4X1YB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 144
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1yB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1yB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1yB01
4IIJA 5LOVB 4B45A 3E22A 1OFUA 3JAKB 5C8YA 3JATB 3JARA 4TV8A 2BTQB 2RHLA 3WGMA 4O4LB 5JQGA 5CA1B 4E6EA 1FSZA 3C8LA 1W5BA 3R4VA 5GONB 1SA0A 1W581 4O2AB 4U3JB 3JAWB 4EI8A 5MN4A 4M8IA 5LYJA 1FFXB 5KX5A 2Q1YA 4I4TA 3UT5A 4XCQA 4FFBB 5EZYA 5LP6A 5J2UB 4LNUB 4EI9A 2VAWA 3JALB 4I50B 4YJ3A 5BMVB 4O4IB 5EYPA 4WBNA 2R6R1 5CA0A 4O4JA 4ZOLB 4ZHQB 5EIBD 3RYCB 4O2BA 4X1IB 5IYZA 5KMGA 1RQ2A 1TUBB 3M8KA 3JASB 2GVIA 3N2KB 2XKBA 5LOVA 1W59A 2Q1XA 1TVKB 3RYHB 3JAKA 4U39A 3JATA 1RQ7A 2VAPA 2BTQA 4O4LA 2RHOA 1W5FA 5CA1A 3HKDB 3M89A 5GONA 4YJ2B 4O2AA 4U3JA 3RB8A 3JAWA 5JCOC 3VOBA 3VPAA 1FFXA 1Z5WA 3WGJA 4HNAB 4O4HB 4X1YB 4FFBA 4TV9B 5J2UA 4LNUA 5ITZB 3JALA 4I50A 5BMVA 1JFFB 4X1KB 4O4IA 5FNVB 4ZOLA 1W5AA 4ZHQA 3WGNA 1Z5VA 4IHJB 4X1IA 3RYCA 1TUBA 2R751 5MN6A 3JASA 2VXYA 3CB2A 3N2KA 3WGLA 4F6RB 4X20B 1TVKA 3RYHA 4ZI7B 2VAMA 3ZBPA 5MN5A 5IJ0B 3RYFB 3HKDA 3VOAA 5LXTB 2BTOA 4YJ2A 4TUYB 3N2GB 3HKBB 5CB4B 5JH7B 4DRXB 3WGKA 3ZIDA 3RYIB 1RLUA 5J2TB 4HNAA 4O4HA 4X1YA 3HKEB 4TV9A 3HKCB 5ITZA 4I55B 4EB6B 3ZBQA 5IJ9B 4X1KA 5LA6B 4B46A 5LP6C 5FNVA 5JVDB 4IHJA 3VO8A 4IIJB 3V3TA 3E22B 1W5EA 5C8YB 4KWEA 3JARB 4TV8B 3VO9A 5JCOA 4F6RA 5JQGB 4X20A 1SA0B 4ZI7A 4EI7A 2RHHA 5IJ0A 3RYFA 2RHJA 5KX5B 5LYJB 5LXTA 4I4TB 4TUYA 3N2GA 3HKBA 3UT5B 5CB4A 4DRXA 5JH7A 5EZYB 5LP6B 3RYIA 2XKAA 4YJ3B 5J2TA 4DXDA 5M7EA 5EYPB 4WBNB 5CA0B 3HKEA 4O4JB 3HKCA 5EIBC 4O2BB 5IYZB 4I55A 5KMGB 4EB6A 5IJ9A 1JFFA 5LA6A 5JVDA
chains in the Genus database with same CATH superfamily
1MT0A 2D00A 1O9GA 5F5NA 2WT9A 1J1ZA 1K73H 4P98A 4RIIA 1P7PA 4B31A 5H6QA 3QU4A 3SDSA 4F3YA 3DZJA 3NR7A 4EVRA 2C95A 4RK7A 2NYRA 3OTFA 1TZMA 4WGFA 3ZHOA 1M34A 3COZA 2HA5A 4PCVA 4FYMA 4OJTA 4JODA 3TLEA 4U2DA 1R9NA 1RXWA 1Z7GA 1SURA 2K6GA 3WDMA 1M67A 5AOCA 4R69A 4J80A 1OYOA 4GU5A 1TKRA 5AVWA 2CHEA 1FLAA 3GLFA 2BMAA 1L5YA 4NF2A 4CLRB 4FLYA 1TAEA 3D7KA 1ECLA 2QAGA 3PGVA 4UVIA 2HSDA 3KSZO 2RJ3A 1QHGA 1WB4A 3M3PA 1PWEA 3G2MA 3M1AA 5CD9A 2Z2IA 1P1FA 3TQSA 2OFFA 3USZA 3U3OA 1VSUA 1JCHA 1ZLZA 3E7PA 4RQAA 1HGXA 4OHMA 2IJGX 2BTQA 3HSSA 2CGOA 5DSXA 3U49A 2P9CA 4UUOA 5AW2A 2GPSA 5KOJA 1D03A 5FI3A 2QL9A 1N5RA 4NDZA 2UVDA 1IBLB 1BGWA 1P8JA 2H9AA 3WHPA 2G77B 4E30A 1ZVMA 8ABPA 2HF2A 2FTKA 1TEZA 1CHDA 4JR1A 5TB5A 1Y8RB 3R23A 3JQRA 1SEVA 1K4CC 2ZATA 1UMBB 3AW9A 3L7NA 5FBRB 2C7QA 4F6RA 3R7WB 1KZ4A 3TKLA 1R6VA 4I2VA 4WEQA 4XDGA 1VQNF 3AFNA 1X6VA 5D3MA 4QXAA 2XIQA 1L7RA 2O05A 2TMKA 4EX6A 3VPXA 5DNUA 1Y76A 4XDZA 4FN5A 2NO1A 1G8AA 1NGSA 4ZU3A 4JAAA 1L5RA 1FW6A 2R9AA 2FEOA 3UTCA 3B6MA 4C1NA 3SDLA 5DLDA 1DUSA 3Q10A 1Z8NA 1MJNA 1EYZA 1X7GA 3DHYA 4HMQA 1WHSA 5ALSA 3HABA 4D45A 2A0FA 1PO7A 3K30A 4K9OA 1BO6A 1M74A 4UFOA 4Y98A 5C93A 1GZ7A 1ZH0A 3LQ1A 3K1ZA 4UB6Z 2CCJA 1HZZC 1JPXA 4KQ2A 4Z4IA 3JD3A 2FPXA 1BHJA 2G6BA 2LP4Y 1HT2E 5IDWA 3HWWA 1UEIA 5C8YB 4DMUB 4M0CA 1ORHA 2IHJA 3GMIA 4J0DA 3A9VA 4MRMA 2C98A 1MX9A 4I9GA 1OD6A 3QXSA 1QCYA 2P2YA 3CH6A 3P9PA 1X8JA 4MTCA 2JGUA 5E3HA 1P4JA 3U60B 1Q82W 2RGBA 2HHHO 2MCFA 4B76A 4HPXB 2C0QA 1KXZA 1UAYA 2AWNA 2XUKA 3FOFC 4LRWA 2ZJ6A 4JWKA 4MQ4A 3CCVF 3LP5A 2QD1A 3KFVA 2F3UA 4GVPA 1T9CA 3U26A 1ABBA 4BLQA 3N87A 1W30A 4RVGA 3D7RA 2BFWA 1W49A 4GMKA 3OIYA 1OI2A 1W4BA 4F11A 3AKDA 5KQPA 3EA5A 3IERA 2QRHA 4EJSB 3G0HA 3ZLJA 3CCEF 1YS7A 2R6ZA 4PRZA 3CRZA 2Y69B 5C37A 3QVMA 2DMRA 1UMKA 3IC9A 3QTYA 1USWA 4UFNA 1N6RA 1VQPV 1G59A 4DOMA 4EFDA 5KYXA 4AJOA 3DLHA 2KLBA 4FGJA 1K7CA 5D6NA 5A3SA 2J4CA 3LBFA 1MTOA 2PJRA 4OG2A 5IEJA 3JS5A 4URVR 1HYHA 1QBKC 3VTAA 1Q7BA 3VA7A 4G0PA 2XKBA 1RZRD 2IHTA 4HZGA 1NXQA 4BWYA 2HXYA 4LHVA 4LNUA 4DUGA 4CMKA 5HF9A 4F9GA 2VZ9A 2BJVA 3GX1A 1K0UA 3L04A 3VR0A 3E20B 3VDXA 2PRZA 1OWMA 3TLXA 5JEDA 3KKPA 5JISA 1ESCA 3DO8A 1J0DA 5ED4A 4LJKA 4YLGA 5AKKA 5L6LB 2PJZA 1I9CA 2FEAA 6REQB 4HX9A 3DMFA 2JIDA 1OYYA 4KO4S 5IKEA 1QG6A 4KXYA 4PE5B 3VPDA 4CIBA 2XXBA 1ESNA 4EG5A 3UWDA 4JYAO 4E5MA 1KS2A 2AD1A 4WIAA 2ZF8A 1B6TA 4FOLA 4F3CA 3BC1A 3HJUA 3DR5A 1OGJA 3ZDYB 4RAQA 2VDUE 4B43A 4H4DA 5D5HA 4E12A 5AKYA 5JHGB 5BMVF 4BQIA 3TXSA 1ZD8A 5G4KB 1N1DA 2H29A 3OEHD 1H0KA 1JDNA 3NBKA 4Q7JB 3WWEA 2QX6A 2Q5IA 3WGLA 2M32A 5E2AA 1XCMA 2FMXA 3I0MA 4MTFA 5AK6A 4OMUA 4LAFA 2Q4EA 4FHGA 2C58A 4DT1A 1AJEA 1GUFA 4PTYA 4GR4A 4FYYA 1LBEA 4Y1GA 3K9FC 4DKXA 3GCDA 3C3YA 2O8BB 1VHWA 2E5WA 1YRBA 2PJDA 2YUTA 1DBPA 4YRSA 3T80A 3JQPA 1XJ5A 2C5SA 2B0CA 4AFNA 5LDGA 3RSLA 2R7KA 5GJVC 4JYPA 4PHTA 5KQLA 4GDMA 4FXOA 1T1IA 3OQOA 3CRRA 4ER3A 3GJ3A 3Q8WA 3DOCA 2H8EA 1R00A 1XQ1A 2ZE8A 4J76A 1Q95A 5JMOA 2UXCO 4D9MA 4CUZA 1XZGA 4OL9A 1S6YA 2XYHA 4ENRA 4Z1VA 5C18A 4FEYA 1WE2A 3N8DA 2PUAA 2A79B 3OEYA 1XVTA 1VJ5A 1IUNA 2XCLA 4D79A 3Q0IA 4I81A 3K5PA 2IGBA 3BN3A 4DV0B 4XLZA 4X92A 1W0JA 3ZV6A 1Q8IA 1YVEI 3FGOA 3R9XA 1MP0A 3ZX4A 3IUJA 2W0XA 3WG7B 1J20A 3DPUA 2RBGA 4IYHA 4KWTA 1IU9A 1J49A 1FPMA 2GPBA 4G4IA 