4X1YB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 144
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1yB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1yB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1yB01
5IJ0B 5EYPA 3E22B 5J2UA 3RYFA 4I50A 5EIBD 1FSZA 1JFFB 3VPAA 5C8YB 4O4LA 4F6RB 5CA1A 5JH7A 1TUBA 1W581 4YJ2A 3HKDA 4IIJA 4O4IA 4ZOLB 4U39A 3JATB 3RYIB 1Z5VA 3JAWA 3ZIDA 3JAKB 4FFBB 5LA6B 3HKCA 5LXTB 5LYJB 3N2GA 4I55B 3WGKA 3JARA 3R4VA 1TVKA 5KMGB 4O4HB 3N2KB 4EI9A 5J2TB 5M7EA 3VO9A 2Q1XA 5JVDB 5ITZA 3WGMA 3UT5A 5IJ0A 2VAMA 3RYCB 2R6R1 4X1IB 4EI8A 5BMVB 4O2AB 1JFFA 4IHJB 1W59A 5IYZB 5C8YA 3C8LA 4ZHQB 3VOBA 4F6RA 4U3JB 2GVIA 4DRXB 1Z5WA 2R751 4ZOLA 1FFXB 3JATA 3RYIA 2BTQB 1RQ7A 3JAKA 4FFBA 5LA6A 5LYJA 5LXTA 4I55A 5CA0B 4YJ3B 4TV8B 4X1YB 4EB6B 2VAPA 4I4TB 5KMGA 4O4HA 3N2KA 5MN4A 5J2TA 5JVDA 2RHHA 5KX5B 1W5EA 5FNVB 4TUYB 4X1IA 2Q1YA 5BMVA 4O2AA 4IHJA 5IYZA 4LNUB 1SA0B 4U3JA 4O4JB 3E22A 4XCQA 5LP6B 5LP6C 4ZI7B 3HKBB 1FFXA 2VAWA 2BTQA 4WBNB 4EI7A 4X20B 4I50B 5CA0A 4YJ3A 4O2BB 4EB6A 1W5BA 2RHJA 4I4TA 4DXDA 4E6EA 3HKEB 2XKBA 3VOAA 5IJ9B 2BTOA 3JAWB 3RYHB 5FNVA 3RB8A 3JALB 5JQGB 3HKCB 5MN6A 4HNAB 5EZYB 4X1KB 1RQ2A 4LNUA 2RHLA 1SA0A 1TVKB 3RYCA 1RLUA 3VO8A 3V3TA 3WGJA 5LP6A 5LOVB 4ZI7A 3HKBA 3JASB 5ITZB 5MN5A 4ZHQA 2VXYA 5JCOC 2RHOA 5GONB 4WBNA 5EIBC 4TV9B 4X20A 4DRXA 4B46A 3ZBPA 4O2BA 5CB4B 4B45A 5EYPB 5J2UB 3RYFB 3HKEA 4TV8A 5IJ9A 4O4LB 4X1YA 1OFUA 3RYHA 5CA1B 3JALA 5JH7B 1TUBB 5JQGA 4YJ2B 3HKDB 4IIJB 3WGNA 4HNAA 4O4IB 4X1KA 5EZYA 3WGLA 3M89A 5KX5A 3M8KA 4TUYA 4KWEA 2XKAA 3N2GB 3CB2A 5LOVA 3JASA 3JARB 5JCOA 5GONA 4O4JA 4M8IA 4TV9A 3ZBQA 1W5FA 5CB4A 3UT5B 1W5AA
chains in the Genus database with same CATH superfamily
3V8MA 4FB4A 4F6RB 1CE8B 4Z1OA 3LGXA 2PFGA 4WA7A 3SOZA 1CRPA 4D44A 1VH8A 4D9GA 5JASA 4QVGA 1BNCA 4P80A 5JZVA 4LAFA 4KXUA 1SULA 2IA5A 5CFQA 5KHHA 5FI1B 4NWOB 5AVWA 1W36B 3OM8A 3LIIA 4H1UA 3SD7A 1IM2A 2P6NA 2PEZA 2QRHA 3RK4A 1QONA 4M53A 2I2AA 1Q6HA 4YMUA 5K3OA 3AJDA 2FZ4A 2Y48A 3DBOB 3ELCA 2GBLC 2PH1A 1PWZA 1FYJA 3KFXA 4OA5A 1AF7A 2ODAA 3GMDA 4JD5A 4HBGA 3PQ5A 4UNPA 5BYKA 1ESDA 4MRMB 5G1PA 2NW6A 1X1RA 2QW1A 2R11A 3LNMB 1PDOA 4AL4A 2VCEA 1DZ3A 3IURA 1BCCH 4D5EA 1H8HA 2P9JA 3SYKA 2VWQA 1Y9JA 4AYTA 1M1NB 3L7AA 4PQGA 1X7YA 1GNLA 2C7RA 1FSPA 3WYBA 3LK6A 2A79B 1H6CA 1E3IA 2V54A 1ONIA 1YHQV 2WU8A 1YZQA 3WK4A 3FGOA 3ORHA 4DSTA 3K08A 2YEVA 1WMSA 5F3DA 1NI3A 4PZLA 1U2TA 4YRJA 3IQGX 3SPCA 1KK1A 2EX0A 4WW0A 2WTMA 4DQDA 3HA7A 2UUCB 2H4XA 4NESA 2ZW9A 4K0KO 1U7WA 5JPDA 9MHTA 5H9CA 3FDXA 3WGJA 2H00A 3EG5A 3M6UA 4LBZA 4D1YA 3BB1A 1D5NA 3KALA 2YASA 2NTJA 5CK4A 5KYXA 2H8GA 2WDZA 3IQIX 3RVPA 4UNNA 4V2IA 2EQAA 3BA1A 3SPIA 1R8SA 4KUGA 2IUYA 2GZ1A 4MSUA 1G3IA 3T7SA 5JPIA 4JJGA 3M8AA 4CQLB 5AKEA 4G0YA 3WGKA 4LV5B 3K70D 3O31A 4YUVA 2WUWE 5JVDB 1FBTA 3KKZA 2O1WA 3WX0A 2FPOA 5L51A 4EJ2A 1Y1RA 3HEBA 4DMGA 1GWNA 1E5VA 4BUZA 1DG1G 5JZOA 2FYTA 4YCCA 4HH0A 2ZR7A 4B43A 1UBHS 1WAMA 1KS2A 4X63A 4BX8A 4M0PA 3OLZA 3SJUA 5JXJA 5IUKC 3NEYA 4YRTA 3C3AA 2V5AA 4BO2A 1U2GA 4NZYA 1G21B 2WUVA 2HS4A 1PFUA 3G67A 4MMYB 3SMQA 5TQ0B 1SXHA 1WDWB 2CYCA 1AQUA 2YJZA 1YJQA 1G1MA 4NECA 2OHIA 3AG7A 3UM7A 3HYRA 3H1IH 2IYFA 1C7ZA 4B81A 1VKNA 3WO0A 1J42A 4ND3A 4R2HA 3FG9A 3DAPA 2D5CA 1PR2A 3DEFA 1QHSA 2QF7A 4RHTA 4WZBA 2W90A 1LVUA 3ASUA 4YJ3F 1P74A 3QJ5A 4QO7A 3M9WA 4D9FA 3R5HA 3E8XA 5CFRA 1U3WA 2UYJA 4UQPA 1ZFNA 4C07A 4PGFA 3UKMA 1GN3A 5LA6A 3ZDDA 1WP8A 1QFYA 1CEQA 1V8DA 5ARDA 1H4VB 1VMAA 1XBTA 1WNSA 4HY3A 4Y2UA 1SC1A 3H84A 4QJ3A 2ZDIA 4CCSA 2NUPB 3F6PA 2GARA 1L4BA 2FMFA 2LR0A 2ZPUA 4MQFB 1CFJA 1ENVA 3I92A 2YNMC 4MS2A 3LY9A 5CXXA 2P5TB 3IEPA 4BFWA 3EW7A 2CSUA 3IH5A 2AUNA 2R1TB 4HGYA 4L15A 5BQ3A 1NUAA 5LHIA 4WEOA 3AR9A 1JXOA 2GS9A 5HQTA 4ZOAA 3PNKA 3FPBA 1ZM3A 1Q44A 1SVIA 3LVRE 4OLFA 1K8QA 4W4LA 1UC5B 4B2LA 3SYQA 4EX6A 2P2LA 2G40A 1R6DA 2Q07A 1DWOA 2ERCA 3I3SR 3NM4A 2ACVA 5FADA 5EP4A 5EZ6B 2KTUA 1RLTA 2JAWA 5A05A 5TJHA 1ZK4A 1K7SN 2BP7B 3ZGZA 2NTEA 1VMIA 4ER3A 3CD6V 2IHUA 1ZI8A 2YFYA 2NU8B 2IV2X 4R0NA 4RWEA 3U3OA 4NMXB 3DA8A 3DEKA 3IP8A 4R81A 1RI5A 1PM9A 1RZUA 3PLRA 3LX6A 1OFTA 3UJ6A 4AJ9A 3I01A 3A3PA 2OESA 4AP9A 