FQ5A 5CNMA 3TOXA 5KYNA 4IGGA 3K20A 1SIBE 4DM3A 1L5HA 2C94A 1M1KH 1OHHG 3E1YA 1A9XB 5T6MA 3UUFA 5KOHB 5LQDA 4AP6A 4V03A 1CR6A 3F6YA 5TT1A 1BSMA 2A9PA 1IJEA 1X6VA 2AXQA 3AUTA 2WZDA 3OIWA 5IH7A 4RLQA 1YS9A 1XZNA 1XV5A 2GEJA 1KC8W 4RPJA 4TL8A 1TEVA 1KBOA 5LZ7A 3TD5A 1A9QA 2AOTA 2BFFB 5DN6A 5HF6A 2YWGA 5HW0A 2Q3MA 3N8IA 1Y3DE 1HC7A 4X61A 2KTUA 4M0PA 2P0YA 3NZEA 2VJQA 1K86A 1NONA 4DLLA 1NSTA 2H1SA 4NESA 2LBXA 5EUQB 3RC2A 3PR2B 2FSPA 5B7GA 3QE3A 1NUTA 1MG5A 2DBQA 1W2WB 3EOAI 2CVFA 2V7EA 4MB0A 5IBCA 1YULA 1ABEA 1F1JA 1V8ZA 2FRDC 3DAYA 3VVMA 3QLUA 1XNRO 2XKKA 4RF4A 5FDFA 1YZHA 1KI3A 4PG4A 4TMWA 4BWAA 4AWXA 5CA0B 4XQ0A 2R8YA 5EKDA 1S2OA 2B25A 3ADCA 3JCUZ 3TZ6A 4K6FA 1YZTA 3CUKA 4ZV9A 1P2GA 1YHNA 1KDOA 5C1OA 1P74A 5JXHA 3K57A 1U6JA 2NQTA 5ECDA 1EP2B 3RW9A 3EZGA 3UF0A 4A8HA 3U3MA 5DP1A 2HUNA 4DMLA 3IMCA 3E3AA 1Y82A 1M54A 4B82A 4LYFA 2HAEA 2BGKA 5KTPA 4FYHA 2P4VA 3QPAA 5IYBO 3RHFA 4EBFA 4GX1A 1XP8A 2ZZKA 3KYDA 1ADYA 1IXBA 1VL2A 3K0AA 3NH9A 4OHVA 2Q41A 4M36A 5CPFA 1D7OA 1FNMA 1MQ8B 1OUMA 3HWWA 4Q4DA 2QEXF 8OHMA 3QELA 3MTGA 4OJNA 5AVXA 2A9HA 3G8CA 5E8RA 1JKJA 2IV7A 5L6MB 2B5VA 1V26A 3CPHA 2ZKIA 3F2IA 4NCHA 5JIBA 3X1JA 1GEEA 2G08A 2JGAA 1XO1A 1NASA 3IULA 2VQFB 2PKQO 2P75A 4LX8A 4OKIA 3WGUA 1TIKA 1JBKA 1I4TD 2Q3JA 1BE0A 4RJKA 2PVPA 4XB1A 4J1NA 4AO6A 1O0SA 1UH5A 1UL1X 1BU8A 2B8TA 1E5TA 3EC1A 3GN2A 4QNRA 2PGNA 3RS5A 5LHGA 1V0JA 2PMFA 4KRGA 4QT4A 4DGSA 1N2EA 5JH7B 3LRXA 2UZ0A 3ESJA 2ZTSA 5FULA 3FYCA 1YAHA 3VOAA 1V8FA 1A5SB 2I3AA 1GGHA 3KDAA 4LY6A 4MITA 1DQRA 2VDLB 1SUIA 2PDAA 3FMVA 3LDAA 1BE3H 1IVSA 2HLDA 5HDBB 5LNK6 3TE6A 3ZXIA 5BNTA 5IRCD 3H5LA 2AF4C 3UWDA 5TF0A 4ZVVA 5JZSA 5KLVH 3KJZA 1XK7A 2JFBA 4LNHA 4TN1A 3AUSA 1XDDA 3A31A 4GMFA 4G4JA 4BGEA 2O8FA 3QVNA 2KHZA 3VDXA 3F5WC 2VH2A 1AZWA 3ADBA 4OCZA 5A5FA 1PK7A 3ZDQA 3NR7A 1IN8A 1P3JA 2F4VO 