1KD1H 2FZ5A 3ZNOA 4B3FX 2Q8PA 2KLHA 3AFIA 5LXTA 1PWZA 2VRWA 2QA5A 3PZRA 1L5WA 4C03A 2PZGA 4RF2A 4FLXA 1NVPD 2R4UA 4KQIA 1F0KA 5CBGA 3ZDQA 1H1DA 4DE5A 4DA7A 4DA8A 2NU7B 1MOPA 4JI1B 3T3MB 5EQTA 3PITA 2ANBA 3H0CA 2G0NA 3GLGA 3OECA 1DUVG 3GVHA 3VU3A 4E3ZA 3D3WA 1JR3E 3I6IA 1H2KA 2Q4DA 4AG3A 3OT4A 2NNWB 2WPDG 2NXCA 2Q3CA 2W98A 3VNSA 1JFTA 5EZQA 4EARA 1SXHA 2D5IA 4BZPA 2HPAA 3CURA 5IM4A 3NTVA 4MUJA 9ATCA 1XTRA 1D9ZA 4F4HA 3I32A 6NULA 3L5OA 4ZMBA 3L8MA 2UUAB 1A77A 3T7EA 3O2NA 2Z08A 3JASA 3NONA 1XYVA 4NDAA 3MCAB 3JD4A 2WALA 1X1BA 3CT6A 1N33O 5EXEA 2H8GA 4XPZA 2OBMA 4B75A 3V00A 1E4OA 3D3WB 2GVZC 3ND5A 4G5HA 2VF7A 3DKRA 1W55A 2HBRA 5MDHA 5TNXA 4XW2A 1DAMA 3DKPA 1J21A 2B30A 4TXNA 1KQPA 3KAPA 1HK7A 2O2SA 3RT1A 2GCOB 3OWOA 1KEEB 1DC7A 3QVXA 4D7SA 1TJ3A 3GNTA 4MA5A 2O50A 3N07A 3MYYA 1HWYA 2DHEA 2QTOA 5ITVA 3CCSF 5FHRA 4ZTBA 5EL0A 1S2LA 4INZA 4DMLA 2ATCA 4PX9A 3O0TA 2KGWA 3BMNB 3DAPA 4DQDA 1EGHA 3BSWA 4K6HA 2Z1FA 1XTTA 3VI4B 5DM70 1Q0SA 1NR1A 3L2OB 2CLCX 3BTOA 1RQRA 4S24A 4U5XA 3T1QA 4RUKA 5BOSA 2ZKIA 2F2TA 4C8GA 2R66A 3IQHX 3SIXA 1RFLA 5DASA 1O96B 2FEMA 2QU8A 1AURA 1GCOA 3MLBA 2ZCJA 2A0XA 1JJ2U 2NXWA 4Z1MA 3D8UA 2QN8A 1P77A 4RK1A 1BFUA 3U4GA 3B3QA 2PI4A 2MYNA 2QZSA 3LE8A 4FI3F 4LY0A 3C1OA 2Q4TA 2ABWA 2BFFA 4HB2A 1CR4A 5EWJB 5MGNA 3D6JA 5TPWA 2BMDA 4D25A 3MJ4A 1TYBE 1YR6A 3LQKA 1PFWA 5M7EA 3QF7A 3IDQA 4HMOA 5JJBA 4JHXA 1CQWA 1HEIA 1JWBB 1ODTC 1P49A 1VQLF 1L7AA 3DSRA 4EA8A 3LXMA 2J67A 1ZICA 4JITA 3PA6A 2YJZA 3AZPA 2R85A 2O0JA 1HMPA 1TCVA 1N2ZA 3HJBA 1K68A 5CRIA 1D7OA 1YVRA 4LZLA 4BZWA 3QX8A 1PZEA 2ZIOA 2AEFA 2OHJA 1JLMA 4ZCLA 3R8CA 4B7UA 3RK1A 2SNIE 4KR0A 3Q9UA 2Q8NA 1VMKA 1ULSA 1ULZA 3BJZA 5J5VA 1HTWA 2IY9A 1R0KA 2VDLB 1SZQA 1L7NA 2Z1UA 4YMTA 3L6OO 4ZVMA 3TLBA 3ZOKA 4ASUA 2ZIFA 1DKQA 3CX3A 3O2SB 1JG6A 5CBHA 3HMKA 2EWVA 2ZRCA 5AW5A 3DFMA 1Z6TA 2A9RA 2DFKB 4UBKA 4PDRA 4IOKA 1IOWA 3AGPA 3O91A 4OMFG 1FTNA 1UOEA 2VHVA 1HTTA 3RUIA 4NXNO 1A7JA 3A32A 3RSQA 2YXLA 3MCTA 2BFDB 3NHAA 1BHSA 3JQ8B 1HTBA 2QTMA 3F6BX 2B2XA 3VGJA 5JC1A 2YBDA 3DDHA 4TL8A 1V9CA 5IJXA 1HDXA 1K66A 2JGDA 2REQB 1HA3A 5BSRA 2C1XA 3O1JC 3PQ4A 1Y6QA 3CLSD 1JLHA 3I61A 1OI7A 4EX7A 3UB4A 2D7JA 3PGA1 4ZD6A 4J90A 4ENQA 3GUUA 3M4NA 1A8IA 5CBPA 1P73A 1KWKA 2HMVA 1WOMA 3EY4A 5T67A 4EUFA 5LMCA 5A4FS 5F51A 2J3KA 3RH0A 2JGDB 3NDRA 2X5OA 4DV7O 2NG1A 2XMDA 3LUDA 1V1RA 2IJJA 1PTJA 1JG2A 1O97C 3ETNA 3TAUA 2EBOA 2IIBA 1C1XA 1OB2A 5EZYA 1ORIA 3NCTA 3F0FA 4OI1A 2NZWA 1Q1NA 3K53A 3UAVA 4I8XA 4EUEA 1N9GB 1G5IA 5AI9A 4JC8A 2OYQA 1BCRB 4KVGA 4RVDA 3A2FA 5BSTA 1E1RA 2H92A 4N8EA 3Q41A 4JGIA 4P30A 4CFSA 4KQKA 2PKEA 1WAZA 2ID7A 2IDZA 1B73A 2Z5VA 3SVTA 1Y37A 2WLHA 1VSQA 3DEAA 3PFKA 4XGQA 3EDYA 2YIDA 2R65A 4MUEA 1YIDA 1CX9B 3PFGA 2EFDB 1IC6A 1QV9A 3W7AA 2O2HA 1XJQA 4WOCA 3HDQA 1WABA 3CPJB 4AJ9A 3WFIA 1OE0A 1XUOA 3EFEA 2E87A 1P1JA 5AKZA 1H9AA 2FNAA 3HLKA 2HJSA 3HWRA 1GKIA 2GOYA 1ZNQO 1YE5A 4QARA 3KFXA 4BRUA 2I5PO 3AETB 1YJNV 1E4EA 4M53A 2J4DA 4RLSA 2XLCA 4RH1A 3AM5A 1YR8A 5F78A 4WK6A 4QBGB 2QKYA 4I9UA 3C6QA 3OPXA 5CFMA 3PC2A 5ESWA 4LNHA 2B0JA 2W43A 3CPWU 3FUVA 2O7SA 2A9QA 3CIOA 3U4HA 2P3OA 4QU0A 2WV9A 1Q7GA 5D85A 5GGXA 3QPDA 3N8GA 2WZDA 4MO9A 4X00A 4EGSA 4MUKA 5LA6B 2CZWA 4HWKA 1NPDA 4L5YA 3UBMA 5CW2A 2RG1A 2P2ZA 2ZINA 1JD1A 2EYUA 1PU2A 4PM4A 3GLQA 3H1TA 1H8ED 3HEBA 3NYRA 3GI1A 4R1MA 3QU2A 1A71A 4B44A 3KPYA 1NDHA 2H8KA 2YUAA 3HA7A 4AYTA 2ZWMA 5AI6A 1LVGA 3L1UA 3DLPX 3MCZA 3AMVA 2VDJA 4PLVA 1RRMA 2D2FA 4UNPA 4KVAA 2BRUA 4FBLA 1YR9A 3R74A 1NW4A 1S0VA 2EZUA 3FDZB 1NG1A 5A5VA 5KWVA 4UUJC 4FFBA 1C3EA 4TV9B 4B47A 4PSCA 2X6QA 3CMAV 1TYAE 2DP4E 1CT9A 2APJA 3DBOB 1L4KA 5BVGB 4QOHA 3EZXA 4E13A 3U5TA 3LNTA 1LBQA 3LS2A 1KEVA 4FHEA 5ALRA 1FK8A 3BJIC 1P74A 3CLUC 2XAUA 4KH0A 4AMVA 1QXSA 4CS2A 2EX4A 3FJYA 3HJAA 2DBQA 1W85A 5K4GA 4S35A 2NU9A 4Y6RA 1ODIA 1E3DA 3GGDA 4KRGA 1FXKC 4XWAA 3OM3B 2NYVA 4HQRA 3SJAA 3DE5X 4PYLA 5JC8A 1XZPA 1G8FA 3CCUF 2A06H 3O6VA 3QE0A 2FWIA 4CF7A 4Q1BA 4NSNA 2Y3IA 5GINC 1O77A 3UXYA 5HFMA 4N3CA 4J07A 1LUWA 4CR6A 2RCVA 4ER6A 3Q87B 3FWKA 4BIIA 3C3MA 3K03A 4JOBA 1DKUA 5KNDH 1JY8A 4RE5A 4KAAA 3EC1A 1J0EA 1M72A 3G5TA 5FWXA 1SERA 4CTOA 1WNTA 4P2GA 2Z1NA 5LQUA 1IE3A 3RBAA 2PGAA 3LDFA 1E9SA 4QL3A 2JIZA 5K6RA 2R6FA 5ERYA 3GLUA 4AO8A 3WJ7A 3QKRA 1VL1A 2QTNA 1VKJA 2J46A 2L42A 2QV7A 2V1XA 3NK6A 5AW6A 3M0EA 4CM6A 3QPVA 3ZQUA 3VYTB 2YL2A 3MZ0A 5EKSA 3DOEA 3Q85A 4H3KB 2H6EA 1CQPA 1U5BA 3BSSA 2PUTA 1XRNA 3FB8C 2UYPA 2NO4A 4CS4A 2OO7A 2VTBA 1ZL0A 4BAGA 2LKCA 2WJWA 3OJFA 3F5MA 5B6JA 4RL6A 5KKCA 4J49A 1AS3A 4D4HA 2PT9A 1EB9A 3L4KA 2I6RA 4R31A 5IKOA 3AHHA 3CWQA 2O3SA 3SZUA 4FDLA 4I55B 1WY5A 3HRHA 4HH3C 2VK2A 4HDAA 2GM3A 2IHYA 1PEDA 4ZI7A 3RTCA 2KQUA 4HFJA 2DC1A 2WBLC 1NUPA 3AFHA 621PA 5IWAO 4FPXA 3IQZA 1KDTA 4RPCA 2Q1SA 1NFFA 1Q6UA 1VQKV 3L7KA 2CXQA 1FFTB 1Q22A 3OTHA 3IP5A 4IOMA 3ZWCA 1XDWA 3LOPA 2JNWA 3MDSA 2GJSA 1U04A 4I5SA 5JG7A 4D80A 1SBQA 4JGGA 3LHIA 1RE0A 2PSDA 1ZAKA 4Q18A 1XZIA 1K2VN 4IEIA 2IOYA 5FPTA 2MIIA 2JFZA 3T5AA 1ZL8B 4ZJZA 1TUEB 1C9JA 3PQ2A 2OIEA 4K6CA 3A31A 3LDHA 