4JYPA 1T2FA 4CFYA 2DW4A 3KLNA 1UBMS 4YQFA 3U1BA 5JJLA 2J5RA 3I5UA 2VSYA 2YIDA 2NU7B 1X77A 1J56A 2QJOA 3OQNA 1IZ8A 3MDSA 4PBSA 3FPSA 3LXXA 2Q0OC 4K2HA 3LLMA 1Y74B 4MKIA 3CLUD 3T5TA 3JARA 5DBEX 3O0TA 4KR9A 2RGBA 5H82A 4F96A 3R7SA 1TKRA 1U0JA 4O2RA 2CXRA 1U43A 1M5RA 5I4BA 3RR2A 5BUQA 1YAHA 3KUXA 5ALZA 1J33A 1KEUA 5LYYA 4OQQA 1YK1A 3TQTA 1U8UA 3P2EA 5YASA 1W5EA 3DZKA 5IVKA 1D1TA 2QTGA 5CFPA 2HN9A 2C9DA 4M4SA 2FOLA 4G4SP 1GN4A 2QMZA 3KEGA 3DDUA 2FSHA 1PFVA 2X77A 1K66A 1ITZA 4DM4A 3EHBB 1KTIA 3IQDB 5DRTA 2PRZA 2PHNA 4O02B 4OHMA 1MSDA 3SIRA 1GPMA 5IT9A 5JCZA 1FYWA 2XAQA 1RM1B 1FEZA 3FWHA 2RMKB 2BFDB 1LK5A 3H04A 1IN7A 1IBKB 4QUHA 4IYHA 1DAIA 2O2CA 2DBVO 3CRMA 5DIZA 4NCBA 4BN0A 3AL3A 4L2IA 3QVXA 1T6YA 3E9EA 4FXPA 1E0JA 2H7YA 5EXPA 2HLDA 1VHJA 1A95A 4M0CA 4IUBS 3T7JA 3EVAA 1FU8A 3WLMA 4LZNA 5K8IA 4RBNA 3TTYA 4DM7A 3ZGOA 1TC2A 2DTXA 1Y4AE 1YL7A 2NUAA 1F8FA 1XF1A 4LF9O 3HP1A 4CKYA 4US1R 3VNBA 4JA2A 3T8YA 2O8FA 1B0AA 1KBHA 1M2JA 5DISB 4B31A 3BMOB 1RMYA 5CH3A 4MLPA 2C57A 4OMUA 1DC7A 5E7MA 4MGZR 1HXHA 3IQEA 4AECA 1OPRA 3JSXA 4HADA 3EIUA 4PSAA 3I2YX 4LGCA 3EAQA 2PYZA 4Q9HA 1OCRB 4PA6A 2R7LA 2RGRA 4LFBO 2JGDA 4EH1A 2F95B 4DR5B 1KJZA 4DYDA 3MFYA 4FFDA 3G2PA 5M04A 2H9YA 3SLRA 1RWWA 4RACA 2HWYA 4G1CA 2CJPA 2AQIA 4QX6A 2Z5GA 1DFIA 4R2XA 2TYSB 3DB2A 5DDIP 4ALIA 5DYTA 2FZEA 1UK7A 1XRQA 1ZN2A 2XOEA 1BH6A 4MEBA 1NI5A 1T6ZA 1W2BF 1USUA 4M7WA 1K73H 1C9EA 3M82A 3I83A 3CCCA 4IUDS 4L5IA 4GPBA 5EUMA 4LR3A 1LLFA 2HQBA 5C8YA 5DO9A 3OE7G 1WY7A 5G40A 5LYJA 2BFFA 1MZFA 3AIOA 2F67A 1NHWA 4KQJA 4FFRA 4D4LA 4A0SA 3GBSA 4LV6A 1XX6A 1RVV1 3F7MA 3MJVA 2VHWA 1CQJB 1MQ9A 1LWNA 1NVDA 2A3QA 3AHCA 1L8XA 4HWOA 4GUNA 1XN4A 1XTSA 4JQSA 5DHAA 2ALEA 2ZCUA 5JH7F 1G7RA 3V97A 2O2XA 1K4DC 4DK1A 4ADSG 3UKOA 4RA6A 4AICA 4FM1A 4E2FA 4J16C 1EDOA 4IV8A 1R6XA 4DLBA 4DEYA 4M1ZA 3KKNA 1WXWA 1YTLA 3QWHA 3CC4F 3B7PA 5JCOA 1QIJA 4PLVA 1GKLA 1R6BX 4V38A 3UFBA 4TGLA 3LWOC 1RM1C 1YRWA 5F2EA 4G5QA 4XVRA 3BXPA 3VR4D 3OQOA 3TBFA 4LHSA 1NW6A 4UM5A 2BC9A 4CQNA 1IH8A 3PFGA 4QQKA 4I7EA 3EC7A 1K8YB 3WWOA 5AJVB 5KHAA 1E3QA 1WKCA 1ECLA 3TSOA 3W2IA 3I04A 1ZZGA 8ABPA 3APQA 1XD2A 3QQ5A 5KNDH 3THXB 3QE2A 2LBWA 3U11A 4PFKA 4U0KA 4Z0TA 4ZCLA 3KCNA 3WNZA 1E94E 4MPDA 2D3WA 4ILKA 1Q3KA 3TKAA 3GGSA 3LT1A 5E6RA 1SXJD 1GR1A 3NUZA 3RJZA 2VO1A 3F5FA 2M7WA 3KHTA 4QDKA 2XUJA 3R09A 1ZMOA 2WJ3A 1II9A 1OA0A 3D5TA 2UZHA 1OCRC 3PXXA 4YO7A 5JSUA 1M56C 2XAUA 3CCLF 1IZ9A 3OAAD 5BMVF 2HH9A 4DV5B 3R20A 1VQMF 4IMJB 4L5YA 1ESNA 2DPHA 5K7SA 4JX8A 1PNRA 2X7RB 4B7ZA 1RM5A 3VGJA 2ZBRA 2B1QA 1ES9A 4I8IA 4D7SA 4DA8A 2HEGA 1XJCA 5JYEA 4FFBA 1M2OB 3GV0A 2WZBA 3LUAA 1Z4PX 2RHHA 1M34B 2HPVA 2KQUA 3RWOA 4X93A 1KYYA 1X1EA 3WMGA 3OAAG 4LRUA 3KKYA 4JJ7A 1WB6A 2E1RA 1WETA 3SVZA 5FL7A 2AEFA 2QKYA 3KR1A 3QVSA 3OJXA 3EY4A 1AR5A 3M6VA 3LUFA 4XDZA 4RJTA 4JLAA 2FPIB 3FPHA 4WKBA 3PXCX 2OV4A 2AN4A 2OMKA 1N2SA 3BL8A 1JFSA 3JYOA 2NTNA 2I3GA 2QX9A 4RJLA 1HNXB 2CY0A 1M0TA 5IXJA 2AG0A 3AR2A 3QO7A 3ZQ4A 4M36A 2PA0A 2FP4A 4TZTA 4HCJA 1V54C 1U1FA 1L5OA 1YJXA 1PGQA 3O3OB 2D2FA 3MWEA 4RKYA 3Q5DA 3PHIA 2IEBA 1E6WA 3O7WA 5B6PA 1ISPA 2C5GA 2YBEA 3G23A 2D7CA 1Z2DA 4C4TA 4YRZA 1R3LC 5JSKA 1E1QG 4TLBA 4J2HA 2I3AA 2A9KA 2WNHA 3HKDB 2P62A 3KQPA 4HNAA 4QREA 5ESRA 3L9WA 1EB8A 3JVHA 2QI9C 3ZDEA 3GPBA 2AZ4A 5HP4A 2J30A 3EHDA 4GKBA 1OKKD 2R1VA 3SIUA 2PUBA 1J2UA 1NBWB 4CKCA 2JGLA 3TNYA 1XVVA 3E81A 4FLMA 5L40A 2M6KA 2QR3A 4ASUA 4LIPD 4AMUA 2RDCA 2YZKA 3V33A 2PTMA 1YAJA 5K3FA 1HLDA 4UPVA 2Q3LA 2XUQA 3RFFA 4CVNA 1I5OA 4LY9A 5L3GA 3NTXA 4PSKA 3PPWA 3K8OE 3O8DA 3C5HA 2YY5A 1EFRA 1SXPA 2ZUBA 4WWHA 2GDSA 3T3NA 5CLGA 2B9ZA 4KO4S 4LEIA 4GOXA 3AOEC 4IDEA 4YRAA 2HMAA 1ONBA 1V16A 4ARUA 1LW6E 2W4IA 2RGNC 4B3TO 2QK4A 1O3YA 3DZ8A 1D04A 2PY5A 4ZZ3A 4DW1A 1F3LA 1EUQA 4HPXB 8ADHA 3EXG1 2JFUA 4KJXA 3JVUA 1FKAO 2P4EA 4ES6A 5JO9A 3LF2A 1Z6XA 3QPAA 4HF7A 4BP1A 4RL4A 4QUAA 4MI9A 2PGJA 1IJKA 1BU8A 1N7HA 4E22A 4HKTA 3LKDA 2C2YA 3KBOA 1BXZA 2YSUB 3WRYA 1M9NA 2I6GA 1N5JA 3M6IA 3DHYA 3NXKA 3RU7A 1PTKA 1YR3A 5HRUA 3UJBA 4A92A 1VJ1A 2IIBA 4DANA 1XROA 3H5AA 3QJGA 2QDXA 2QI2A 5B6JA 2Q0XA 3R75A 3WNVA 5ICMA 1PR0A 4IR7A 2IYZA 3VNUA 1J24A 2PRYA 2N9UA 3ANYB 4BQIA 5LDHA 2WHEA 