1U8CB 3I9V1 4M88A 1E32A 3UJ8A 4IQ4A 1YZ3A 2J5RA 3VZPA 4FNAA 6ADHA 3C9SA 3CNBA 4ES6A 4B4VA 3OM3B 2F9MA 4E7PA 4G26A 2AJBA 4RE6A 3M4SA 1HP8A 3N2KA 4Y2YA 5C81A 1RYMA 5FUYA 1C81A 1DHRA 1I1HA 1NSFA 1TLLA 1YVEI 2A6PA 3NEAA 3PAFA 3OT5A 3RSZA 2CTPA 4BZPA 3T7RA 2ITDC 2Z5FA 3MUNA 1XZMA 2XQKA 3KCXA 4JJKA 3LUHA 2JFWA 3S03A 4M86A 1ARZA 2HSZA 4TUYB 3FWKA 3V33A 2W0SA 1X77A 3FKSD 3W1VA 2CCJA 4P6VF 2PSDA 4KQ1A 4RHUA 5EBWC 1JG4A 3RQIA 4CUKA 5JSQA 3J7AC 3EHDA 3HPRA 3LF1A 1F4PA 3GFFA 1E63A 1PEAA 4L5AA 5FBZA 2X4IA 1XZIA 2J4FA 3AI3A 3OCWA 3AXTA 2GSDA 2ZUFA 1M93A 5EHXA 2Q9LA 2QVCA 3HVRA 4LOIA 4PVCA 4EKYA 2C5FA 3FYUB 1J49A 1Z6ZA 4F6RA 3P3NA 2JFNA 2FQQA 2JHGA 5FLXM 2DR0A 2NPOA 5BQ5A 4G84A 3L0PA 2W0MA 4WFQA 3D6JA 4ZTBA 3IIIA 5HF5A 3LQ1A 3TLGA 4YS6A 2ZVYA 1KXJA 3KVYA 4MVWA 3IILA 5ETJA 4R8RA 4BFVA 2M1ZA 2OV2A 5BSUA 4LKOA 3RDPA 4FZVA 4EA9A 1JDJA 3ZJ5A 1F8XA 4IDPA 1EFRA 2X13A 1T6BY 3PJDA 4KV9A 4QUKA 4R2IA 3ZU4A 1ETUA 4KR7A 3QEMA 1ONPA 2QA5A 4DV6B 4A0SA 4BIUA 1WNFA 2L6LA 5C3MA 4IH9A 2ZRNA 3A9VA 3NAGA 4K6HA 2W6ID 4QU8A 4NTWA 4HYYA 5E2IA 4BWYA 4QQKA 4EATA 4TLAA 1VRCA 5FHRA 1FDWA 1WXFA 3E9EA 4JEUA 2G0AA 2YIVX 4IWYA 1L3CA 1Z8FA 1QO0A 3G8AA 1I6WA 2C98A 3FAZA 1UK7A 5BMVF 1B2LA 1J4AA 5IWAO 3CH7A 3GEMA 4XUDA 2CJYA 1QCDA 2XNDA 5J2UB 2N42A 4C04A 5K0TA 3E20B 2FFRA 2J3DA 4S0XA 3S3XA 1Y3HA 1JDBB 1U7OA 3VR6H 3ZIAA 2FFAA 1VBNA 3U3KA 1U65A 2ZANA 3MAQA 3R5JA 1L4GA 4TTTS 2FQYA 4CETA 1K8RA 3IEKA 4C81A 4G0YA 3RVJA 5DM6V 2NTJA 1YJNF 1UBSB 1J24A 3ZHSA 1EFRG 2GN2A 4C5AA 5JCJA 2X8BA 4P7FA 4US2R 1NFRA 3JV7A 3LQRA 2OZLA 1V4BA 2NZ2A 2PSJA 2CHUA 3AT1A 3UMJA 2WD9A 3WGQA 3KUDA 2QKSA 4JXXA 4OUDB 1JVBA 1OBCA 1YA4A 1PX0A 5C7OO 2F66C 2YCLA 3ECCA 2QMOA 4EGSA 3EMVA 3RO7A 3C5WP 3E2IA 4HEHA 4G28B 4J0HA 4W1RA 5F51A 5H16A 4CF5A 2AG6A 2HHHO 3FJYA 3PUVA 1F4LA 2EHDA 4YCSA 2VEOA 3OZDA 5JBQA 5AHWA 3ZY2A 