4UW9A 3KLBA 3VU0A 2NSJA 4ZOQI 2A5JA 4L0CA 4W99A 4PFQA 4PXSA 1XV5A 2HXSA 4ESHA 3D54A 3G89A 5ALEA 1MC1A 4IVPA 3ER8A 4PGGA 2JFNA 4IMPA 1MQ9A 4OYLA 3AR9A 4G8CA 2G17A 1KKCA 4D9CA 3WO0A 1Z36A 1BW9B 3HDTA 1E2QA 4YRFA 1AG9A 3WK5A 1X7OA 1FTGA 5CA1F 2P4KA 5GINE 3MOIA 3DKKA 3ZWXA 2NUPB 3COPA 3VU9A 4QKQA 2ZUTA 5CURA 1HXHA 5MN4A 1T2AA 5DTMA 3THYB 1CVLA 3EPKA 2CFIA 2EZ8A 3LCMA 1FYWA 1ESEA 4TGLA 2Q3BA 4URZR 3QXCA 2WTAA 1UK6A 2OAP1 3DTUB 3VOBA 2W6PA 3TRFA 2GZ3A 3OW2F 4DIBA 2BM8A 4A6XA 4MIOA 4YP0A 1S2GA 2H1FA 1UKCA 3FWPA 1DIHA 3C14C 4GOLD 3TW6A 1I5EA 5IVDA 4C81A 1B3RA 3Q5GA 4OH1A 2FR1A 3CINA 1CKEA 1Y67A 1QZUA 3LO8A 1GA1A 1XA3A 5A1JA 1Z6GA 3JARB 3R6TA 4JYBA 2P6UA 3UGTA 4BT2A 4LZAA 1SKYB 3FM9A 3CLVA 1OUMA 4A8JB 1OCCC 5JVDF 3E8FA 2P2CA 2XUAA 1SC9A 1BNCA 2CD7A 4DUYO 4NG4A 2FPWA 3C7KA 2IBSA 3UH1A 1XRLA 3NMUF 2P75A 1YZUA 5FLEX 2IDMA 1RKQA 3RU9A 4OHZA 3V4RA 3ZWQA 5TMDA 1CEZA 2I71A 4DY6A 3I1YA 3RWMB 4N65A 1GO2A 4KIUA 3PUIA 2AMFA 3ONFA 4RQEA 4K1XA 1H5QA 1QS0B 3SD7A 1F6WA 3ZV7A 3G80A 1YZKA 1QP0A 5C34B 3B40A 2VP2A 3KVYA 4NS1A 5ES4B 3K73O 4Q4JA 3GDWA 1UQTA 1A9OA 1AGYA 2PU7A 5I9SA 3FMPB 4A0SA 3IAM1 4NBWA 3L7OA 5JNWA 1JHRA 5CGZA 4CTJA 4M46A 4KLRA 3SE0A 4BIZA 3ZS8C 5A03A 2H4XA 1H4TA 2A0YA 3IR5A 1ZW1A 3HCPA 4EY8A 4GNRA 4XDKA 4GVXA 1CETA 4DR6B 3GN1A 4CLEA 1B43A 2K9PA 2C77A 3UQYS 4IJUA 2FSPA 3AK3A 4UU7A 2WYIA 2ZSUA 4RH0A 4N82A 5M5BA 1ZK3A 5LL6Y 3DWEX 2UDPA 3K8ZA 3EVKA 2QPOA 2W2NA 1F0YA 3I3OA 1QGZA 1MA0A 2ZZMA 3K14A 2GX6A 7REQA 5EPOA 2XYRA 3GFSA 2PQ0A 4MVYA 1PVDA 3ONDA 2E48A 1RLGA 1HYGA 1E1QA 1BH2A 3KQOA 5E8JA 1GUAA 1ZK1A 1MO5A 4RGYA 4I5IA 3CMEV 3ZDFA 1M8KA 1NI4B 2XUZA 3ONVA 1FDWA 3WAKA 4BKQA 1NP6A 2ZRDA 1TMYA 4F04A 3WGKA 4FS3A 3TLMA 3K9GA 4JLAA 4LFBB 1GTMA 2AOTB 5FBLB 4J4TA 4RY8A 4WNCA 4XWKA 2XH8A 1ZUD1 4DMMA 1TIPA 3UUGA 3EFOB 3FD8A 3K70C 1DAFA 3PS9A 4OOFA 2OD7A 1QVVA 1IY9A 2JLSA 4UZFA 4H1VA 4X6XA 3ZZNA 1OMOA 3QUWA 2FWMX 4U6NA 5CR9A 1A88A 2XWJI 4YAKA 1QPZA 3TECE 5JJKA 1RAGA 4Y0AA 1XJWA 2F9ZC 4TLCA 2FE4A 5U9CA 5LP1A 2GAOA 1RFGE 4O59O 5JZVA 4A9AA 2J3JA 1ZGCA 3BSFA 3EGWA 2GCGA 5HBRA 1AGNA 3QP9A 1T9BA 3TQTA 3BILA 3O8QA 3IAXA 2C2BA 4WADA 2VJKA 3O8OA 2ZETA 1DFGA 1T10A 3JWEA 4D4MA 4ETWA 5JEEA 1TM3E 4ND1A 2ADMA 2CK3G 4OPHA 1MHTA 1WPXA 5G1NA 2X0NA 5E7JA 1JB9A 5LP6C 3VO8A 4L72A 2ESRA 4JLDA 1P4SA 5I7VA 1A8HA 4DLYA 1EFLA 3WLNA 2GTIA 4XIGS 4ZQEA 3IMEA 1Q7RA 4TMXA 4AC9A 2VC2B 2QD4A 2HCTA 4DLSA 1UI9A 1SCQA 5A0TA 3EZYA 1CK4A 1OU4A 4ZQBA 4L74A 4OKIA 1H8HD 3ABQB 3AHJA 4LH7A 1G4AE 2WMNB 4HDMB 1FFHA 3KCQA 5LMUB 2EFGA 5GONA 4ALMA 5DHRA 8ATCA 4BKOA 2O8DA 3NKLA 3R8FA 1X80A 3T9AA 2VT6A 5KKAA 2FN9A 3OE7A 5DRYA 1ULTA 4K9KA 1ISRA 3SR3A 3DKVA 5MN5A 4NV1A 2IPMA 2A4KA 3I3FA 3T12A 4DWVA 1CUIA 2QSYA 1KP3A 3ZZMA 1YCGA 3I56F 3X1WA 1QQCA 2P9TA 1FJ2A 2NLJC 4WF9V 4WJZA 2CNWA 2J6IA 5KOHB 1RI4A 4BO6A 4BIMA 1XCJA 4QYWA 4XXHA 4Q93A 1H48A 5AHKA 1XD8A 3KEQA 1I24A 1SMKA 3HM2A 5JCXA 3ZXYA 2YHUA 3CCCA 4WDRA 4OGQB 4QSHA 4ZK6A 3NT2A 1U3CA 3E23A 4G25A 3D2CA 4BEVA 3JYNA 3TAHA 1FQJA 3X1XA 5CEEA 1MPTA 3BIWA 2EFYA 1NT4A 4G0WA 2PZKA 1E3WA 2BPOA 3CBQA 4L3OA 2VJMA 2OTJV 3ODGA 4AF6A 4MWTA 3CEJA 4REQB 1X7XB 1F8YA 3REOA 3U7JA 1RC0A 3LY8A 1ATIA 2GARA 4GS5A 3MFYA 3D31A 1KSHA 1ZU4A 4XVCA 4WHMA 2GKGA 4AKIA 1BDMA 1LSSA 1EWTA 1Z2AA 3V1KA 3MWKA 3K57A 3EAFA 2OFWA 2IHKA 4JQOA 1I3OA 1VJCA 3J7AC 3NRJA 1DBFA 5DNAA 1BQEA 3CR8A 2IW3A 1OREA 1YRYE 3DL0A 4RDXA 2C4UA 3RF6A 5EERA 3QTLA 4QPKA 3E48A 2EINC 2RGXA 2WKRA 2GHRA 3I04A 3V8VA 2RC6A 2YN2A 5KWIA 4YP1A 4ENSA 1NE7A 2QM7A 1GPDG 3I2IA 5EZ6B 2BFOA 4JI4B 4WGGA 5AP9A 4TVOA 3QNMA 3KHUA 1ZX3A 3TCKA 4Y9RA 5M34A 3G2PA 4L3WA 4I50B 4OB6A 1Y4SA 4LTDA 2N0SA 4M89A 1FSPA 1VFNA 1XILA 3P9IA 3L8HA 1YS4A 1VE6A 3N8HA 2EP5A 4IXDA 4EYSA 4Q3OA 1M6WA 4Q39A 1GM8A 1EFPB 1QPGA 2YC0A 3UQ8A 2WJ6A 3S4YA 4X9XA 4TS9A 1QLEC 2JGLA 4UJ5A 5FLYA 5EZSA 3AR8A 4FN4A 1ND5A 2EWCA 1JHDA 1YIJF 2VAVA 1ZUWA 5EUBA 4E2ZA 2DPXA 4R6ZA 1HFEL 1UJNA 2PAAA 1TJYA 2X40A 3PTAA 1ZGAA 4E5YA 3S03A 4G5RA 4TSFG 2VNHA 1BGVA 3ZZTA 1P7ZA 3CLTC 5FA8A 4WXHA 3TMYA 1D09A 3E5NA 3SIRA 3ZQJA 2QTLA 1UXJA 4MWBA 1ZW6A 3GGSA 3QBJA 4DYHA 1GX1A 3WNCA 5AHWA 4BWVA 4XQEA 5HRUA 4KDRA 1MAAA 2ODAA 1WMFA 2V7PA 1D5AA 4ZEVA 1VGVA 3FPEA 5CLFA 3DTTA 3I1FA 1ZK0A 4JMPA 1YV9A 4J9VA 2O8EB 3NB0A 2JBHA 4X3LA 3N2KA 2YVKA 4OQXA 4BLTA 2CE2X 3K20A 3TZEA 1YKSA 4DA4A 5EPUA 2G8LA 4EG6A 3E5RA 5GZ3A 3G0DA 5K51A 1P9RA 3QHAA 4I0XB 2E1PA 3L8ZA 1DBIA 4O1IA 3L46A 3WA6A 4DN6A 1JG1A 1IN5A 4HZ3A 1E9DA 5M04A 3DFFA 1X1AA 2X8BA 4GKVA 4RE6A 5KVAA 1W0KD 2CMFA 3QE9Y 4FOSA 2GYWA 1KO8A 2YY6A 5EAZA 2JK0A 3DXRB 1UMDB 3WLOA 3EARA 3JU3A 1RXIA 2R00C 3OM8A 1UT8A 3B2EA 2WLNA 3MGKA 1H2ZA 3RA5A 4W4LA 4EITA 3IURA 3GHHA 2C4WA 5EJ4A 4WZ6A 5K8JB 2D1TA 1D6MA 3MJCA 1SOAA 2FQXA 1YTFB 2FLWA 1LJUA 3LYAA 1CF9A 1G55A 4P86A 4KIWA 4LE0A 4NICA 4UUAA 4MUYA 5AUPB 4CQMD 5AOAA 5L3RA 2FZKA 3JQ9C 3ND7A 5B57C 1C4WA 1TAQA 5BSMA 2OL4A 1NS1A 1NL3A 3C9UA 2ZBDA 4UUMA 1JX6A 1XMOB 1J8YF 2GYUA 4RTPA 1OAOC 4HSGA 1J0BA 5F33A 2A14A 2IHNA 2UZ0A 1VJ0A 2DOKA 3TG8A 5AI8A 3SIWA 1B0AA 4EECA 4DYLA 3F0TA 