4DLKA 2GYWA 3LBFA 2DSNA 3F9IA 3I9V1 1Q6UA 2P4QA 4TOIA 3VYUB 4OQPA 2LTAA 4BNVA 4NJMA 1M73E 3WGVA 4GKJO 3DC2A 2IYSA 2JEOA 3KLOA 3U0ZA 1NN0A 1EUCA 2EJUA 4UFZA 4UREA 3U16A 2PGGA 2IS1A 3FGZA 4B4VA 4RLFA 4MA4A 5EIFA 4RTRA 1M2WA 3GLQA 2VF8A 3HKCA 2LFRA 2IOHA 1LC0A 4XASA 5DBHX 4LZOA 4CMHA 2PXXA 2QN2A 1R3IC 3AJAA 4N8EA 5IYZB 1VG8A 3ROXA 3KHSA 1CYDA 2QSYA 4Q4HB 3I05A 2HDWA 1DDGA 4NVPA 1JKJB 3ZBTA 2D06A 1MABA 2XODA 2IV7A 5D8DA 2X0KA 2BEUB 1M2GA 2O7RA 3MJEA 1MIOB 3RI3A 1MOZA 3LPLA 3SQOA 1AMNA 4HAWA 5B57C 1H6BA 1VI5A 1ZUNB 3HA2A 3U44A 3DNMA 2TRSB 2BGTA 2ZE6A 1DJQA 4LZPA 3D7RA 3RA5A 4RVCA 2XYPA 3ABLB 4A26A 5CDYA 1W1UA 2QPAA 5B3JA 1ESCA 3ON5A 1YDHA 1I3CA 1WJZA 2VK1A 4UPDA 2Y77A 2D8AA 4BT5A 2AZTA 3RFUA 3F7VC 3ZHXA 5JIBA 2GO7A 1EZVH 4ITVA 5DLQC 2BKLA 5KDDA 3N8GA 3AB7A 2H63A 4TL9A 5KMGB 4CDNA 3TQQA 3WKDA 4MWCA 3E2EA 4KFCA 5DU2A 1YOVB 4A8PA 2XX3A 3SSAA 4FNGA 3PNVA 3D4NA 1DQYA 4MDYA 1I1OA 4NENA 1H0KA 2I1WA 1A8IA 2QD1A 1ZINA 1IZ0A 1DJLA 5AI6A 1I3LA 3N58A 3CC7F 2RAVA 3P9KA 3OCCA 5EXSA 3WRXA 1T0BA 3AB8A 1GAWA 2VAXA 1KZYC 3ZO8A 2TMDA 2WAYA 5AKZA 2TMKA 1KVTA 3G1WA 1QQAA 3B6ZA 4DJFC 3MT9A 3F9RA 3I23A 4CMGA 4YCJA 3ZJTA 4J0KA 3O8LA 1FYXA 3QELB 3ZH2A 4ZEVA 3D8BA 3JALA 3IC5A 1GL9B 5JRJA 1DKOA 2MSDB 1VQ5V 3GLUA 3BX1A 1WZNA 1KC8W 4JL6A 4JVLA 4QELA 3BC1A 1P1JA 3ZQKA 2AKYA 2YV1A 2X9LA 1JFFB 1WUJS 4CEIB 3VYUC 5CPFA 1Y5RA 3NBQA 4JNKA 2QV0A 1SEPA 2IZ0A 2VHYA 2W6NA 1GTRA 4AJ1A 1SQSA 4CMIB 4QDXA 3V8PA 4R8CA 7AT1A 3MELA 1TLTA 1YVRA 4M22A 3NVIB 3K0CC 3CVVA 1K8XB 1V1MB 1FFBA 3T9AA 4WY8A 3HLYA 1OGJA 1D2NA 3F4LA 2HA0A 1A9TA 1BQ4A 3EJWA 2K9PA 3VYRB 5LU9A 1VXRA 1HH4A 4DQUA 5JTTA 1GADO 3C39A 4GECA 1QLJA 4UOEA 4JJAA 4IM7A 4F8EA 4ESEA 3AUXA 5IVPA 4LMAA 3K73O 4MKHA 2K87A 3B9QA 3INGA 3FPCA 3AR6A 1E18A 1EE9A 3C6ZA 1EXNA 2AGAA 1GVHA 1XJ5A 3DL0A 1U3CA 3KK0A 1CCWA 1GZ3A 1CUFA 4A0QA 1W42A 2BSAA 1E4VA 3BSYA 2EJ7A 3SNHA 4YP7A 1JVBA 5C81A 2O8DB 5L3SA 3HCRA 1T2AA 3D0KA 2OHWA 5ULLA 2FFHA 3ABLC 3WGMA 1K8AH 3CA8A 4BX9A 2OORA 4BJ3A 1L7EA 2Q5QA 2WG0A 2HA5A 4FE3A 2JA1A 4TVOA 4LC1A 1LDNA 2O2ZA 3JQFA 3ZR4B 3ZU3A 4OUDA 4I4TB 2DWDC 5JEDA 1LV7A 3O92A 3BCCH 3S2YA 5TGZA 2AMFA 1T1IA 1IXMA 1R66A 4HYTA 3GDWA 5IF3A 2YN4A 4HNRA 2VHQA 3B5IA 2XQJA 4M9CA 4KQHA 3EOBI 1UAAA 4B3MO 4ABYA 2BEWB 3CRRA 4HWGA 2UV8A 3MK31 4AAYA 3ZRVA 2QLFA 4F9TA 2IHYA 4D7TA 5FFMA 2ATKC 1JNXX 2EARA 3OOWA 3QEJA 3Q3CA 4W63A 5JEEA 3ZV6A 1ATIA 1TLLA 4A0RA 3CC8A 2XMDA 3FZQA 1UANA 4P3OA 3PC2A 4OLHA 3EXHB 3HU1A 3S40A 3Q1LA 1XEQA 4MVXA 5JNWA 4U00A 2JEZA 4IEFB 3CKKA 3LRPA 1BWQA 4O2AB 3B9PA 5IXSA 1T5SA 5KJFA 1A2OA 3IIIA 4UC0A 1YI2V 1BOFA 2CB9A 4HTFB 1QANA 3IBYA 3HO6A 3G4SF 5KQLA 1NXPA 2VZ9A 4AY3A 4OKSA 5L3QA 2XRFA 3CRNA 3L8ZA 4EI7A 1L3BA 3TIIA 1GGEA 5JSQA 2OT3B 4LMBA 3BXGA 4UVIA 5AH0A 5EXXA 3RWRD 2UYKA 2ZXFA 3AY3A 1XRMA 2EIXA 2CLDX 4E03A 1Z2PX 5GINC 1A8SA 4BV3A 5KTMA 2IHNA 1KYXA 3TFOA 5AOCA 4DNQA 3ADOA 1QVGU 1UAYA 5JE8A 4JLKA 1NMYA 1PJAA 2N42A 4BCDA 5EA2A 5CYOA 1GN2A 3WC4A 1Z4MA 3ND6A 3TZQA 5FTNA 3UT5B 3M5PA 2JJQA 1DRJA 5BSVA 4BECA 3BWBA 4AUNA 3AHGA 2OTJV 2HK8A 1I7LA 3SGIA 2ODQA 4NK5A 4YQEA 3R6GA 3WIDA 1JYSA 2IBTA 2ZKOA 2F17A 1PD1A 4WKOA 1VSVA 3AP1A 1Z2CA 3QLVC 2JS5A 4KAXA 4BMNA 1E2JA 3H3JA 4GXRA 4YLYA 2CL7X 1R5JA 3FTPA 3ZVLA 3IE0A 4C9BA 1SBHA 3VPSA 1KUQA 2YY6A 2X2OA 1ZWLA 3UYLA 1JKMA 3LD9A 4N5NA 4ONEA 4ZN6A 1EVEA 4XCXA 3GLHB 2WHRA 1R37A 5FWNA 3M34A 4EG1A 1WDKA 4X0EA 3HBJA 3KQMA 4JJKA 4EITA 4HXEB 3N0XA 3ZCVA 4P2ZA 3NK7A 2X8JB 2KSQA 3NFYA 4DV0O 5EE5B 2NO6A 3SR0A 5DNDA 4CM5A 1AQIA 1YJBA 5CCXA 4GPZA 2ADMA 1BKYA 2LVBA 5C7IO 2D2CB 2WZQA 1ZLZA 1WCXA 1KY3A 3LPMA 1XCBA 2DP4E 2QJRA 2JHFA 4IXNA 2OLEA 1E2QA 3Q4HA 1Z75A 4Z4EA 5IJ0A 4P8RA 2AG5A 1W2GA 2WFMA 3M6FA 4IGIA 5E79Z 1TTQB 2OWEA 3EXHC 4Z4HA 2HJRA 1GN9A 2AHZA 3LT0A 1NULA 3NKLA 4IDQA 1XU7A 1QYIA 3L3BA 4LYHA 3K0TA 1CQIB 2VNHA 4GM4A 1X70A 2O23A 3COVA 3KAQA 4ASUG 2F93B 1JR3E 1U0TA 1E3EA 4NC9A 3PTLA 5SYMA 1ZWIC 3GFBA 3RB8A 1D6SA 5H6QA 4UHJA 1RQPA 5A04A 4W8HA 2A8YA 2Q6IA 4DRXA 3S44A 2C8KA 4M6WA 2ZIMA 1OAAA 4LPKA 4C89A 2P27A 1MT0A 3A2FA 1X7PA 5TGTA 1S2IA 3BTVA 3RTCA 4N0DA 1O0BA 4B3XA 1XMQB 3IQWA 3E82A 3T1QA 4CIDA 2P78A 3KTDA 4E1AA 1JPVA 1ENPA 1B16A 1XMJA 1W4BA 