3PL5A 4L0MA 4TQ9A 1ORQC 1BHJA 1E9RA 3UNXA 2HRUA 5F2VO 1QIHA 1T8YA 3NJRA 4R8LA 4XD2A 3T7SA 2ZB2A 4G5OA 2AUTA 4Z8YA 1QRTA 1OI3A 3AVTA 4B3GA 4KHZA 2WA4A 2ZUCA 3FPAA 2OXFA 4PINA 5EQJB 1SPXA 2IYYA 4QU0A 2AMVA 3S4YA 4LDJA 2IOFK 3DC7A 3PX2A 1KJWA 3KKPA 1XDCA 3H04A 2DRIA 1OAOC 2EL7A 4BX0A 3FB7C 1NN1A 5DCVA 1Q81W 1ADCA 1G20A 4CL3A 2O3QA 5H59A 1SU8A 3ZJZA 4HWTA 3W9UA 5IM5A 3S55A 1KXZA 3KYJB 4KXNA 4WL0A 1BXRB 2CDCA 4ZQHA 2AS0A 1E1QA 4MMYB 3LMEA 1BFDA 1GKUB 1T1GA 2OWDA 3PDUA 5A05A 1K68A 3D0RA 3HFGA 4LWQA 3EXFB 3OPNA 1JHAA 3WLKX 3OF5A 3DQZA 4YYEA 3W8FA 2QWPB 1OXSC 1P4JA 1FNKA 1L4UA 2VI5A 3OP4A 2YYSA 4F5ZA 4EKIA 1Z12A 3QW4B 2VDWA 2ZAUA 2JLWA 2FX3A 1K88A 5HFNA 2O07A 1F60A 2ZIAA 3I4FA 4GYYA 4JCOA 4BFZA 2O7NA 1YZGA 3S81A 4F93B 4ZO9A 3PPIA 1SOVA 2BLLA 1M6YA 3A2FA 1QG2A 1U4OA 1WDMA 3GFBA 2NT4A 1G41A 3EQZA 2NP6A 1QHHB 1O94D 1E96A 2P2SA 2REOA 3RYIA 1UJ5A 4LH6A 4JLSA 4WBSA 4XRRA 5IMBA 1IXZA 3H3XA 4RVCA 4YBRA 2QR5A 2Y71A 4XLTA 2WJ3A 4PGGA 3DTVA 3SMVA 5B6IA 2FN7A 1PNQA 4FEYA 4DIKA 2XAGA 3CF6R 4O33A 2WD8A 4GXTA 3ZLBA 3HNPA 1GQ2A 2HPHA 5LOVA 2AT1A 2W2TA 4FU0A 4XM2A 3Q2IA 2UZIR 3T3HA 3RYCB 1QLJA 1T0JB 2A3NA 4PR0A 4XR4A 4QVIA 4CTOA 1FNSA 4L22A 2EILB 4YY3O 1YITF 1EJBA 2W93A 3R0QA 4DLZA 4AFNA 2DFVA 4JF3A 3ZYCA 2G09A 4BNLA 4C0KA 4ENWA 1YHYA 1CSEE 2NUTA 3P27A 3O3CA 1EB8A 1P33A 4I9QA 4Q66C 3RC3A 3BWVA 4RADA 3LPLA 2L0XA 4M9QA 1UODA 3CJHB 2FR1A 3KOMA 2V58A 2GPSA 1JLLA 1LLQA 1LUWA 2CNWA 3CUEF 4YHBA 3VZQA 4ALJA 1YH3A 1PP4A 2EX1A 3SC3A 2VSQA 1HFEL 2OB2A 4FNMA 2QAGA 5SY6A 4AZSA 2J6IA 3GLIE 1UP7A 3CT6A 4LY0A 3NVIB 2ZWAA 2YN0A 5K01A 3X1WA 3WWPA 3WB1A 3UUEA 3EZYA 3A37A 3IIEA 3PIDA 3JQAD 1WB7A 4PHCA 4B5KA 3FF1A 3FNQA 3KPYA 1SBIA 2FPKA 4P58A 3NXKA 5FL7D 4DRXA 4WK2B 2SKCA 5JLJA 3DVSX 3VU0A 1VYTA 2V54A 4FFBA 5LOVB 5T57A 4M1WA 2GLZA 1NFQA 2YN2A 2J3HA 3PUHA 3QJYA 4FDAA 