4PZDA 4MYUA 3S3TA 1J2UA 2YEVA 1E7WA 1RPAA 3AB8A 4B6RA 4UEJA 1GR1A 5A7GA 4GMDA 1DAKA 3ON5A 2PNFA 3IQXA 3JXEA 4FEEA 3SVZA 4NV3A 1KEUA 1K2WA 5BN4B 3A6LA 4ZMSA 4RV5A 1G66A 4QG7A 2ZVYA 3LW7A 5LGNA 2GSWA 4ZCSA 2DQ0A 1QQ6A 1IB0A 4KX3A 1L3CA 3VJLA 3FY4A 4KK3A 3PE3A 1T1JA 1CE8B 4CH3A 3KFLA 3UFBA 4P80A 4FFMA 2H4HA 2POCA 2WIKA 1JDVA 1CJVC 1VF5B 1BS1A 1H85A 3AV0B 4ND2A 4Q7QA 4QJ4A 4JA2A 1U8EA 1YU9A 2A94A 5LDDC 3A1CA 4XUEA 4DRYA 3FLMA 1HQCA 2Q3HA 3O4IA 1WBBA 2CFCA 2VQEO 4E3WA 1HDZA 2VWGA 2JRLA 4AYXA 3U6KA 1BGXT 1RKBA 4H44B 4I1UA 3L0SA 2LUOA 4N47A 3FTCA 4RH3A 4A5OA 3DEIA 3KD2A 2NZYA 4ZJPA 4Y6QA 3EEQA 4C7BA 3OOYA 4YGYA 3H5TA 4W9MC 1HE1C 3PKZA 4CLRA 1JTVA 3QA3E 3OWHA 1DWUA 4DCVA 2AYXA 4X61A 3WP1B 9LDTA 1PS8A 3BTVA 1EN6A 3IO3A 1ZIYA 2R1VB 1M4UA 4MARA 1OQAA 3EIQA 3KKKA 1WKVA 1WF3A 3PE4A 4QO8A 5BURA 5H3LA 4XIYA 5FBHA 3P1JA 1A2KC 1CJSA 4ZXPA 2HWUA 2QRPA 4PN7A 5IS2A 1N25A 1TZ2A 1OVMA 3J7AU 4D9FA 4DL9A 3MTBA 1YVUA 4QQKA 1MO4A 1H3EA 1DDGA 3G2HA 4OHUA 4CIDA 4IQGA 1B8NA 3E22B 5AVZA 2HF7A 2YZ7A 2CT8A 4RF4A 1I01A 2R72A 1UMCB 5DOZA 4MUBA 3QFCA 3TSAA 4QU5A 4UC0A 3W7WA 1L0NH 5JD5A 2JKYA 3F4KA 2C4TA 4WXMA 4CTMA 3AVVA 1Y8RA 3GFGA 2NO0A 3T35A 5JSHA 3MJVA 1UMBA 3UA3A 2PLNA 1FJGB 4FT4A 4MVJG 4HZUB 3R7WA 3KKZA 4J16C 1JN1A 3PPVA 1QR2A 2P65A 2VH5R 4J03A 1XRMA 2QJFA 2P35A 4RQUA 1EFCA 3S44A 5TS3A 3W05A 1T3GA 1K6XA 5DMXA 2IYAA 3B3FA 3ICXA 3AI7A 4FMBB 3JVIA 4G2NA 3KE8A 2OTCA 4FNGA 3WRXC 5BUSA 2EEPA 1YJBA 1LX6A 2QB5A 1NNSA 2Q7DA 5ALDA 2L35A 1C9DB 4LHEA 4D82A 4YMSA 5IBRA 1NIJA 5TJ9A 4LSZA 2RGNC 3VHQA 4BXOB 1A7KA 1BEUB 1MF7A 4ZWNA 5I5EA 2WHRA 2P1ZA 2W2OA 3K0HA 1HSZA 5FWNA 3WLSA 4HH4A 5DGCA 2E6UX 4J3JA 1P3DA 2YN4A 3IBTA 2R8BA 3K5IA 2VR1A 3PUXA 1HEUA 1O57A 4A2WA 1TOAA 5KPDA 1TKBA 1KBQA 5F2EA 1D2CA 5TR9A 3GFBA 5C8YA 3PU6A 1F7VA 3QZUA 1F2UB 2BUBA 2WPDA 3EJ6A 4MVMA 1MZPA 1RS0A 2LR0A 4FDTA 2CXTA 4IG9A 2QX8A 1PJLA 1KTVA 2E76B 3QXJA 4F92B 2LRHA 5CVTA 3IEUA 3T4ZA 3PNBA 5LZ7A 3ZWPA 1E2HA 3SZGA 4PZZA 1N5MA 2BN4A 1BDHA 1CQIB 2ISCA 3EGVA 1FXUA 2PUDA 4BYGA 2NT4A 2XITA 4MMZB 1KZ1A 2IU4A 1DPFA 4FGWA 2GHTA 1NVKA 2CSUA 4YIKA 2E37A 4C82A 3TNLA 5FAXA 2X4IA 4P2BA 3CCQV 1HYEA 4HXGA 1Z6PA 1YMUA 3ZGOA 5EGSA 3HYTA 4DNQA 4EJSA 2I7DA 4ZVUA 2MSKA 3STZC 3ZRVA 3AK1A 3ELUA 2I2WA 1KYVA 4TKLA 3SC3A 2C4VA 1I2DA 2RGCA 1K0FA 3FAZA 3PFNA 1JP7A 2VJBA 1Z37A 1OXMA 3NWOA 4Q1DA 2CBGA 3FYUB 3OZSA 1AN9A 2O7QA 2R5FA 4IDFA 2BBWA 2PX0A 2FKXA 2JEYA 3OUFA 2W4IA 1Z0KA 3UENA 2GBLC 1W88B 4XCXA 4LDAA 5HMMA 2VDNB 3OLZA 1U4NA 3ZXXA 4J7KA 1SRRA 1Z38A 1L7EA 5B64A 2JLRA 1IN1A 3NM6B 1RZVA 3E3OA 3IJ5A 4B48A 4MVRA 1SUAA 2OSBA 3GA5A 1R10A 4FYPA 4OSEA 3W9YA 3P9SA 5H1YA 4G9EA 3K9BA 2QTHA 1ZRMA 2Q6LA 3H9JA 3JZDA 3GAZA 3TBHA 3V4OA 1Z2CA 4FK8A 1FS6A 2KB1A 5HMLA 3SY8A 3AG3C 1YZTA 3DZDA 3BWEA 6REQA 2MMCA 2GJ4A 1U8XX 3GMTA 2C4MA 2VWPA 2NMUA 3SHFA 1KMQA 3NHBA 1WZUA 1TQHA 1N8RH 2G4VA 4FDAA 4X9QA 4D9JA 2KKWA 3ORHA 3VH3A 5HZKA 3SBEA 5C8XA 5CEJA 3N9IA 5JAHA 2A9VA 4EPYA 1RWPA 1YJ9V 5FL7D 5A9GA 1NC3A 3APQA 4Q9DA 1JQDA 4LDNA 3FCYA 1UC8A 4QTUB 4IIYA 5G4KA 1D6JA 4JDUA 2R1TB 4PONA 3PGJA 3D6AA 3R9WA 1M5IA 3J81M 4GMHA 1SXJC 3G0GA 3D0KA 3C3CA 4EEKA 1C7JA 4BLRA 3SYNA 3GA0A 5GGYA 2Z9DA 3M9XA 1ZSPA 1XA0A 3F47A 2W6NA 2XNDG 5CT4A 5F7ZA 1NKDA 1BX3A 2P4SA 3KV3O 4RK0A 4P38A 1YC2A 2ZBUA 1E2PA 2HJFC 3JAWB 1YZYA 3VR4H 2HK8A 4KXRA 1JE0A 2WQ7A 2O8BA 4PCAA 2D4AA 3O4JA 4GOXA 1UXKA 2A0KA 3ESXA 1BWRA 3JWHA 4OV6B 3OBBA 4AL4A 5AVRA 2B9VA 3TNFA 2Q5EA 5C2JB 4MQUA 3EW9A 2AHRA 2EBWA 1C41A 4IJMA 2R7LA 2HL6A 5ALMA 3TSCA 1D1SA 4UHEA 2V7WA 4P7JA 3RI3A 3NBMA 3IEQA 2HIHA 5TE9A 3UN1A 3SPGA 1SZXA 1N5DA 3OZIA 1ECFA 4N3AA 4RIFA 2DECA 1NU1H 2YV2A 4DW8A 4B46A 2ZS9A 2VKTA 3A6HA 4KK4A 2VZ0A 5I7UA 3K0FB 3KKQA 4C01A 1QH1B 4BTEA 1XMIA 4BMVA 2KI5A 2VKQA 5DT9A 3HM9A 1NNLA 5KJFA 1J8FA 2XZPA 1HOXA 3QK7A 2FH5B 4N0EA 1ZJZA 4DQUA 1HG1A 3CF4G 2VAXA 4TMKA 2X7JA 2PMPA 1NHGA 1UBMS 5E1BA 2BE3A 2NU7A 3GJRA 1V2HE 2HDNB 4YAEA 3BWBA 1K06A 5LQRA 5CVVA 2I0FA 1G5TA 2LD4A 5IAJA 3GQBB 1ONBA 3GJYA 3OSZA 4NVRA 1I0LA 3PB3A 4OVKA 1ODLA 4OJNA 3NYQA 3LT0A 5FI1B 2IZ0A 3DCNA 2DULA 1Z4MA 3CC7V 2Q50A 4UMDA 3CYQA 2VLIA 2Y1CA 1EVJA 3EGEA 5BXZA 4ZDKA 2YBEA 5B1DA 3MCAA 4X24A 3WB0A 4RLQA 4MW9A 1P9OA 3DFUA 3A14A 1ZI9A 1EN4A 2AW9A 1AF4A 3L0YA 5TMPA 4KAXA 3UHOA 1TMKA 2PBRA 1VF7A 2R8OA 1YXMA 2R60A 2GCOA 1KEEA 2OYRA 2CNDA 3TEMA 3UXHA 4O4LF 2CW4A 4B2IA 4ZO8A 3JCUZ 3ITNA 1ZGZA 2H2AA 4ZU1X 2O19A 1LK0A 3FPCA 1HNZB 1AKEA 4B6SA 1M93A 1H6CA 3AR5A 1SXJE 2IF2A 4JJFA 3BMNA 3VR5A 4KP4A 3UK7A 3NVMB 3OMIB 1I94O 4Z9FA 2JCSA 1NXXA 3HKCB 1J9GA 1X8KA 3AY0A 1O96A 3Q8HA 3MTGA 1OHHG 1COMA 1RYEA 2PVSA 4OGKA 1ZZGA 1Z4QA 3MINB 4E5NA 3OCCA 5AG2A 4GZLA 3BA8A 4AP6A 1S3FA 4G4ZA 2ZSFA 1SCIA 2EBFX 5L40A 2GN9A 3ER6A 3QIVA 5EWJA 1K6MA 1KJ9A 4BN5A 1GO1A 1J6UA 2QAJA 1R9GA 3KJIA 4KL8S 5C0OE 4LXXA 1GGEA 3EX7C 1IG3A 3AM4A 5GIPC 4B80A 2JHCA 1OKKA 1WZIA 1D5NA 2YWJA 4L7VA 3RO7A 1GZ5A 1TZBA 4BO2A 3V7EA 2FUCA 2JHPA 4X1KB 4KLAA 1G21E 4RD0A 4HT3B 5HWEA 1CF4A 4DVGA 3JR7A 2V3WA 1SQ6A 1VCHA 2G38A 2XW6A 4BMNA 2OLEA 5FO1A 3L05A 3B82A 2JK5C 