3R8XA 4OQYA 2NACA 3C6BA 1G6HA 1C0PA 5K3CA 2IW3A 1HDXA 1SKUA 4UEQA 5I8PA 4CQMB 2EX3A 1ZD2P 2ZJ1A 4IY1A 1QHHA 3V8NA 4CS2A 1SIBE 4MV6A 3C1UA 3S0HA 4WOPA 1QFZA 3L07A 4B4OA 1XZHA 2R3SA 3ZOZA 1J90A 2PM8A 5LP6B 3BRWA 1HPLA 1JW9B 1MENA 4CH5A 3H0EA 4UTZA 1NF2A 1SQFA 3GLFA 3ZHBA 2I8AA 5G0VA 5I6DA 1RPZA 3ZXUB 3CZQA 1VFPA 4OQXA 3GEHA 4RQTA 4UDNA 4BKOA 2UU9B 1E6UA 1EJ6A 5EYPB 4ZQEA 4RTOA 1SG6A 1QB8A 4KBFA 2EF0A 3ZU4A 3U81A 2WI8A 4KNWA 5ADUS 4Z9XA 3WRWA 4L9AA 2P4HX 3D1LA 2EFEB 1GMGA 2GF9A 2IZOA 3AMVA 2JGFA 2ON6A 4PFJA 3DE1X 2XKBA 3VPCA 3DFFA 4JDPA 2NO5A 3D0RA 4LRWA 2LDXA 1TXGA 1XR3A 1Z5ZA 1ESEA 5AOVA 2OTMA 2V1DA 4Q3AA 2IEGA 4IV5A 1XDUA 2PMPA 3BGVA 5ADHA 2AN3A 2O05A 1DXYA 4FGKA 1Y42X 4OJMX 5A9RA 1JEDA 2YMQA 1UF9A 4H59A 2C8JA 1ZRSA 1EHYA 2PMCA 3I01M 4DSUA 2IVZA 2HZBA 2PYIA 3BG5A 1CRWG 2JJ1D 4W5WA 4GXQA 3DLTA 2FAXA 3ZD7A 4JB3A 3HI6A 5DW3A 3B1ZA 3WLQA 1A8HA 1NBOA 5J4LA 2HIMA 1JH9A 2I62A 1F1BA 1MB3A 1Z45A 2FPMA 3UAYA 5KTPA 2C4TA 4TV9A 5C32A 1VIVA 4TKMA 2R8ZA 4JLJA 1XZNA 3T4PA 4P92A 2IZ5A 1AI4A 2M98A 3QQPA 1J2JA 3ZV5A 4DR7O 1EP1B 4WOCA 1E1CA 4LYJA 1OAOC 5DWQA 4UOQA 3AR4A 3D59A 2QQEA 3QNEA 1N6LA 1G2PA 1BD4A 1J6UA 4ZQFA 2KB1A 5IT9M 4QASA 3H9CA 1ODSA 5B12A 1I9CA 2OXRA 1NSYA 5CVVA 2F8MA 4MGYR 5EESA 4AILC 4F4IA 3NNSA 1NNUA 2D1TA 4BEBA 4B7UA 1THGA 2BM0A 3ZW7A 3RYTC 4QU0A 4F56A 1D0VA 1AV6A 2I4IA 4XYGA 2R96A 4BZQA 3EPJA 3JYHA 3SHFA 5CM2Z 1HDZA 1AT1A 4Q34A 2JCGA 3GRZA 2WB2A 4HAIA 5IU6A 4KQ9A 5B6IA 4JF3A 1RYFA 3GCWA 3F90A 2V4MA 3D8NA 4O4HB 5E8JA 2R9AA 2YJ6A 1N36B 2EFJA 3MJSA 4GGPA 3LWZA 4ZOLA 1R8YA 3Q3HA 5IFLA 1LTQA 1EK2A 1JE1A 1VKHA 1TGVA 4CCYA 2VTKA 2ADQB 1CXZB 2WD7B 1NE2A 4QTTB 1UADA 2E5LB 2XDQA 4G88A 4HD8A 2VGMA 4G4XA 2HD4A 1OX5A 1Y7LA 4JT9A 2B7CA 1OGIA 3THWB 5BSKA 2VHTA 1UFIA 2W2KB 1IUPA 3UCXA 4RXUA 4C7VA 3REOA 3NOVA 5GONB 2IPOA 4LHEA 3OIWA 2FRDC 3SLGA 4R05A 1XLTC 2PWYA 3MTQA 1GDDA 1TUEA 4G56A 2RCVA 4QSHA 1B42A 2KHZA 3AIIA 3UJHA 1M2HA 1LLUA 4QLAA 1BXGB 3EDCA 5BUCA 2ZJ5A 5AKKA 4UOZA 2AZ0A 2GCOB 3K5WA 4DLLA 121PA 5I5GA 1C1YA 1V8FA 1KNXA 2VHUA 3M4NA 4H08A 3K0BA 3CC2F 4TQ9A 2NU9A 3E7DA 2AT1A 4LTDA 5FAXA 4BWFB 2G1PA 4RH0A 1Q43A 5EJGA 2FY8A 2ZKLA 3AFNA 4L74A 4JI0B 1YIDA 4QFCA 4TYYA 3F97A 2Z8XA 4URYR 2F9FA 2JGIA 4A2QA 1XFAA 3CMEF 4UTXA 4A5OA 3N0WA 4Q37A 3T5AA 1KOGA 5FWXB 1E6LA 4XCVA 2Q6TA 1UPUA 2FJ0A 4UZSA 4P58A 4CCWA 5H0IA 1QU2A 2AYXA 1JXMA 3L7NA 2C2XA 4IVRA 3LQYA 5JJBA 2X6AA 2UUPA 3ZTTA 2OBXA 4Q3LA 3L8GA 2EBHX 3KSAC 1RQLA 4RFSB 3ZHCA 1PNTA 2GLZA 1AI6A 2HRCA 4DW8A 1X8LA 2OD9A 2X7XA 1SKMA 3IUEA 5CA1A 2JLSA 3I04M 2Z3VA 2K7ZA 4QYMA 1II8B 4X94A 1SC5B 3FKJA 4P54A 3P2YA 1R5BA 1FW8A 5JW6A 3CCBA 2JGMA 1HYBA 4FGWA 1UK8A 3EFBA 4ZZ1A 4Y6GB 2XXAB 3U62A 5I9LA 4XYEA 2FTKE 4GMHA 1QQBA 2DJIA 4G01B 3MJDA 4CT0A 2YINC 4OUKX 2YXDA 2LJ2A 1SUCA 3I6ZA 5HVNA 1R16A 3GCDA 4B7XA 4JIMA 4FK8A 4D8WA 3CLRC 3OIGA 1IFXA 1NRWA 3D2BA 1W94A 1TU3A 1YZBA 1TJPB 3BA6A 3OE7A 5CH5A 3CV3A 1EE1A 3F7NA 4TWJA 4KXVA 4Z9AA 4LYYA 2G3YA 1XCLA 3OSZA 1G4YB 2XEDA 2P6OA 3ZY5A 4UFPA 3QVMA 2HCTA 4TKLA 4KIGA 2IU0A 1XZFA 4MVJG 3OOSA 3UQ8A 3O1IC 4ESHA 4FQ8A 3FMIA 2XYHA 1KQ3A 1MJNA 1B41A 3I09A 4JJ6A 2JL1A 3WKEA 4KUMA 3N7TA 2QM8A 2VT2A 3QF7A 3HCPA 3UMGA 1LH0A 1QORA 4AMBA 2YWJA 5CPBA 5EPEA 2VQFO 4PRZA 4RSRA 4Z4GA 1T43A 3S55A 2RD2A 4C7XA 2F55A 5AMXA 2CEAA 4JU8A 2IJGX 2D0DA 1F0YA 3ONNA 2LW1A 3C9RA 1TLFA 2NAFA 2R25B 2ES4A 3QVGA 2GUZB 4B73A 4JLBA 3MMPA 2QRMA 4QDJA 1JX9A 1PBNA 1CERA 2G09A 2WF5A 5K5EA 1W85B 3L7JA 1G20A 1JG7A 3USCS 2YC2C 4JBNA 4FT4A 4IPTA 4CG0A 4US2R 2AOWA 3TCKA 4DEXA 2P2CA 1Q86H 5GTHZ 1P1FA 2EYUA 5FHRA 2YHAA 1TMGE 3V2HA 2I22A 1GA4A 1XTJA 4Y1GA 1K4YA 3CEHA 2PUVA 3VR4A 4GIBA 3Q3EA 2O14A 4OHYA 4BUJA 3ZMTA 4OFZA 4EK9A 2HRRA 2ZUSA 4D4HA 3HM9A 2BEKA 4I0WB 2ODEA 5AM5A 4QLBA 1YMVA 2LGQA 4IG9A 3I28A 1LBQA 3SX2A 2Q5LA 1N2JA 5KOHB 3JWJA 3CX8A 1ADGA 4JASB 2COEA 1PDVA 1JIVA 1W4CA 4ZIRB 2RKWA 2G7MC 2WU0A 1KR5A 1Z29A 3CCMF 1ZVJA 3SZ3A 3ZHOA 1ORVA 2VIIA 4GG1A 2GK7A 4E6EA 3QEAZ 3GEMA 4S05A 1SXJA 4TN1A 2I91A 1KSHA 4FYWA 3L0DA 3A1NA 3N8NA 1G7SA 4GC9A 3F0DA 3CNNA 3HLKA 1M1KH 5AK3A 3GLIA 2CSLA 4C7MA 4F60A 3AP3A 3RYHA 3BAAA 2HIAA 1KC3A 1L5FA 4K88A 1Y6FA 3OAAA 2NU6B 3NC0C 2CXXA 4ZYXA 5G4VC 