5FNVA 2ADMA 4UU0A 2L18A 3TECE 2B4YA 4ARCA 1N5MA 4V0QA 4C29A 2FG5A 2WC1A 3L07A 3QX7A 2QRZA 4H1VA 4II7A 1YI1A 3HWSA 3LFHA 4MVJE 1LEHA 4QDUA 3DL4A 3ZTTA 2WJWA 3SOPA 1JEJA 2WZBA 2DT4A 5HP8A 1UWVA 2FRXA 3F9CA 4BN5A 1RLOA 4Z2AA 4RPLA 4XWKA 1JDPA 3HM9A 4AKTA 4PGHA 1BW9A 1JE0A 1VKRA 1NLUA 5AVZA 3LOPA 4NHEA 4M8NE 1HY3A 3KL2A 1O6GA 2H4FA 3CCJF 4FINA 2WQZA 4RPCA 3IFXA 3MJ4A 4MWDA 3WX0A 4BNWA 2ZJ8A 3KKKA 5IN5A 3VOUA 1PJSA 1RCFA 2HRQA 2ZG6A 5ALUA 3UCSC 4GZLA 1IBMO 5H9WA 4BXOB 3C16C 2A1TS 4BO9A 4DPMA 1EG7A 4PR3A 1GCIA 4MWSA 1B41A 3I45A 4HLUA 4JCCA 1CQJB 3QTTA 4CLHA 5KNCH 2QBYB 1BXRA 2VQ3A 4R7GA 3ZCCA 1BW9B 2EFYA 4E1VA 1L0NH 3C8MA 2IYOA 4C6TB 2AJTA 3DW3X 4KLZA 4PSAA 4FKZA 2KJQA 2EATA 4QDZA 1JEQB 5JXWA 2RB4A 3KPUA 4B7XA 4YUVA 3FG9A 2PUFA 2XY4A 4OXIA 2OV3A 2ZS7A 4G8JA 4KIWA 1Q20A 5T4FA 4DDWA 2PX5A 4D9FA 1N6OA 3SQDA 5I3CA 5CA3A 1AR1B 1CKEA 5B6JA 2GUWA 2JK0A 3LHFA 4C0BA 3A14A 3WK7A 3RHSA 5IBQA 3IBYA 4U4AA 4YP6A 5A4AA 2PWPA 2XBUA 4O2BA 1TRKA 4PAQA 3HRIA 3CC4V 1TYDE 2ZVQX 2HLDD 2NVBA 5I48A 2YCBA 1QHTA 4RQFA 1NI3A 3JSXA 3DL0A 4MPPA 1X9HA 1ZXLA 1G5IA 3Q72A 1XRJA 3KB6A 4G5SA 2A94A 3PDJA 5AXDA 1YRWA 3R6WA 1SHZA 1Z6QA 5BSFA 4N6NA 4TWJA 4E31A 3Q1LA 1XHXA 2BE9A 3DZFA 2XDAA 1Z16A 3INYA 2VJMA 3GVHA 4NBTA 2WSSA 1PWZA 3BERA 4N8SA 4ZCIA 3PQCA 4MUEA 3DCJA 4P7BA 1DARA 3FVRA 1XZEA 4U5XA 1YU6A 2CNWD 4V0SA 3VYWA 4ZT4A 4EJMA 2HV8A 3M6IA 3CNLA 3U16A 1DKPA 2ILTA 3GARA 1GUBA 4JLDA 4NMLA 4NNOA 4QQNA 1XZ8A 1V45E 1YR6A 3W2FA 3U44B 2R87A 1EQAA 3J80N 2CLCX 4TZZA 2LWIA 4MWTA 3MTDA 3S3WA 4OQZA 4Q4JB 2YICA 3SJUA 5KQPA 5ELXA 1JBEA 2CE4A 2R5NA 1T6XA 4Y98A 3LUTB 3D81A 4HMOA 2OO5A 2EBFX 3OFNA 3W9BA 2PJRA 4X8AA 2BUCA 2EJWA 5LSAA 1II0A 2R6JA 4YPOA 5JCPA 3KVRA 4WTOA 1ZH6A 5LMCA 1ZSPA 1EDDA 1OZ0A 1WXXA 3VNUA 1UMDA 5KSYA 3QEAZ 2KLHA 1I08A 3CS5A 1Y3FE 2QTOA 1MX1A 4OSEA 4X71A 3UAOA 