4R8KA 2LXNA 4UEKA 3F6EX 1NOKA 4GLLA 3AKCA 1OI4A 1XAIA 3F67A 1EHYA 3FWYA 5JJIA 3IP9A 4RCVA 2XWSA 2LNDA 1M73E 2VSYA 1QUFA 1FYEA 5F12A 1OA0A 4P31A 4BO9A 3GVIA 4IGKA 3AHFA 1PL0A 1MZFA 1YHNA 3FYTA 1YDFA 4GYKA 5LU8A 1J42A 3C2QA 3OZFA 5CLHA 2OO3A 1T9KA 2VRNA 4G85A 2VEOA 3ZDAA 3TXYA 2ETVA 4K9SA 5M2QA 4Z3DA 1ZPDA 4GWKA 1XV2A 4PXYA 3RUFA 3UHAA 3M89A 2CJWB 3LDGA 4UHCA 3CCJF 1NPYA 1FYFA 1GTOA 4HEA6 2VYCA 2BFDA 3LA8A 4P9NA 1A04A 3I5MA 3JQ8A 3ZE2B 1J0AA 4MKIA 4YEDA 1P62B 3RVBA 3CO5A 4OI4A 3M8AA 3BF8A 4X65O 1B2RA 2AG0A 4UCWA 3TDMA 1I4OA 4S1PA 1WY7A 4D8UA 4CDNA 5JLJA 4TMVA 2REQA 2CMKA 2P9HA 2VHXA 1GPJA 1O4VA 1PUIA 3SIUA 1V47A 3G2LA 1R5NA 5H9WA 4E15A 5K09A 3ZHQA 1S76D 4QNNA 2HMTA 3BEDA 5MFPA 4TRMA 2WW8A 4MV9A 3P45A 2X2OA 1JDJA 1S89A 1JQ5A 2Q2QA 3BWXA 2HA0A 4RHYA 1CN7A 4JI6O 3PNSA 1LDYA 1P1CA 2PTHA 1Q19A 3QYAA 3I1IA 3VHLB 2P9JA 1GTZA 1MW9X 3DOJA 2AB0A 2XUDA 5IAGA 1PZXA 4C1BA 1N9GA 5LC1A 4RVSA 4MV3A 3S99A 3HA5A 3H9CA 1BCRA 1C3JA 3PQ5A 4WV3A 4NXMO 4BVLA 5A9SA 3IRUA 3CWBH 2IK8A 2QSAA 3RVNA 2XTZA 1JIJA 4BJ1A 2HG5C 2ZUEA 2HMWA 3VJRA 1ND6A 1YAJA 3URMA 2XMSA 4A92A 2EFCB 4M55A 4AMGA 3ES9A 4LJRA 2JJ2G 1CUVA 4FGUA 3GV0A 1S4QA 5HFAA 3OPVA 3UWPA 1NUUA 4E32A 5K0EA 4U3JB 3TWOA 5A9SB 2WMOB 5EIOA 4Y2RA 3NNSA 2B6HA 4FHDA 3NANA 4BX8A 5EJMA 3ULKA 4DHWA 3E2IA 1TVKB 3M6WA 3BH0A 3OX4A 5DLYA 2BHSA 3SZRA 4F2WA 1V3TA 4FD2A 3CCVV 1N0UA 4FLZA 1DTEA 3IX7A 3AETA 4HQNA 2C7GA 4DUGD 1Z4PX 1S3GA 2KE5A 3AR4A 4RJIA 2Y1OA 3SK0A 1A9RA 1URFA 4S1NA 3M2PA 1ZAUA 1VQ5V 4OFWA 4Q4CA 1YXBA 4OBXA 1P6XA 2G5TA 3GVCA 4B3BA 5B7GA 2IYVA 1R27A 3WKAA 4A5UB 5LB4A 1ZUHA 5LA6A 2V7GA 3WIOA 2IJHA 3FVTA 3CUEF 5TPZA 3ABRB 1YO6A 1AUPA 3O3MB 1J5PA 3QMWA 1CLUA 5IDQA 2F7SA 2VNJA 4RHAA 5DEIA 1UIRA 2WABA 2JH9A 4C6SA 4LF7B 1Q7CA 3A1WA 3RJ9A 4HG2A 4KQJA 1QV6A 4JN6B 3UB3A 1EDZA 4LHYA 2VHCA 1PJSA 4G4VA 2Z4TA 3VR1A 3NBAA 2ZVJA 4CEIB 3PC6A 2X14A 4KVZA 1W46A 3FDZA 4TXHA 4TV9A 4WBXC 3VUFA 2HU2A 2A9KA 4V39A 3L1KA 3MG9A 5B6PA 5BVGA 4TS4A 2OZBA 2OB1A 5EFZA 1FNKA 5I9BA 4D8WA 1PD0A 5LNK6 3ZJYA 2QMZA 3GCGA 2I91A 3HB0A 3DT8A 4BY9E 5IWCA 4L4UA 1LUVA 4HLUC 1QK3A 1YQDA 4AKSA 3ZV5A 4P08A 1VE9A 1K8XB 1G19A 2UZ3A 2C4HA 1NVWQ 5SZJA 1EJ0A 3F3YA 1RQNA 2P9BA 3ZGNA 4HNQA 1DTOA 4NQ3A 2I2CA 2EJ7A 1TB4A 3W5VA 3ZU6A 3CB4A 5JD6A 1WM1A 3CWCA 1O8BA 4MR9B 5T3YA 2JD0A 3FCUB 2PRSA 2FW1A 5CVDA 3WJ2A 1KMIZ 2OQIA 2I8AA 2HPZA 3RFTA 5JFTA 2RFLA 3CV3A 3LHSA 5JCJD 5KC9A 5IY5C 5LJIA 2I3DA 4X89A 4XX1A 3W5HA 3C3AA 3WQQA 3JRWA 4G4XA 2ZANA 3GLHB 4ENWA 1V48A 3WQSB 3T1HO 5DM60 3ZE7A 4W63A 2YQ4A 3BEOA 1PJBA 3WJQA 3ZWVA 1JDPA 1ECGA 2ASVA 1T34A 4YCSA 4ZZIA 2QPTA 4NJMB 5A2QM 2H1VA 1UBNA 3ST7A 2I66A 4RABA 1KI3A 2RN9A 4PAMA 2GPAA 4IIXA 3TTVA 3LNNA 4MUAA 3R3SA 5TT1A 2PUEA 3OPMA 2GEBA 4BCBA 4UQOA 4BNDB 3PT5A 1Z5ZA 2VHWA 1FUEA 1L3IA 2VGMA 2AF4C 4YCJA 1R88A 1NHWA 1SY7A 3GP3A 1LDNA 5CFLA 1Y8AA 1OLXB 4UTNA 4QAQA 3KEGA 3ZCCA 5ILGA 4U9IS 1R5OA 4QRHA 3QLUA 4ILEA 4F3NA 1ZMTA 1EXMA 2QSJA 4Q16A 1CIVA 3HFJA 4AVYA 3E8XA 5CG1A 3G2JA 3CG6A 1GSAA 1HX7A 3IOYA 3SLRA 3OQHA 2XD4A 2GUGA 1U1CA 3LMKA 4F3TA 1SQVH 1NASA 1AR5A 4MQLA 5J9PC 4I55A 2DUWA 2QYOA 1FLDA 1E6MA 2PLAA 3OZAA 2KHZA 3R5SA 1OXBB 1DX6A 5IPFA 4ID9A 2XYVA 2E3JA 5D3QA 1AC5A 3OD1A 1T1SA 1ZVVA 1D8AA 3HP1A 4TT3D 1Z7WA 2FQQA 3L0IB 2B83A 3R6LA 1N1GA 1I7FA 4FUTA 2FSHA 3I83A 1M1ZA 4MQMA 1EFDN 5LM3A 1Z4JA 2VOJA 2VYNA 3KWMA 2XJ4A 2VJLA 3O9OA 1YBFA 3I6QA 2HH9A 2CK3A 5KVSA 5JAMA 4HNUA 1RC8A 4HPJB 4NWOB 2I6XA 4NVPA 1VQ4F 3NHSA 1KI7A 3AP3A 1DOHA 5FNVF 4R1TA 3GELA 3ZCRA 2CGNA 5EFOA 4IWNA 1Y4DE 3ME5A 4RHUA 3SFVA 1ZL8A 3OJWA 1TUEA 1U7DA 2J0QA 5KDOA 4QUHA 1A9SA 1XYGA 1E3MA 2C2OA 2KG7B 1N2BA 1CUAA 1HDCA 4N5IX 2Q5OA 3OF2A 1PSZA 1LQ2A 4ZQFA 2GAIA 2HS4A 1P18A 3CCSV 2IWHA 2JGEA 4GBMA 4LYYA 3EEIA 1M10A 1ZWLA 4HDKB 5AW7A 3D81A 1AX9A 1GQ2A 1BW9A 2VAWA 2CBXA 3T0IA 4PSVA 2NUPA 3MAQA 2VQ6A 4OHFA 4NU6A 1SVWA 4IGAA 4PI2A 1QANA 3OOWA 3THYA 4UEWA 1F7YA 3B1VA 5ITZB 3P3NA 4AD8A 3Q12A 4HF7A 4HL6A 3B1YA 1GH6A 3LX6A 2OHOA 3E9QA 4FYWA 3U81A 3CCMF 2CFOA 5A5GA 2RJZA 3RS3A 4N41A 3ZD6A 3OG9A 2Y1FA 4DIDA 5CHEA 3P9RA 5JSKA 2QENA 1UAGA 3WB2A 5E9QA 5K0FA 4BASA 1SQQH 1DNPA 1JE1A 3ER9A 4M0EA 4U7GA 4LHWA 3DYIA 2P4VA 5HPYB 5FR1A 3V55A 5ICFA 3JARA 4UTVA 3ZWOA 3NOOA 1UPBA 1YI0A 3VOTA 721PA 2V54A 3W8EA 6GPBA 5CA0F 4R8SA 3PC8A 2JGAA 1M2NA 4A8JA 4DXHA 4BNVA 5EI5A 1F3LA 2FN7A 2WJJA 3W5UA 4WFGA 1W5TA 4D96A 2D0DA 3A0BZ 3PPXA 3RB8A 1E2FA 1T0JB 3N5CA 2PSSA 3DXYA 4YUZA 1I10A 1OWOA 4OREX 2Q8VA 1NJ5A 4X95A 3VI3B 3H7AA 4ZAFA 4MVOA 5DYNA 5L3ZA 2ZRNA 5L3EA 4R50A 1O9BA 2WUWE 3VC2A 3KVVA 3AJ8A 1YJ8A 2AZ0A 3G5UA 3ZU5A 4RZ3A 3A0UA 4R68A 5A9TA 1QS0A 1XDGA 1T9DA 2NN3C 3VX3A 2I9PA 2PHZA 3TTYA 1XL6A 1DOZA 3H1FA 1JJAA 4RVUA 5EP3A 2HMSA 3VQWA 1JZTA 1XT6A 1A96A 3ZQ6A 2EVWX 4M9UA 1LR1A 4YV2A 3FTFA 3HXKA 3NIGB 2I33A 3GN2A 3OI7A 2GVIA 4KNYA 3LX8A 4ZQCB 4GI3A 3RARA 4Q3EA 3CSUA 3CEHA 5I9IA 4YN3A 3CZRA 3ETCA 4EKEA 5AUOB 5EP1A 5HZHA 2GSDA 2PPLA 5AXCA 5SICE 2PX4A 3B1FA 1P0IA 1WXDA 4K40A 2Z2ZA 3STYA 1SHTX 3JZMA 2YVQA 4US0R 3SDZA 2GF0A 2FW8A 4A1FA 2G9ZA 3I37X 3TR6A 