5E9JA 2ODPA 4WFGA 4ZALA 3QPDA 1KEEB 2Q7XA 3UO8B 2V45A 1Z2OX 5AJWA 2CZWA 2WYIA 4IDPA 1S72V 4JLOA 1RRCA 1M6NA 4GU5A 3LDAA 3W1VA 3HNPA 4Y30A 1QUEA 2FU5C 3NYRA 5CD1A 4MR7B 3RS8A 1JIUA 4A7PA 3QO5A 1A72A 2X5OA 5IM5A 3AWDA 1A7KA 2FFQA 1N7JA 2NNWB 4J2TA 1Z0AA 2OCAA 2WYVA 2ZXWC 2X5XA 1JEAA 3HWUA 4YFYA 2Z9DA 5AI5A 3W5VA 2ZRLA 1C8KA 3Q3JB 4INZA 4WY2A 3ANXA 1D2AA 3RVSA 1XCGB 4I08A 3N2EA 3OO1A 4W7SA 3F9CA 2OIGA 5KAIZ 3KT6A 5G2OA 1ZRNA 1IPHA 4WFFA 1XNRB 3V6LA 3VXKA 3Q5GA 1QV9A 4BP8A 3BDAA 4BLTA 5LP1A 4NXNO 4FHDA 1PXWA 3DFIA 1NDHA 4R2JA 8LDHA 4OQEA 3F5MA 1DL5A 1E1QA 3TNDA 4E14A 4HBZA 4N3GA 4HH1A 4IHJB 2YUTA 5ALEA 4MSWC 1OLUA 4BFLA 1R3JC 4C6RA 2AK2A 2YTZA 3LQ1A 3TTUA 1W36C 2XB8A 1I24A 1EVIA 3SVTA 1FPOA 1ZGCA 3SM9A 4MR8A 3AK1A 1VMDA 1COMA 3O8QB 1ABBA 2WU3A 1FXWF 1Y37A 4PEVA 2JK5C 3CCJF 4MQ5A 4K3AA 3RTBA 2P9ZA 3ZC3A 2WABA 2ZQYA 3B8NA 1J5XA 3KYBA 5J59A 2FL4A 1A5ZA 3ZCUA 2A9PA 2XDAA 1EFPA 4YPOA 3GU3A 4HZIA 2D59A 4E2LA 2G0AA 3I9LA 3D2AA 3KAJA 4IJWA 2MDTA 3VCZA 3NAQA 2W11A 2PKQO 5HF9A 4LTMA 4DIFA 3RGGA 3LCVB 3M4JA 4WCDA 1WLEA 1KAMA 4INPA 4WJZA 3RYCB 2BM9A 3FFXA 2YICA 3L72H 1VTKA 1EFAA 4KPFC 4R31A 3O3MB 4ALJA 4D74A 5AW0A 2HWUA 5CCEA 2E3JA 3L05A 5EHQA 2H54A 4X61A 4BAYA 5JXHA 1TDJA 1N2ZA 2OCBA 3A3YA 5FFFA 5JALA 3CHXA 1SHUX 1ULAA 5ALUA 2R0QC 1BJRE 5ILQA 1ZOLA 1MJHA 5AW8A 3H2BA 1NV8A 1NZJA 3VNSA 4JBWA 4N4AA 3VGPA 1XEWY 1ADCA 3PE3A 3QHQA 3I53A 4DG8A 1AROP 1N2BA 1K7CA 5BWCA 1S7GA 4O0LA 2NYAA 1AVTA 4CMBA 2DSTA 2C5LA 4O4JA 5K6RA 1ZJWA 4R9UC 3VKGA 3H8WA 4I1RA 5T4EA 3ZGXA 2OPBA 3NG1A 2XR1A 3AG5A 2EF1A 2HHHO 2RBKA 1E7QA 3OI7A 2HOQA 1GZ0A 1USKA 4E30A 4D8VA 3V1TC 1EGHA 1XWIA 4EHHA 3IHWA 4JELA 1RQ7A 1X8XA 4CUKA 3VTIC 3KSZO 1XDWA 1RA4A 1E3MA 1URPA 3ICPA 3H9EO 2QJWA 4TS3A 1KH1A 4YREA 5E9WA 1UJNA 5DI3B 3UAXA 2CUTA 3T1YB 1SBTA 1PVVA 1X94A 3VIUA 1U0RA 5KEIA 2Q9AA 2MYPA 2VT6A 4AKTA 1E7SA 4IZ6A 4JUIA 4UV8A 2ZRDA 4U4AA 1QCDA 1Y8RA 1LLCA 3SYLA 5DM70 1EXWA 3DPSA 3L6EA 2X0LA 1D6NA 3HXMA 4F06A 1I33A 5GIOC 4AJNA 5IKEA 3ZOPA 5J4YA 4QSMA 3NMUC 3VQVA 3ZEIA 1P4RA 1C3JA 2O9JA 5EMJA 3ZWBA 3SQNA 2L35A 3KQQA 3TLZA 4GQAA 6Q21A 1DKMA 4TTTS 2GTPA 5T64A 3MCTA 2O8CB 3FETA 3MS7A 1CFZA 3IXLA 4WF9V 4ZU1X 3A2MA 3ASZA 3ETGA 2GVIA 3OT1A 1EFDN 4KN8A 2B99A 5KX5F 3WDLA 1T29A 2B33A 3KYDA 1YJWV 4GI5A 4N18A 5K51A 2VK2A 4YJGB 3BD8A 1RQ2A 5DM0A 4YRLA 5E4JA 1TO1E 3MIZA 4HUQA 5C53B 3X1ZA 1YRLA 4M76B 4C4RA 3C3CA 3OX2A 2R4QA 3GVMA 1Q16A 3A6FA 1RKXA 2OO5C 3RJ9A 4LJAA 3ZTWA 3A4LA 2CGOA 4TQDA 1AHIA 3QNMA 2DN9A 2I7TA 2QSJA 2PYLA 2JATA 1Y6XA 5KAPA 3WL6A 4NBKA 1D7OA 2RHBA 2HFKA 1H2WA 5HKKA 3AI1A 4LBVA 3TJZA 4IQ0A 4AS3A 5CFOA 1RXWA 2RK6A 2ZNIA 1GPLA 3LBAA 3B38A 5FBLB 4MUEA 4PAWA 2WSBA 1E8MA 2QG9A 3PGMA 5DEDA 1F2VA 3VPBA 1YRBA 4EG8A 2P1ZA 2VLBA 4UXJA 4I0XB 2J09A 1X13A 1N0VC 3KJKA 4GDMA 2E76B 1BS3A 1O6GA 3GOHA 4QG7A 3BULA 1QH8A 1AP6A 2AHOA 1M2VB 4F3NA 2HLPA 3VX3A 4R0VA 5J2UB 5LQMA 3FKSD 3S3WA 4YX9A 1PLJA 3DM5A 2I9KA 1SVUA 3KE9A 1VQ1A 2VA8A 2WE7A 3L49A 3BORA 1US8A 1GFWA 1QBGA 1VJ0A 3UJ3X 1JCHA 3K0SA 1P1KA 4GW3A 3WZMA 4R3WA 3U7JA 3SHWA 2XUDA 5A0TA 1U2RA 4J7CA 5F98A 2KG4A 3B1VA 4MTFA 2OQIA 1GLVA 3W6NA 3S06A 2XQFA 4MP6A 1Q7GA 1Z28A 1HP8A 4B3HA 2REBA 5A3JA 4F3TA 3L01A 3SEQA 2RB5A 1N78A 2ZAUA 1SZJG 2NVUA 5BV7A 5ILGA 3A27A 2KYRA 4EPWA 1SA0B 3NIWA 1RM4A 1R4NB 3Q12A 4FEAA 1LVHA 1OC4A 3DDCA 3MJHA 9GPBA 5FO0A 2ZJZA 5B36A 1V8OA 2UUAB 3LXUX 4R83A 4RY9A 3V1YA 4LWSB 3MAGA 4M0LA 4UVHA 4XGIA 1CT9A 4IS2A 2IZZA 1EK0A 3OY7A 4ARZB 2FWAA 2X0DA 1MCZA 4ZT3A 5GWXA 3M1LA 3U7IA 4KPYA 1L4FA 4GS5A 2I7DA 2H2IA 1PZEA 4XSGA 5A7GA 3VQXA 3BHPA 1QZUA 5A5EA 4GYCB 3BIFA 2QROA 2CK3D 3K20A 2Z6VA 1BFUA 4I55B 4F46A 1RQRA 4DIUA 2QAGB 2XW6A 3VH3A 2QX4A 5GZ3A 4JLMA 4KUHA 5B1EA 4JP2A 2A7QA 3YASA 2B4RO 3UJPA 3AVPA 1F8GA 4IJ6A 4YMVA 3EEFA 4KO2S 1CZOA 4GLBA 5AKIA 2AX3A 4DLAA 1T36A 3RJTA 3VU9A 3PDUA 1X39A 1DELA 3FSGA 5FYQA 1UKEA 3CVJA 4RK5A 2DKFA 5G3YA 3FSRA 1WQ3A 4J7ZA 1H6AA 1JQKA 2H16A 2BZ0A 2Z98A 1Q74A 1WG8A 2CJYA 4UBLA 5B1SA 1RBZA 5L3CA 1MRNA 1HDEA 3ZJ4A 3I5MA 2QVZX 1PNMA 4IDOA 1ZCBA 1TI7A 1L1QA 1X92A 3OY2A 5LBIA 4UUOA 3GLGA 2V98A 2BPOA 4B5CA 2UXBB 4RC9A 2YC4C 1B73A 1EFHA 2GAOA 1D1SA 2A1TS 2AMTA 2LBTA 1BXRB 3M81A 