3SHFA 4DT1A 1FP6A 1PR1A 1A82A 9GPBA 2H7CA 3RSFA 2XRMA 3LC1O 3RT1A 1YC5A 2Q6LA 5TJ9A 2I6XA 4NZYA 4EEQA 4AJ1A 5K6AC 5CIQA 2ZSBA 4RM2A 4M54A 4OQ4A 1CC1S 3DM5A 421PA 3NDBB 4KHPB 4H3KB 1T9AA 3R7WB 5IS2A 3D00A 1TAGA 1Y80A 4FFSA 2M7WA 1FU7A 4XH9B 4YONB 1U4NA 4ZVPA 2QUJA 5LQAA 3U13A 2I87A 2Q27A 1HYBA 2DQSA 4JTCB 1FQWA 3SHTA 3FPFA 3BEHA 2E21A 5JAZA 4RTNA 4C0QC 1J2EA 3TW6A 3SQXA 4BJ6A 4G1UC 3GEHA 1LW6E 3O3MB 1NW9B 4GYKA 1OGYA 2OPBA 4AJ4A 2HCFA 1B3QA 2AZMA 2B9ZA 2BDUA 3KX2A 2D13A 1ZU5A 1C3LA 2YVKA 3D6UA 2W11A 3V6LA 3UV7A 4I9WA 1Q3EA 2ZIEA 1HK7A 1SPBS 4LJYA 2Y69C 3PXXA 1KWGA 2YEVA 1GO3F 1D2NA 3VKVA 1MR3F 2QOEA 1TVKB 2J5BA 2BFOA 4LOAA 3SMQA 3O3OB 3OOYA 2WALA 4KFRA 4YIHA 4DV2B 3QLVA 4TSRA 1UP4A 2YRWA 1V5FA 2X8LA 1SH7A 1RJWA 4LBWA 3VYTC 1SY7A 5AW5A 2FEAA 4JKOA 1SUEA 1ZZEA 4B83A 1N0IA 1CUWA 1JFFB 4QG3A 1EDOA 2WAAA 3EGXB 3OSUA 3PQ2A 4OYRA 3HGMA 3P5SA 4JODA 1A27A 2CJWB 2WHEA 4I66A 4AMVA 4OUDA 2QX6A 3II6X 1JA1A 1UFOA 2JI8A 2K1SA 1PV1A 2D5LA 2ZJ0A 3G2PA 3KSMA 3R44A 4WASA 2EVWX 3WK8A 4WGFA 1EI9A 1NN3A 2PD4A 5F9MA 1O8CA 4DV6O 2OC4A 1CETA 2LR0A 4IWXA 4MR9B 1YGPA 1Y7TA 2GFHA 5AW1A 1SVNA 1TK2A 1VE1A 5KJCA 4RJJA 4GLFA 2OA0A 1Y3AA 1HDIA 3R40A 3IALA 2R48A 4FSDA 3EMBA 1GPKA 5DLEA 4HFRA 1KQPA 2ZSHA 1MORA 2E4AA 2WM3A 3WKDA 4CFYA 3K35A 1V6SA 1PZXA 2XB8A 1VI6A 4FR5A 1OC2A 2PRYA 3OZBA 3FVVA 3H1EA 1HQYE 3RE1A 3KU1A 4AICA 5KDLA 5ABPA 2H7VA 1NWCA 2RBGA 1MRZA 3VO8A 1XEWX 4M87A 3ETJA 4FEGA 1DBSA 2VCEA 3KVVA 4KWEA 3PNVA 1AP5A 2V65A 3L5OA 2YYYA 3DYBA 4PSVA 1GSIA 2XOKD 2EJVA 1JT2A 1CUJA 5EAIA 5ICSA 4UXNA 1PGNA 1FRVA 2WWXA 1XBLA 4IJMA 3EISA 1Q1GA 2ATEA 2C4NA 2ZB3A 4NMMA 1KP2A 3BA8A 3U17A 3I37X 2BUAA 5CP8A 4CDNA 3Q2KA 3AK2A 4JYMA 3AM3A 3EFEA 3FIJA 4FPXA 1VPWA 4R9VA 3S3TA 4PI0A 4YX9A 5T5QA 3QWAA 1SCBA 3KIPA 1KC3A 1LBSA 1H5QA 1ULSA 2VN8A 2QS9A 3LX5A 4Q4CA 4YRGA 1B23P 1M1YA