2QD2A 2JKVA 2FE1A 3R3WA 4LV6A 3S3WA 2PYJA 4WN3A 1U3WA 3RV3A 1NI4A 4ZCTA 4MJLA 2HPVA 5A2GA 5EB1B 4QXRA 3AVXA 2NO6A 1J2EA 3ZE8A 1GL3A 3FFMA 3IVMA 2FRDC 3LQRA 2AOTA 3IVXA 2OECA 4GXNA 3OKPA 5KSOA 1QIDA 1OZ0A 4N3BA 2VK8A 3T9CA 1QORA 4QYTA 1SZPA 3W2EA 4G36A 2GPWA 2WLJA 1ODKA 3EFOA 1TVCA 3A1EA 2W2KB 4CCSA 1HR0O 3M8KA 4K8ZA 5G40A 4YQZA 2E4ZA 4OQEA 3D8NA 4MA4A 1ESDA 5FFNA 2VT7A 2F23A 5B1SA 4DM3A 3T4DA 1TNDA 3QNEA 1PF7E 5CAEB 5HVNA 1FBTA 3RUEA 3S1SA 4CZ2A 5AVJA 1T4BA 2CLLB 2X3YA 2N04A 3RIMA 5THQA 5KTSA 1NNUA 1RBZA 1SPBS 4PHGA 3U7GA 1KY3A 4EYEA 2PTGA 1H2RS 1ID1A 4MPDA 2DWEC 3AM3A 3BXOA 1CQJB 1CY6A 1RCFA 4PFSA 4HN2A 5F35A 2Y1LA 2RI0A 1EA5A 5I47A 1RYBA 2IP2A 2A3QA 2J87A 5T7BA 3FIJA 2AC7A 3PBKA 3P2MA 3UMSA 3VMMA 2W8BC 1YCFA 2P1DA 5LKAA 5I3ZA 1KVQA 5EWMB 1ISMA 3PT9A 5CBKA 4C22A 1SM4A 3W8DA 2ZAMA 2GEDA 4A82A 4PNPA 1KI9A 4DMGA 4HVLA 1LSUA 1DRKA 3I73A 5CK5A 2GM9A 4XPIB 1OBOA 2CYAA 1XZEA 4XEHA 1AGPA 4X0EA 4P35A 1T2NA 1RA4A 4WUVA 3FTDA 5CLIA 1DC3A 4HDMA 4F5DA 3OU2A 2CYCA 4NU8X 4FBMA 4WTOA 1PJ4A 3S1LA 3M7MX 3MLEA 5B3SC 2HHCA 4EOGA 1IQUA 5IT5A 5JXHA 1AUQA 3C3JA 2OQVA 2A30A 2F1HA 3WHIA 2R8XA 2P30A 5FUWA 1NBME 3C8ZA 2W2PA 1ORRA 3DVLA 1G3MA 3P7MA 3BE4A 2QVCA 4TWIA 3IEXA 3DZGA 1XROA 2AI2A 1MKYA 3GPIA 4QHTA 3SU8A 3T2MA 1F51E 3M1YA 4ZOCA 3E4CA 4L5AA 2XOKA 5KOHA 3LGXA 3M4JA 2WYUA 4J0JA 4ZYWA 2B2CA 3HJTA 1MORA 1BWSA 4M36A 3OAAD 3WR5A 1QYIA 1Y8QB 4B84A 5AICA 3T1NA 4KB5A 3T6KA 2D8AA 2LGWA 1PFQA 4HJRA 1GXSB 3SYMA 5A4AA 1O03A 1IBLO 4KUGA 4XGNA 3N1UA 4BUCA 4CQJA 1T8PA 5CK4A 1H38A 3AONB 5A5FA 4GX1A 4CCYB 1MCZA 4REQA 1X7XA 2RHTA 3FUUA 1ZN9A 5FUMA 3VH1A 3SZLA 1QVZA 2E5LB 3TRHA 5B2FA 3HZHA 2E7ZA 3E61A 4UCVA 1M1NB 1Y3IA 1QP4A 1GO3F 1C3OB 1ENOA 2PS3A 4GSLA 1EK2A 1FCJA 4F38A 3W2TA 3WBJA 1RRVA 3CPHA 1KYQA 1DC6A 3UCEA 2FDCA 4JYYA 4BFUA 2ATVA 3SYOA 5H7XA 4NOLA 2O6LA 3K59A 1V8PA 1L8DA 1OFUA 2O14A 3FTEA 4PGFA 5DXAA 4O6VA 2H1OA 4RSMA 5HZMA 1NBOA 2DT8A 3U31A 4MPJA 2EW2A 2GM5A 1A4RA 3U1VA 3CCUV 4HY3A 2RGEA 2E82A 4O2RA 1IQPA 4FGSA 2JJ1G 2CDAA 4DG8A 4K8RB 4MGEA 1U3PA 3DOOA 3WLPA 2OCHA 4I50A 2DAPA 2GXQA 4QULA 5HF8A 3QUCA 2PX8A 4Q1FA 4YR7A 3SG0A 4GQAA 4M37A 3VOAA 1HEYA 4OXRA 4TUYB 3F6RA 1F14A 1VQMV 3N2YA 1EFPA 3UF0A 3IUMA 3ZE0B 1RSOB 4D6PA 2O5CA 3W1WA 1SOWA 2R5NA 4DIEA 2IH1C 1QQBA 1RPRA 3UM7A 4PQFA 1QDEA 5EJ8A 4PHHA 3DMHA 4MTGA 4O2LA 2YMPA 1H42A 3PQ3A 3S8MA 5KNCA 3C3TA 2QRNA 1AHNA 4MVJA 1Q1AA 2AMLA 1Y0BA 2XQFA 4F60A 4JBIA 4CM1A 2YIAA 1GAJA 2RGAA 1IN7A 4MA0A 2ORWA 1NVUQ 1NZFA 2F17A 4MVCA 3WHLA 3NALA 1XALA 2C88A 3CT4A 4UARA 2ZIAA 2HCFA 5DLEA 4FSXA 4K46A 1M9NA 2XB2A 2ZB7A 1LS6A 4EKNB 3NORA 3N4ZA 4AJLA 8MHTA 3CR3C 1SC1A 2VTEA 1TRKA 1VLLA 1RACA 1T9HA 3GIWA 1XN1A 4EHHA 3CKLA 5TQ0B 4HVTA 4PPFA 2O48X 1V8FA 1IZYA 1ZUNB 4PZ0A 3N2GB 5JZOA 4KHPB 2GFQA 3GJZA 2O8EA 2V9CA 2Z2JA 4DMCA 4YJFB 3GRUA 3D54D 2HLDD 1YI2V 4V0ME 3B8HA 1T15A 4UCRA 1M7BA 1NI3A 3ND8A 4L87A 5FPSA 1TW3A 1A76A 4FZ5A 3BL5A 3VH4A 4JFAA 4I0XA 4PTLA 5H70A 3L6UA 4DR1B 4JKIA 4W82A 4ZJUA 1MNGA 1KY4A 4TTTS 2Y2UA 4CMHA 3AHDA 4K3AA 2CL6X 2RKBA 2WD9A 3W4KA 3P9QA 1N7HA 3JWIA 1SOUA 2BDUA 3ZCXA 4O2AF 2WG0A 4TMZA 1IYZA 4EPVA 3IS3A 2ZRBA 4UM9D 5TF0A 4AKHA 3DDSA 2PRIA 4H9GA 3DXRA 1C4OA 3OCJA 1ZVJA 1UMDA 1BG6A 4BV9A 4PPQA 1D2AA 3TW0A 3CEIA 4N49A 1B1AA 4RPHA 1GA4A 4RIEA 4IUDS 1NV8A 5E4FA 2BMVA 1JA8A 3S7ZA 2HFJA 4DR2B 3DS8A 3ASNB 4S0XA 2WAAA 1MG1A 4PAGA 1YFLA 3U4QB 1ZH6A 1QOPB 1XU9A 5FTWA 4EI7A 5T57A 1NTZH 5DTQA 4MUIA 1VB3A 3DLAA 1VZ2A 4LN1A 1VPVA 4NTZA 3BG5A 5KI6A 1V55B 2FFRA 1FFWA 2HRRA 1JHPA 4TLAA 4EYOA 1WXEA 3ZIAG 3CUTA 4GP9A 3MMZA 2WEKA 4EGJA 3VSEA 5JADA 3MMNA 1Z4IA 3MW8A 4W5WA 1FYJA 2DPLA 1Q16A 1XK7A 4JLJA 1J95A 3K7EA 1G16A 4DEYA 3WLKX 4AW9A 3UO2A 2DLCX 1A82A 2ZI7A 3CUUA 2JIBA 3CNBA 4I5EA 1ISIA 4GLOA 3IV9A 3DQPA 4B3DA 1N34O 4NR1A 5BN4A 2BKXA 4LBYA 4YIOA 2ANCA 4K2HA 1ACJA 3I9JA 2QMHA 1WN7A 2PR2A 4ISCA 1DGQA 1JHMA 4J1TA 4XASA 3NVKE 1CE8A 3P4XA 3ZLTA 2D1FA 5BMOA 4BIUA 2QRKA 2QTGA 3F5TA 1QLJA 1GP2A 1BJRE 1Q7EA 4I4TB 3O2JA 5BV0A 4CM5A 1VIYA 3I09A 2QM0A 2BR3A 1GV1A 2C61A 4HATA 2ET6A 3R3HA 2EX0A 4DNOA 2GN8A 3TOXA 4JAUA 4ZVPA 4LF8O 2PA0A 2HB6A 1FE8A 3W79A 4HH0A 3FH0A 4TVSA 1VLJA 4QO7A 4M9ZA 4WW0A 4CTNA 3C70A 2HOQA 1R3UA 1IHPA 3K9QO 4DV0O 2R1VA 2I65A 4MV6A 3ESZA 2J7PA 2ZJZA 2QM8A 1DIBA 3RWOA 4UTRA 1JW9B 1SK8A 3C98A 4ACBA 4M1KA 1LDEA 2WQZA 3V32A 1TCUA 3FB5C 3HJCA 4DNXA 3G8DA 4ND4A 5EQFA 4AMBA 2H1LA 4X3OA 3W6NA 3MRSA 3WYBA 5B5SA 4L1KA 4C87A 2OZEA 1L1EA 4TYNA 3T7RA 2XNDA 4FS8A 1DX9A 1QQ5A 1KI2A 5I6DA 3AGKA 4D8XA 3EIWA 3C0KA 4JI1O 5KNBH 3TTSA 2XAFA 1OX6A 3E22A 3KC2A 2CE4A 3V48A 4UREA 1UMCA 4JBNA 1HDGO 4IUBS 1GRCA 1Q21A 1AZTA 4XRRA 4OYYA 4G0MA 5CT5A 4YRJA 1YDWA 4HZUA 2UUAO 4D0RA 4AY4A 1QCEA 2H1RA 2Y92A 1EAYA 3HG7A 5EO3A 1IV4A 4MGYR 2YMLA 5CH5A 3DC6A 3EWAA 4MTLA 2DYSB 1WQ3A 3MM4A 1WWKA 3ELCA 4MVZA 1COZA 1V35A 2GYYA 1VLQA 2PQ2A 4MPPA 5I48A 5JXIA 2A0WA 3RDPA 3VDMA 4UUQA 3EVNA 1DELA 2HFEC 4CQLB 2R9RB 2EGHA 1HFJA 3BMOA 4QBHA 3G82C 1J39A 5D1HA 1GRNA 1OLOA 4G0XA 1AQUA 2JATA 3FGPA 5CJ2A 4BXOA 1YHQV 4EHNA 1Q7YH 5COAA 