3L93A 4ZYYA 5REQB 4IJQA 1U9IA 1H3EA 1E0SA 5LNK6 1W73A 1B1AA 3OE4A 2R6R1 4MQEB 2FMHA 2C42A 4A2PA 4NPAA 5C51B 2PPLA 4GICA 3ZWYA 4KPEC 5H7XA 1VQOV 3PS9A 1I0IA 2RQ6A 4X1IA 3I55V 3QNUA 1S8OA 1LPBB 4AI8A 4FHEA 3AH8A 2AEEA 3TYXA 4OL9A 2DVMA 2RAPA 2XB6A 2AK3A 4DOMA 4UTNA 4RVSA 6PFKA 2R87A 2IS6A 1PT9A 4JOCA 1E9FA 4F6EA 4C1NA 4PINA 2EAUA 3LLCA 4TVSA 2VYND 3K5OA 5I9NA 3PLAE 2VRNA 2WHPA 4IH9A 1AUVA 1R4MB 4UVGA 1E1LA 3TDMA 4KWEA 1XCMA 4B0OA 1XTBA 3EZYA 4P31A 3RLFA 2DM6A 4DUGD 2G38A 2UXCB 1XMXA 5AOAA 3IKLA 2PD6A 3V7EA 4CZZA 5THQA 4B34A 5CDHA 5KCZA 3OA0A 4HEQA 3K6SB 1QNLA 1AUXA 4QOFA 4YRDA 2H52A 3SX4A 5WRFA 3DM9B 3GRAA 1NXVA 1KQGA 3MXTA 2FFBA 1UXGA 4NU8X 1AK9A 3PQDA 3KQUA 1TVEA 2HT6A 3KOZA 1CDDA 4LDRA 3DLAA 2VA9A 2ZB4A 5BYAA 2DQ0A 1LC3A 3PD1A 4GEKA 4UE2A 1BYUA 4X64B 3S02A 2VBFA 3W3AH 3K2EA 2JD1A 1NURA 2C7BA 2OV1A 2QRJA 3PGLA 2YJ5A 4KFMA 2Z0AA 1KO4A 3PFBA 4MVSA 4J1QA 1LVGA 3QA3E 1F0KA 4LBWA 1T9ZA 4ARVA 4PXSA 2HSEA 3MEQA 3MAAC 4G4IA 3KJZA 1W55A 3ROQA 2R1UA 2DH5A 4D9MA 1JTEA 2Z09A 3VZDA 1E2NA 3LG2A 4OHWA 4IEIA 2A0FA 2V1XA 2F66C 5A3RA 4KLAA 3VSBA 3VR1A 5AWFC 1A27A 1YHYA 3UBTA 3U37A 4RD4A 2D62A 4CM6A 2IT1A 2BKUA 3BMQB 3Q0EA 3CNBA 5DE3A 5EJ7A 1S2NA 3ZMVA 3E0QA 3Q9LA 2XVAA 4ZPJA 3UMJA 1H2SB 5JCJA 2GVNA 2FI1A 2W8BB 2RNBA 1Y5MA 4WOJA 3HA5A 2AJTA 4Y9UA 3S03A 2AC2A 2F3RA 1NKSA 1DBIA 3L92A 3GZ4A 1JEQA 1H4QA 2HADA 4A2CA 1TJ4A 5IXYA 1TFUA 4YGXB 3UFXA 2Q99A 1GZ4A 5AXCA 2H5JA 1WA8B 1WNTA 1B6RA 3KNZA 2HJDA 4G81A 4HX5A 1EK6A 4ANFA 1OZGA 2P79A 5KNCH 3GJ3A 1GG8A 4E6PA 2FMTA 3Q40A 4D8TA 3STXA 3SJAC 2XJ4A 1OZHA 2G1AA 2I4TA 3OP1A 1ZL8A 4NR0A 3CRW1 1KQSU 3B77A 3ZHUA 2E89A 3QXGA 4MV9A 2QQ0A 5FH9A 1OLXB 4EY6A 2QPOA 4C05A 3PWZA 1JS1X 4PLHA 1GGNA 1XZIA 4EKNB 3ST7A 3NBXX 4DYHA 3V8EA 2Y0CA 4TUYB 5T6MA 2QM3A 4R9RA 2HJHA 3U7QA 3HUUA 1CP2A 1DKRA 3HR7A 3LUGA 3BT7A 2WW8A 5J43A 1KMQA 3KWFA 2C3OA 3S0WA 4UTPA 2PKQP 4YWHA 1XMVA 2LUOA 5C7OO 3LX5A 4DCMA 5HIAA 4JVNA 4RU1A 2E87A 3PLNA 3R7WA 4DV4B 2JCYA 4MW5A 3AVTA 1QLHA 2VAVA 4G24A 4AJPA 4O4IB 1E7RA 5EJIA 4QWWA 3EGXA 3FZNA 2VYVA 5DLDA 2W6OA 2JBHA 3GOQA 1I2DA 1A88A 4C3ZA 3BH0A 2YIBA 2CNDA 4J41A 4EJFA 5CIYA 1S3SA 2FWIA 4Z3OA 2BSXA 2KQXA 2IXAA 3A4TA 3SC4A 3HVHA 2WYOA 2PV0A 2J7PD 4YALA 2WAXA 5KNBD 1RYHA 2GEDA 4V39A 1QVGF 5DH9A 4O1IA 4WZBE 1EVKA 3AGPA 3R77A 3AFGA 3IP9A 3OTIA 3VU0A 3SSOA 2QD4A 3GLRA 5INTA 5C4IA 3AIKA 2XCUA 2ZTHA 4TMYA 3TVTA 2PUTA 4YR9A 3OZSA 5LBTA 5IWAO 4U7JA 4CDGA 4M3NA 2JJ1A 2NP7A 1XQYA 1CLUA 2VVTA 1CTQA 2Z43A 2DPYA 3CSUA 2WOJA 1EJ2A 3IKEA 2P69A 1GVNB 1ICEA 3H18A 1AKQA 1QZTA 2GM4A 1XD8A 4Y2VA 3EUEA 5TPZD 2JDID 1T1GA 4TTJA 3OWOA 2W8BC 2WSMA 5BUSA 3D3JA 3NEAA 3IBFA 4BBPA 4LJKA 4XIGS 4MI3A 1Y3HA 3EAFA 2P4VA 2WBLC 3HFRA 2GX6A 4W6ZA 4PYLA 1NQ5A 4LF7O 5H3LA 4MRSA 1O96B 4B7AA 3L9XA 2PANA 4X62O 1IURA 3H2HA 5A5DA 4U7OA 1JQ3A 5DTEA 4MITA 2PH5A 1PSZA 4U2DA 3U4GA 3IAAA 2EJBA 3LT2A 2ZBEA 2B61A 1USWA 2NZJA 4E94A 1O94D 4JJIA 4OQNA 1IZZA 3VZQA 3B4SA 3KDSE 1K27A 1DTWB 5IY5B 1EVJA 4FZ5A 1UDAA 2E37A 1VQ4V 4X92A 1AHPA 4IH4A 4G4WA 1I2ZA 1J49A 4EG0A 5LU8A 1NVTA 3QE0A 1M0WA 2NO7A 1MAAA 5AKYA 5E4TA 1P81A 3WB2A 4PA9A 3KWLA 2ZROA 2V6BA 4XQGA 4II3A 1TT5A 4K9KA 2PX4A 1NE7A 2VP4A 2HUNA 3CX7A 3NBZC 1NJSA 4DUZB 4J42A 3W77A 3CUVA 2H9AA 1U63A 1JLKA 2ZRIA 4NNJA 4J7KA 2GKOA 4U7TB 2VNSA 2YMPA 1YWGO 3F6CA 2HRQA 3PGA1 5B1OA 4PLTA 5FV7A 3HJHA 1E99A 2YVUA 3RSFA 3NI2A 2G76A 1Y5IA 7REQA 4MTCA 1O03A 3GEDA 4X9QA 4KR0A 5C1PA 4Z8YA 3PVSA 4H1WA 3ZIAD 1YTFD 3P97A 1JG2A 1SG0A 2VRZA 3BUSA 4CMJA 3T5PA 2QG4A 1LJ8A 1I2AA 3E5RA 3ISVA 3NOXA 1PWYE 1TCVA 2FSVC 3NGMA 1SH7A 4MW0A 4DKJA 2JVIA 3TOCA 1ZY2A 2FSPA 3A4MA 3FOWA 3LGAA 2P2NA 3R7DA 5MHTA 1EUYA 5ECWA 1RSOA 2WFLB 1W6RA 4LP8A 4HNVA 2B82A 1VF7A 3LOPA 2PD4A 3M6AA 4R7GA 4A16A 3ZIAG 4DUYB 4FE7A 2VPQA 4RJJA 4JQOA 4IFBA 5HUJA 4PJ0Z 1MA3A 5FHQA 2AKEA 3DVAA 3QF4A 1Z8FA 2NQ2C 3QHAA 3FVRA 4INAA 1Y33E 2NT3A 3UW1A 2E85A 1VQ9V 3PEUA 4L28A 1YCIA 2M6YA 3W7VA 4BNDA 4BO4A 3HA3A 3E03A 4AIIA 4RXTA 3N5CA 2C5BA 3CUUA 1V7QA 1GX1A 4LKRA 4UU1A 3RC9A 3MZ0A 3JATA 1IBSA 4PHZA 2H1RA 4KQGA 3HR0A 3E9ZA 4IZOA 1BS1A 1XPRA 2ZRHA 2G9UA 4AG3A 4F45A 3BJIC 4DIEA 3HR4A 3C9UA 4KO3S 2GK4A 3UH1A 4D0NA 4NFYA 3SHQA 4G8JA 1IXRC 2X1LA 3IQZA 5BN3A 1PUXA 1CRLA 4H7KA 3AQIA 3KSBC 3F46A 5IY5C 3I61A 1I7NA 3SIPA 2H3OA 5K3BA 4IFIA 4KFUA 2UYQA 1LLQA 4UU0A 3ESZA 5BNTA 4DF3A 3ASVA 1TQ8A 1Y9ZA 4RUKA 4P7BA 3GUYA 4L8WB 3TLXA 3VSEA 2WSIA 3A6EA 1TE2A 1O95D 3ACCA 4Z9BA 2YL2A 2HV9A 1NPDA 2YDEA 4J0JA 2ZZNA 2GPBA 3O4GA 5M2QA 3A70A 1WB8A 2JAPA 3HYCA 3F2VA 4U3JB 4MVUA 3X43A 2E3CA 3PNBA 4E13A 2X2EA 1QCZA 2O3SA 1VB5A 4MVJA 5E3JA 2Z04A 2EWVA 2G80A 1IHDA 1ILWA 3OZDA 1E9SA 2PX5A 4B3RO 5BOSB 3QTYA 1K0FA 5JLJA 4EUFA 5H8WA 1CF2O 3GC6A 5H3HA 4QDOA 1UMBA 4H0LB 3BABA 2GTSA 4X1YA 4RTJA 5L3RA 4BVEA 4C6SA 2FCRA 4BNTA 1X9HA 5MN4A 2V7VA 2YI8A 3A0HZ 4ATNA 3W5BA 4TSFD 1U7TA 5ALSA 1DG3A 1CJCA 2RI1A 3STLC 4XGKA 5HY1A 5F7JA 5CDGA 2FUEA 4PCAA 2DWEC 2O8NA 4TPKA 5CDFA 2AR9A 5K8VA 3REQA 1RZRD 2CD7A 4J80A 1TMKA 1AVMA 5CA0B 1ZEJA 4R3UC 5GADl 5K4HA 3DMFA 2JIDA 3AEUA 3W1EA 2D0IA 3I8SA 4D7AA 4FLVA 2HXYA 4BPRA 3RF7A 3PXEA 1LK7A 2GAIA 1U5AA 2BTEA 4M0KA 3QVNA 2D1RA 3QWAA 2COUA 3LC2O 1XOUA 3LDTA 3DFKA 4YQYA 3KTOA 3IIMA 1E8DA 5EK0A 2Q0HA 4EGCB 3A9CA 2YYAA 5ELXA 2XVZA 1O97C 4E5YA 3HFGA 2EP8A 3CO0S 5F21A 1X3LA 4GPIB 4BU0A 3P32A 4WLVA 4L02A 2FRXA 4ZV4A 2FCAA 4H7HA 2GM5A 3HWSA 1SZXA 4KQEA 2REQB 3TD5A 4ALMA 2ZJ4A 2QIPA 1N92A 3A2LA 1WSBA 3I4FA 3ZWNA 3U31A 3NJRA 3U48A 5FLYA 2C4NA 3N2KB 4K1XA 3OPMA 4A4DA 3LU1A 1SHTX 3DC5A 3X1DA 4ZOCA 1LLDA 3R40A 2QEXF 1BGVA 3NKFA 1RTKA 5AVYA 3TCXB 2VDUE 3F78A 3DYBA 3BS4A 2O5VA 4ZCSA 3GAMA 3T9EA 2QL7A 2G8LA 2J6CA 5IUNC 3EGOA 5CXQA 3JQ9C 4CU5A 2G17A 3OPYB 4MJ7A 5EIBC 1E2UA 1YH3A 3I2FA 2IE8A 3L43A 3JQAD 2VP2A 4AZ0B 1Y5LA 4WDQA 2QGFA 2OXEA 1VE7A 4QPKA 1MR3F 3I0MA 5ES4B 1CVIA 5LJIA 4N5DA 3ZWDA 4B6GA 2OBMA 2HXSA 3CZRA 5ED4A 1KFEB 4HDSA 2BCCH 5DLEA 5C5CA 4RTLA 2VWHA 3BXXA 4I5GA 3UEOA 4BVFA 4DCVA 3EVEA 3I8OA 2EBWA 4HDMA 2RC6A 1WABA 1QLWA 2BGMA 2CXUA 3R3HA 3HBNA 1NOIA 5B58C 2RBGA 3VTAA 4IBOA 4KO8A 4MMXB 1FMCA 3CE6A 1VPWA 3COZA 4CEHA 1Q90D 2RBEA 2MSCB 3E2PA 1OPXA 2FYUH 4PHCA 1QHGA 1I6WA 4B35A 3FWZA 1JKFA 2C2MA 2WVJA 4LCJA 4QOHA 3D36A 1NVGA 2HG5C 3WISA 1K7YA 1QYWA 3WGHA 3KXDA 2OD7A 3JQGB 2ANCA 4TQGA 1GL7A 2C5AA 2Q1TA 1OVMA 1U8CB 1ZDMA 3HCWA 5GGYA 1L7DA 4EHAA 2F48A 4IIGA 3AHFA 3UUGA 1GA1A 5KOIA 2LBPA 4HXFB 2C1XA 5HGXA 2YKGA 2GRAA 3C5EA 2C78A 3HJAA 1QLNA 2HQ1A 1BEZA 1UFRA 3KZOA 3PWTA 2AIZP 2DXIA 4UMVA 1S2LA 3IBCA 4BT7A 1P5ZB 2VDWA 1T4BA 4MS3A 2ZDGA 4R9SA 5KWJA 5G4LA 3VU3A 2ACWA 1ZIYA 1L1FA 3VNQA 4F4JA 3VKFA 4HDRA 4BWGA 1OT3A 3RYFB 2X6CA 4C4YA 2IY9A 1DDOA 1I14A 4OV6B 3G9XA 5JRZA 3LLVA 2FEAA 2JJ1G 5IYBO 3VYSB 3PPYA 5ALDA 2I1QA 3DF7A 2V7PA 3RF6A 4NS1A 4G37A 1SZCA 1X7XA 2IC5A 3C3MA 1UXOA 3PVCA 2XTAA 4NYMR 1D5CA 2CMFA 2OBNA 4K8ZA 5JWPA 3OECA 3G5MA 1GSOA 2WYHA 4HQRA 3R5TA 1TM1E 1HY3A 1Z0IA 3LBIA 4IH1A 4IYIA 4RVUA 4JBHA 1PNKA 3LYHA 4D6XA 3OQIB 5IAEA 4DDHA 3ZWXA 1TA0A 4W7IA 3TOZA 5HJ7A 4CF7A 4EZIA 1KP2A 3QEOA 3HTNA 5LP6C 4XDLA 4H1VA 3GB9A 1SRRA 3KPJA 3K1AB 2HK9A 1BHAA 4AF8A 1JMYA 3BGOS 2N05A 1STOA 4FMTA 4YUWA 3NVKE 4FKZA 4PBRA 4FDVA 4R40A 1B1CA 2H1FA 3ZJZA 4ALNA 3PYXA 1QSGA 3IUSA 4WV3A 4O4LB 1SVLA 1L5HB 4UTOA 1FVOA 4IHAA 5A6SB 5JRDS 4L4SA 2Y1GA 3DFZA 3RLIA 1I1NA 2JI9A 1FNCA 4NEQA 4L3OA 3ESQA 4NBWA 4UAUA 4BMPB 1NQXA 4C08A 4Q1FA 1P91A 3JS5A 3CH5A 2CCKA 3GARA 2EEZA 2BHLA 4XWOA 3T7AA 5ERYA 2UAGA 2OFOA 2OCIA 2DLDA 3NBYC 1JH8A 1FYVA 3BHIA 3EMVA 2P41A 4LWPA 3M0EA 2WUEA 2ZCEA 1LBHA 1K92A 3P9NA 4GMGA 6ABPA 5CBPA 2A78A 2ZIOA 4EECA 5CDTA 2F8TA 2ZYTX 3MWLA 1F23A 4NHEA 2P5OA 3P2OA 2GZ3A 3QE4A 4K9SA 2X86A 1O6CA 1U5BA 2RHGB 1H9CA 1ZTEA 3GVHA 3HZOA 4D3ZA 3UF0A 2ZP1A 4C6TB 5CB4B 3FHLA 2REXB 2VTEA 1O89A 2R4UA 3FLBA 4AY5A 3DEJA 3RSCA 3DEIA 3QYAA 1C1XB 4FZVA 5LWHA 4C2UA 2XIQA 4H7IA 1XBLA 4I1IA 1AB3A 4KLNA 1XTVA 1FP7A 1O0CA 1V7CA 4DCTA 1B3QA 2JLBA 1P6QA 1PV4A 3JAKB 4R5MA 5LDDC 3J81A 2W4QA 3K53A 4CF5A 4NTXA 2L26A 2PMKA 3AB3A 4PZYA 5ALRA 1WDLA 2BJWA 1J1UA 2ZRFA 4IQ4A 3G6EV 3NHMA 1OYOA 3MLEA 3MRTA 1XLUA 4JBIA 4Q20A 1MH9A 1GO3F 4Y6LA 4B5LA 1NBIA 3DT8A 2VNKA 1CY8A 1F0PA 3QKRA 4EW6A 5DLYA 4F6LA 3ZGLA 1YQQA 5EQDA 1RXIA 4XARA 1ZI9A 2ONCA 4GMKA 5DULA 4LECA 1PJZA 4WGGA 1JDVA 1E3JA 1OFIA 4FUQA 3V7UA 2OGTA 3WZ2A 1RWPA 4HB4A 1C1DB 1UXHA 2JK0A 1RWNA 4UXHA 2VXBA 3NAMA 4N7JA 1KYZA 1K7XB 4L7QA 