2UUCB 3GNSA 2RH8A 1Z6AA 4NJOA 5FOUA 4TZZA 3BXHA 2CZQA 2G9RA 4UTPA 4RADA 1JFSA 5CCBA 4YUVA 2V8BA 3U13A 1LZKA 4PLPA 4D4KA 4BWAA 3VZPA 2O9JA 4CVNA 1F2UA 2I6UA 4FMCF 3BMOB 2GFIA 4HWRA 3UGKA 5DTIA 4XQCA 4BEJA 4YGXB 3VV2A 4HUTA 4X7BA 4S3MA 5AKGA 4FU0A 3RRZA 5LDHA 4UBMA 1GAXA 3HJWC 1KEZA 3SIVA 2OGUA 1T1GA 4L8GA 1O95D 4PO9A 5CT6A 4ER5A 3BWCA 3QPCA 4NQZA 1CQIA 1XMQB 1O3YA 3N3BC 5TXGA 4ZCMA 1SUFA 3IOCA 3LCJA 5K99A 4U0JA 1XL0A 2YOGA 4GBJA 3HAXD 3MS2A 3W1EA 3AHGA 1ZM3A 1FAFA 2G1KA 3H8WA 5BORA 2ATKC 3GBSA 3FI0A 2F1JA 3RFUA 3AUKA 1PR6A 5AFSA 1WETA 4KFCA 2GN6A 1G1MA 3TTWA 1S2IA 1IHDA 2IZ5A 2ZJ5A 1TLFA 2GR9A 2KPOA 4F4IA 3QVKA 1BE0A 2H00A 1V43A 2GWRA 1FEZA 2PLRA 2PJUA 2DTEA 3WGJA 3F6MA 2PZEA 3S68A 4F5WA 4QYXA 1N0WA 1MXHA 1UP6A 4AJHA 3E9EA 3DBRB 4ZZ1A 3FYUA 1Z0IA 2OLKA 1ST2A 4NTXA 3HY6A 4I4IA 3M5WA 4URXR 3CSXA 1USIA 1ZNYA 3T94A 3GAMA 2JLBA 2RH5A 4HLDA 5IJ9B 2WA3A 2YN0A 4OP1A 1W88A 4C6TB 4R9SA 1D2DA 3A4MA 3E70C 1ZA2A 3NHJA 4TLDA 2AJBA 4L8LA 1AF7A 2WWIA 3HUDA 2BV3A 4LMAA 4X84A 4II2A 3D6HA 3A11A 3QEKA 4A2PA 2JEXA 4KREA 3U4IA 5IF3A 3OUTA 3PUVA 4I7ZB 1YZBA 2OM6A 4X64B 2PD6A 1Q44A 4Y18A 3WOHA 1HP8A 1GN9A 3DONA 3W4JA 3UJCA 2ECFA 3BXFA 2C9DA 2P4UA 1N6OA 4LTMA 4YJHB 3F9IA 5T4FA 3ZEIA 1J0CA 4KO8A 3CWZA 1CUEA 4IIGA 3K6SB 4UMVA 1XZDA 1AUOA 3TGWA 4DMRA 2QTTA 3F7NA 1IV1A 4HK4A 1A5BB 5FLXA 4HGOA 5B58C 5LZ8A 2AXPA 4RVOA 3V7UA 1M90H 1Z08A 4NJEB 3ZWMA 4R6WA 4C5BA 3L73H 3IR7A 4LFAB 1R8XA 3WPWA 4E5UA 1YNSA 4R0VA 4B6PA 3H4TA 1C2TA 5I7OA 3E84A 5AW0A 1YDXA 4A0QA 3U3RA 1HPLA 2NZJA 4XD7D 5F1KA 3AO0B 4PLZA 4LBEC 2WVAA 1RAFA 3SHTA 4CTKA 1G64A 5L6MB 1RLMA 2XMCA 2R1TA 4IDHA 1UP4A 1GQYA 1VL0A 3OZUA 3O8CA 1DQSA 2WJPA 2CVLA 3O3CA 4IQ0A 3TFQA 5KHHA 4G89A 4ZALA 3CHXA 4R2XA 4Q7LA 4ARBA 3SZMA 5J3JA 3MJDA 2X0KA 3OD4A 3NC0C 3JAWA 1ZISA 2ZVPX 1S2OA 1PYGA 2ZM6B 1S8AA 1AOXA 3GOHA 3LUCA 5ISMA 1KY5A 3BAAA 1FTQA 4N9QA 1GFWA 2O2ZA 3F73A 2F1RA 4FXPA 4HS9A 2W6OA 1VP7A 1OTYA 2OWEA 3PHCA 1LNSA 4JXZA 3ESCA 3L49A 5LUBA 1J8VA 4GRDA 2OCCC 4ZOBA 4CIAA 2QIPA 2AG1A 4XQ0A 3ACDA 2PXCA 4KNVA 2ZQZA 2YIBA 3CW2A 3FPHA 1O89A 1FS5A 2FP3A 1YIJV 1KYZA 5K3DA 2NNUA 1P4RA 5IJAA 1SXGA 3RC3A 5LLDA 3UUFA 3WK9A 3RUCA 4PDMA 1ONSA 1EDEA 1KFJB 3K1JA 1A1VA 3HB4X 1DV2A 3K0FA 1GDDA 2UUOA 1QH1A 3C8HA 2QQFA 4HOYA 4RD3A 1UK7A 4HRXA 1PLKA 3F5QA 5HKKD 5DO9A 2NZUG 4MW1A 2BAGA 4M88A 1EN5A 4HDQB 4EKYA 4NKGB 1GTSA 3ZOPA 1ICIA 1EUQA 2GYVA 4YJ2F 3R9IA 1Q11A 4N48A 1JJOA 2W2TA 2RG7A 1Q0RA 3GY0A 121PA 3MVEA 3IYLW 3ROTA 2F9MA 3GQBA 2Z0AA 2IODA 3GFVA 4I3HA 4EUSA 2VNIA 5KJCA 3ECCA 1ODCA 1ZIOA 4BQOA 3SF0A 5HM6A 3ZU4A 4DKJA 4R9RA 5CDFE 4HDOB 5J1TB 2UXNA 4MHOA 4I1YA 3W77A 4MCHA 3D5TA 3RHFA 4QTZA 1RDFA 4O4JF 2FWBA 4UHJA 3A0HZ 1SBHA 1QDLB 2XNHA 3ZWAA 4G97A 2VHUA 4X8AA 1RQGA 1HDRA 3L8CA 2HEPA 2YZGA 5BWLA 4F9EA 3RCBA 1GRQA 1H4VB 3QHQA 1QH9A 5AJUA 1T0HB 3Q4HB 4ALIA 1E6KA 3CRNA 2X5JO 1K8YB 2HMYB 4EY7A 1EA7A 2PKRA 2Q5LA 3NWJA 4PINA 4BV8A 2I4NA 3HZRA 1U1EA 2UYOA 2IEDA 3AL0C 4JT4A 1YUMA 5JV5A 1D4FA 3JZIA 4K6OA 1QP8A 3ZQ4A 2W0FC 1L1FA 4AZ3B 4COKA 4F4UA 3M1LA 3HKCA 4L4XA 5ESRA 4RS4A 1L5SA 3AK2A 1YL7A 1I9GA 4W5HA 2D4HA 4XGKA 1K9MH 3MINA 4P53A 4RM3A 2YJ6A 4NBTA 1AN0A 2ORVA 2NLOA 1OGYA 3LVFO 2IYWA 1ZK4A 4JQYA 4D02A 1N9KA 4NE2A 2Z0MA 4PWTA 4YAUA 1T1EA 1CYEA 3NC4A 4B7AA 4Q3AA 3VSCA 3VSDA 3DDOA 3O84A 2OXIA 4GOOD 1QHFA 3DEHA 3JY6A 1BVHA 3QWFA 2M6SA 4DS3A 4PS1A 1WTAA 1D1TA 3TB4A 5IYBO 4YCBA 3DBVO 4NOJA 4A7PA 4X1KA 1XRPA 1RYNA 1UJ5A 4LCUC 4OHCA 5JH7F 1NN0A 3SQNA 2P68A 4PC2A 1E92A 5KTKA 3BREA 4DAEA 1DQNA 2ZRPA 2NXNA 1YF3A 3ROXA 3FBWA 4KN9S 3TGLA 4N54A 4MDYA 4H7PA 3QBVA 3V6MA 4AWBA 4RAOA 1NPTO 3G6KA 1KYIA 3KQSA 1BDIA 4K9QA 1IXRC 1NRIA 1K3TA 2HBYA 3FFTA 2PWPA 4LMRA 2PBLA 4P4UA 4IKOA 1UADA 3RT9A 5I9LA 1G7TA 4EPXA 4HB0A 3WC4A 2V0CA 2C5LA 4BNMA 4CMIB 1UBSB 2PIDA 2G1PA 5FWDA 2R4TA 3C3KA 5TMBA 3RD5A 2CJWA 4MH0R 1BXZA 1V3VA 1W36D 5KYUB 1MB4A 3Q98A 4QOJA 3PLRA 5GMOA 1SJ9A 4A8TA 3BB3A 1LQTA 5K45A 3QO5A 2AJTA 4ITUA 1THGA 1JHZA 1KR2A 1PFYA 3OZGA 1QOZA 1K88A 2G06A 3KVNA 3CU5A 1J2YA 1TD9A 2W6JG 1R6BX 1X1DA 5HJ5A 2D0OB 4OQFA 1JEAA 2J45A 5HP8A 3MS7A 5IVPA 1P45A 1RWXA 4CLXA 3FA2A 3HPRA 1U63A 2VDPB 1SHLA 1X2BA 4JV5O 1PJAA 1UOOA 2KSQA 1KQ3A 2ZNJA 2QDXA 2EIJB 2ONJA 3FCAA 1FPQA 1VA5A 1P5ZB 1V9PA 4H27A 4AJNA 1GYQA 1QK4A 3RS4A 3H7IA 3ZY6A 3ZCQA 4EKGA 2IUEA 3N0WA 3MIZA 1VQNV 5F76A 1KRWA 1S3IA 1RJ9B 4ZFNA 4NESA 1T3ZA 3GJ5A 1A9QA 2VZEA 3L82B 1ZRSA 4YALA 2RI6A 5B4TA 1A9XB 1LDGA 4TTAA 1GAEO 4MDHA 5AM5A 2J30A 1G0OA 4D2IA 4CF4A 4YPFA 1VP9A 1CS4C 1D1PA 4H7FA 2FY8A 5FYQA 4GWLA 3EGIA 1Z2NX 1QRAA 4M8IA 2DFNA 1O6CA 2C0CA 1XZMA 5L53A 5EIBD 4K1LA 2HP8A 4FI3C 4QE3A 1UWLA 4U3JA 4G8BA 5B66Z 2VXOA 1KKUA 1JKXA 1TVKA 3A6PC 1XGKA 1ES9A 5DN6G 1KVSA 5GIPE 5HX7A 3ROZA 1CNEA 1G5HA 1A2OA 3AOEA 1KFBB 5I4BA 2Y1XA 4OH7A 3QY9A 3QJYA 2GA9A 1VSVA 1Z6ZA 4GE0A 2HW8A 3S6JA 3NHKA 2ZXFA 4MTXA 1XEXB 3DW3X 1ACLA 3WWDA 1GZ6A 5H3HA 2MSDB 4FEAA 2ZSKA 4EB8A 2QX9A 3C6ZA 5A7FA 3N59A 2V1DA 5D00A 2WG2A 3TCNA 2BI8A 3PTZA 2WF5A 3AG5A 4G0YA 2JAQA 1C7FA 1C7ZA 2P0EA 4YI5A 4FSDA 3EVEA 4EHIA 2NM0A 1N2OA 4CV2A 1BHBA 5JBIA 2KTVA 5DP1A 3JWPA 4LGVA 3COWA 4OJYA 3CCEV 4YUYA 1C9MA 1X2EA 2IM9A 4CNQA 2OMEA 2VPPA 1SG9A 3RC7A 4ALJA 2C5BA 3B9QA 1L8QA 1A9PA 4F2DA 5JASA 1EFUA 4TQ9A 2I2FA 4NBLA 4HDSB 2AKAB 4KWEA 1TKCA 2C94A 4KI7A 4AS3A 1JXAA 4ZGGA 2H2IA 1GNTA 5KHGA 5J2TF 3KIPA 3JYHA 4CEIA 4MW8A 4DR6O 4Z2YA 4JKYA 4D46A 4JF3A 1NMSA 4QIWF 1WP9A 3TYXA 2D5CA 3LWBA 2OQRA 5LQJA 3F6PA 4MRAA 4YWHA 2ZRLA 1VF6A 5D86A 4IUYA 4HWOA 3VZBA 5U4QA 4EG8A 5ARBA 4DJTA 4PX2A 1TL7C 3O4VA 2LFSA 1TKAA 4YROA 1WJZA 1X7YB 4JL5A 2HC9A 3B3JA 1ZJ6A 1NXPA 4R6XA 1XEWX 2AEMA 1MSWD 5AI0A 2YRXA 5AVVA 3NUZA 1U2RA 1QZZA 3C24A 4LFBO 1U2GC 2SICE 3II6X 4MR9A 2UKDA 4DLPA 1ZD1A 3UJ9A 1XZ8A 1XC7A 3LKDA 1N5LA 4AJEA 4Q4DA 1CY4A 1LK7A 1PEKE 5B30A 1QWOA 4D3SA 2WJGA 2MW2B 2XTAA 4M9XA 2XMZA 4GRIA 2XQGA 3IP8A 5IYZB 3GLHA 4HWGA 5C4IA 1R6UA 2YZKA 4EJMA 3PDJA 4LFCB 2ZIWB 4B09A 1CZLA 1O6BA 3O21A 1JU4A 1MHPA 3VDRA 1IEXA 2RH4A 1WCWA 2HVYD 1D3AA 1PX2A 2X58A 1S1MA 3MT0A 4NJMA 4OIFA 4G3XA 3DE2X 3W2GA 3BFKA 1IXBA 3WGTA 1V8BA 4W4TA 2IXFA 4I3GA 1P91A 4UU0A 1FZQA 2JBWA 1W0JD 1XAHA 1EFVB 4K0KB 3RC2A 1DIOB 1KDZA 3SCZA 4TVBA 1L7BA 3ABLB 1NTRA 2EBHX 3WFVA 4Z0TA 4BNDA 5FLKA 4D8VA 5C7IO 2CMHA 3K8YA 4PLCA 3EMBA 3TKAA 4G37A 1OLXA 3ANMA 2R8RA 1DAEA 4BP3A 2JAPA 2VHZA 2QM4A 1BRMA 6ADHA 4W1RA 5IUNC 2QWRB 4HN9A 3Q5EA 1M2EA 4Y2XA 3IBFA 2FFHA 4Z7QB 3IJRA 4LZOA 3TIFA 1BWPA 2Y93A 4M9RA 1OT3A 4JI0B 1DC4A 1Y7IA 2ONCA 3UH0A 3UMFA 2DGDA 4FCWA 2DUNA 1JHVA 1UJ6A 4HAVA 1E94E 4GECA 4CLOB 3PDHA 2Y77A 5DPMA 4L4SA 5JJJB 5LMUO 4OLFA 5DMHA 1TAGA 1JLLB 3HPQA 1P1HA 1YITF 3WGZA 2C7OA 1NDQA 4ZT2A 3GJ0A 5BVHB 4IJ5A 3D8CA 2O2EA 4JEHA 2A5FA 4RA6B 3R7BA 4P36A 2Y1EA 5B1HA 4QBIA 5JXJA 3Q6IA 2BTOA 1BA2A 5M3BA 2BSKB 2H94A 3PEUA 3P32A 2HHAA 3K2BA 4E5KA 4EIWA 5DBIA 2CV2A 1KI6B 1FMLA 4LF6B 1QYDA 1Z5NA 3RIXA 4DIUA 2DWOA 2ZT5A 4J4HA 5CFOA 1ISGA 1Q86H 5GOTA 2ZGVA 3L40A 5LWQA 4WNAB 3SYPA 3VO2A 4RMJA 4ZGWA 4KYUA 1IB6A 4IGFA 1HDYA 2IOFA 1B26A 1OYWA 2HLPA 2Z6UA 3OX2A 4NHOA 1VKZA 3V1YA 3PJGA 2ZBFA 3HA3A 2KG7A 3LWOC 3FW1A 2JFWA 2YXEA 1VGRA 2W00A 4MHSA 3NFYA 1QO7A 4XB1A 3T5TA 1GL9B 2OXEA 2AMTA 2RH9B 3OZVA 4HDKA 1BMTA 4Z1MD 2RGWA 3CRAA 3BSYA 1Y33E 3IVAA 3M6MD 5CG2A 4GL4A 3DZ8A 3IDAA 1X1TA 5JXWA 4OP3A 1EVZA 5KQGA 2E74B 3ITKA 5ITZA 3KBOA 2O8NA 4FYXA 4IHAA 3Q7TA 1WSWA 3AG2C 2YNMC 3TX6A 1R37A 4F93B 3F6CA 1JHUA 1CU1A 5EMLA 5B7NA 4AZTA 2IRWA 2QA4F 3AYZB 3AXSA 2NVBA 4DCUA 2YZ2A 4JI4O 4D4GA 3QVTA 4Y1RB 1YACA 2FXIA 3PAFA 1JR4A 5T6MA 3QF4B 3BJEA 1RM1C 2CDBA 1KNXA 5J2UB 3AVQA 3TZLA 3RVKA 3WXMB 3L43A 3NUGA 1YQWA 3UANA 4RACA 3AWIA 1WXIA 3ZWWA 1SVMA 3TW4A 1OIXA 1W4ZA 5TX7A 2IJKA 1TADA 3LSYA 2KB0A 2HADA 1EZ4A 1M1YE 1SESA 1QPBA 1YL6A 4UULA 2Q4OA 2EIKB 4ON9A 4B82A 3VOUA 1EMDA 4UDXX 1IJBA 3FNEA 4ASUD 2JEZA 3FPBA 1VIDA 1X7ZB 2O6HA 4R2LA 2D2EA 3WIEA 2ZU6A 2B61A 1YQEA 3EE6A 5EJAA 4NCJA 1Y42X 3WG9A 3JSAA 2AVDA 1VQLV 4FQ7A 5KSWB 3EC7A 4ZIBA 5C35A 3LL7A 4N03A 4N3GA 1WMEA 3KQNA 5HEKA 3AUYA 1V7CA 1DLJA 1W5BA 3F4LA 2Q49A 2OT3B 3MQ4A 2L18A 1MSDA 5AM4A 1K7EB 3AOGA 1DB3A 1GZUA 1FSGA 2MHCA 2JJ1A 2X9GA 2N46A 4MS1B 2OKCA 4WLEA 2XUOA 4MRPA 3RSCA 3P9NA 1TPZA 1Y63A 2QE7G 5J43A 4M76B 3WBKA 3K08A 2NMVA 4EO9A 3V4ZA 3HLTA 2QXUA 1K08A 4PHZA 2TS1A 1TF2A 1T13A 1GVHA 1YR7A 4PRKA 3CZ5A 1TCBA 4MKHA 1XRRA 3IP7A 2BIFA 1IIRA 2IPOA 3B7WA 4EY4A 3LUTB 1EP3B 3FMIA 3OFVA 1P5JA 1D6NA 3QM1A 1JAYA 3N6XA 2AHZA 4JYZA 5FADA 3EG9B 3R5KA 1XWFA 5E79Z 1M6VB 1Z0ZA 4KIFA 3O65A 1E1RD 3OT1B 3MIIA 2IFTA 4AQ7A 4IYJA 4W7SA 4KR9A 3GPBA 4QQRA 1VBKA 1PZFA 2JCYA 4XUCA 4L8FA 4H3HB 4OXYA 4GI1A 3JWJA 1X15A 1YUBA 4B3IA 1KVTA 4UDOA 4EBFA 2W2KA 1XMOO 4LYHA 2OGSA 4TSFA 2YWCA 3P5SA 4JENA 5FTMA 2YRFA 1M2JA 4ZCQA 4V0OA 3V1MA 4YPOA 1RYDA 1XF1A 2J3LA 4I1OA 1A97A 3QX9A 3T5MA 1I3LA 4V24A 5ALKA 4DSNA 1S2DA 5CAEA 2V4UA 1EPUA 1UBFA 1GJRA 2AKEA 2X6RA 1L5KA 1NYQA 1TU0A 4JP1A 1E3SA 2XKAA 5FEMA 2JH8A 2OZLB 2VPXA 2HNBA 3P0EA 1T5OA 4YLEA 2BGTA 3PQDA 5IP5A 4JI7B 1CQJA 3OUZA 4OEHA 1RWQA 2IYPA 4IG4A 2G70A 3PHJA 4AZSA 1BE3H 2OV3A 4RV9A 5AUQA 1ORDA 3QVWA 1MX1A 2QAIA 3RYHB 2ZP1A 2DJIA 5EWMA 4JWTA 2YHBA 2JDIG 1HY3A 3PA8A 2Z9CA 4X3PA 4MW7A 4DAOA 4UNNA 1U11A 1YAHA 3A70A 5IN5A 3U7EB 3UJPA 4XPIA 1GGJA 4KIGA 5C8VA 4M0DA 1UOQA 3KTAB 4N6OA 3Q6MA 3ZQKA 3UAZA 5SYNA 2G8NA 3H2BA 2NTEA 1ADBA 3NMUC 1FA9A 4CBVA 4JC5A 3EA4A 1GIAA 1RYFA 1RYYA 4BPRA 5A3VA 1KH2A 1YDEA 4W7HA 3TRJA 3I8OA 4EMSA 1VQ9F 2N48A 4F3RA 5KHIA 4K9MA 3ZIAA 1DEOA 1RQPA 3ZHZA 1RP1A 5HZGA 1CG6A 3WYDA 3UPDA 5DP2A 2ZEJA 3P2EA 1SIUA 5JECA 4TYYA 1U0NA 1SNYA 3E86A 2PN1A 2MMGA 3OSUA 4O2BF 4UATA 4YP6A 2O0MA 4MQBA 3AUXA 1MN6A 1H3NA 3AIKA 4HUQB 3R0QA 3STLC 1KNJA 1GL7A 3OTQA 4J9UE 4AZWA 1O6GA 1BTOA 1RM0A 4UQPA 2Z2YA 4CF5A 1JHYA 5L51A 2OK7A 2HV8A 4TTQA 3ELWA 3E9ZA 2R8ZA 4XDLA 2X6BA 2AZ4A 2FDRA 3D4OA 1C3LA 1Y8QA 1SHJA 4JC4A 1JQBA 3CKYA 1NQ3A 2FEPA 4OM7A 3LO5A 2IUFA 4DGSA 5CP8A 4FFKA 1XBTA 4BNLA 1GXSA 1P2FA 4XEUA 2X1MA 1WO8A 1KGDA 1EGMB 3D7MA 1IBKB 1ZQ1A 4XR9A 2VYQA 4CCYA 2IYEA 3KBBA 2EDAA 2D3TA 2ZIXB 4U4AA 4LOHA 1FJGO 3HLYA 1PYOA 5C7LO 5IULC 2H9IA 2C9CA 3UT6A 3L75H 4Z53