4TLAA 5KQPA 1NSTA 5KVSA 4ENTA 4DV6O 2X9VA 3E20B 3OD1A 5A4KA 4K9MA 1FJGB 4QUEA 2R97A 3DD1A 3AUUA 4CZ2A 1M6HA 3H2YA 4JEMA 2O2GA 2WM8A 3FRJA 3L4BC 1DX6A 4JVSB 2HWWA 3BQNB 2C9ZA 4J1SA 4I4LA 3CKMA 1X38A 5IKMA 3EDOA 4F7DA 4Q7KA 4AZTA 1CF9A 3K9LA 3K5PA 4Z2WA 2A67A 1XV5A 2VP0A 3O75A 4PS1A 1DU4A 3WVNA 3SJCC 2PFKA 5CGQB 1TF5A 3DEHA 2NM0A 1HOTA 3GTZA 3UENA 2G6BA 4NH0A 2C54A 2XUOA 2OCLA 4DR6O 1VJCA 1XEXA 3SZUA 3M84A 1ODTC 5IDVA 5LL6P 3SBXA 4NX2A 5ALLA 1SC6A 4MCJA 1WVIA 3U4AA 1MHTA 3EQ7A 4H3KB 3ICVA 4DIDA 3DYVA 4DR3B 2GR9A 3BILA 2QPLA 3GFPA 2QRVA 3U4QA 1WW2A 2ATEA 1EZ4A 1BRTA 5DHRA 1UZNA 3G02A 4MWBA 1ZS9A 1MB2A 2B78A 3RRBA 1CJTC 1E61A 3VUEA 4BMVA 1A76A 5BY1A 4G1VA 1EB9A 3VPXA 4JI7B 5IKXA 4K8OA 3IJ4A 1RCUA 5AVQA 3T54A 3VBBA 2ZYAA 1A9RA 2CHFA 5HWEA 4RJIA 4C76A 1VQNV 1NBAA 2ZIXA 3WIVA 4XD7D 2Q4OA 1DO2A 5I7WA 4IJUA 3RRZA 3TEJA 3VH4A 4R7CA 3FIJA 2I6QA 3UXEA 1JHDA 1JPUA 3R24A 3X1YA 1JSZA 4Y0VA 4Q3NA 3LC0A 2GYUA 1OYYA 2P7IA 3VNAA 1UMKA 4U7DA 3VAZA 4Q66C 2XTJA 5H68A 3TUIC 3VHXA 2IJKA 1Q8IA 1T9DA 3PL5A 3LWDA 2CGEA 1GPYA 2NXWA 5C5IA 1W0KD 3WKCA 2GPTA 1NT2B 2EQ5A 1NX6A 3PFWO 4N5HX 3T38A 3UPDA 1P1RA 2W93A 3RVMA 5DEOA 3BOSA 4YYZA 2Y27A 4DREA 3N59A 3NV7A 4DLWA 1SBCA 2FV8A 3QKSB 4PN7A 4PF1A 3A0BZ 4DILA 4ZAYA 3GP5A 1DEXA 1FZTA 3K6RA 1IDOA 4P36A 2B92A 3L8HA 1D4OA 4HT3B 4XEHA 4ZEMA 4DR4O 3FPLA 2ADOA 1NP6A 1XCJA 4QPDA 3G2HA 2W2NA 2OHXA 1TU4A 1Z7BA 1K1EA 1YJNV 1SUPA 4FD2A 2CLHB 1Y8QA 5C34B 4TRRA 3ILVA 4XDJA 4N21A 2PQ6A 5B1DA 3KL4A 3S1LA 2CW4A 1HQKA 1XZ8A 2NQ8A 4OAQA 3D7NA 4B9AA 1DBSA 1P84F 1WXEA 4MKZA 2O5EA 2WSSD 5EJ2A 3KV3O 1OI4A 4BIOA 4F5ZA 1ZESA 4URVR 3CR3C 2HSDA 4MXDA 3LMKA 3N0VA 3O1LA 1N2XA 5D6NA 1T2DA 3I64A 4JIGA 2E4YA 4QA9A 1Q19A 2QMEA 3C4VA 4N8DA 3A9VA 3C6YA 4KDRA 1E5TA 4LHXA 2VP3A 2RE8A 4PZCA 3QU2A 2UKDA 2X8AA 1YMQA 2UYCA 3IAS6 1YDGA 4YHHB 1L4NA 1XL4A 3E7PA 3ADCA 1QE0A 1D8AA 2O2SA 1IMJA 1VE6A 3QU7A 4BFVA 1HQYE 4TKZA 2Q9CA 2VL7A 3NPMA 5LXTA 3A0RB 3AETB 1R15A 1FX1A 4OK6A 1UKVY 3UAOA 1L7XA 1H38A 1ND6A 4K9RA 3PQ3A 1OFHA 1DCMA 3PHCA 4X20B 3STHA 3VBCA 1EPUA 3HJWC 5KAFZ 4PDMA 4X66O 3O8OA 1DXQA 3W06A 2R8XA 2XMBA 1ISRA 2AMYA 4HAUA 3LDFA 4D26A 1NJIW 3NNNA 3DVLA 4DXHA 3OF3A 1IY8A 5KTNA 3CKLA 1W57A 5ALIA 2Y2VA 1YONA 4WCFB 1X86B 4BAUA 1Q1GA 1ISMA 4DUGA 4RLQA 3FF1A 5CURA 1U3FA 4DR2O 2Z6UA 2GJAA 4GI1A 3OFVA 4AKGA 1GU1A 2KWIA 3SKXA 3EVKA 2XLCA 1Q8RA 4TTIA 3V4RA 4ENWA 3KLMX 3UWSA 3DJYA 4WQMA 3RO7A 1SETA 3WY9A 3D6VA 5EMKA 2WMNB 2D00A 3LUBA 1FYEA 2O57A 3L46A 4X60A 2PZBA 1TGOA 4LZWA 1M90W 4PC1A 1G5RA 4LJ9A 1T4DA 3VR6H 3DTUB 3B82A 4M0UA 3HNOA 2ZI5A 3CRAA 3FWKA 3D6JA 4QJIA 3QH4A 1EM6A 5I7EA 3JYCA 3N05A 4CR6A 4MW7A 3AF1A 3D01A 4WXMA 4R1UA 5CT5A 1SBZA 3FAKA 5GM1A 2CTWA 2D74A 4B4DA 4BTEA 5CFMA 3GGDA 1OKKA 4KQCA 3HYSA 5TMDA 3EPKA 1HR0B 2H4WA 4YP9A 2OPHA 3LWNA 2UZ3A 1GR0A 3DE2X 3RKSA 1UKBA 3GQBA 3MGKA 2D5LA 5F2VO 1YJ9V 4IJMA 2B1GA 2HRBA 3DE7X 3UG6A 4L87A 4EELA 3PUYA 4RF3A 3FZYA 1R5OA 3F0TA 4HN2A 1FFEA 2V7EA 5C8VA 1JSCA 5HJ5A 1SF9A 3SU8A 1LDMA 1Y3AA 1B23P 3VPGA 2ETXA 3OTOB 3C8HA 4KACA 5HP8A 3P27A 2C9MA 1NLZA 3JVDA 1JRLA 1CS0B 3PTZA 4NBSA 5FUMA 2JK1A 4P35A 1W41A 1IJBA 1O0SA 1RZVA 3R0ZA 3LFUA 5EGSA 4YMIA 2WWXA 3QFCA 3MMXA 2AV6A 4EA8A 3K6JA 4G9GA 3WI7A 1EG7A 3CZ5A 3DQZA 2F4VB 1U28C 1CUGA 1DQSA 4Q1VA 4ITUA 1U0EA 3GLFE 1KHHA 2AI3A 1WLSA 3QVVA 3ET4A 3MMZA 3IKVA 3C0KA 5ER9A 3C74A 5G0TA 1K6XA 1G8AA 1WOYA 4GPD1 1K7FB 5EXEA 1ND5A 4OBBA 4OXQA 2CE2X 1J06A 4UFOA 3AC0A 3D4PA 1WTAA 1EA5A 5DN6D 4KSBA 3ETCA 2XT9A 1HDGO 3MTGA 5JVDF 4O25A 4QTUB 1UEXC 4C7OA 3ZTYA 1DX4A 3Q7TA 4GOLD 2B20A 5AFSA 4Z4FA 2CLEB 3O2QB 3T7TA 4PAQA 3S0YA 4IRMA 2W6MA 4P4TA 3ELBA 4D6TH 1VHDA 2YYZA 4P38A 4L4XA 4CTMA 5JD6A 5DX8A 1KL7A 1QH0A 4OMCA 4A1FA 3IV9A 1HQCA 4LSGA 4AMGA 3K71B 3F67A 1FTSA 3ELYA 1OZAA 2V7XA 5H5JA 3ED5A 3BF7A 3ZV4A 3WNDA 3BB3A 1A7AA 2BD0A 3T4ZA 2HK7A 3V55A 1MO5A 3CCUV 2F4NA 5CFZA 4F97A 3G9TA 3KVRA 2QMUA 1X0VA 3Q5EA 4H2DA 4FM0A 3TTWA 3ONVA 1I5RA 5ER6A 3L7DA 3VC2A 4MVWA 3VR5H 3D7KA 2IHKA 3V1NA 4CM4B 1BT8A 3HNRA 4PGAA 1R6TA 5KNBA 1KZ4A 5HF8A 1EVQA 3G79A 4DY6A 1YRAA 1TZKA 2QZZA 1Z73A 1FP4B 1YVEI 1RRVA 2VFAA 2Z3YA 3FOZA 3MWYW 3LUTB 2O54A 1AGPA 3PIIA 1SJ9A 1NU1H 3KZMA 3HI4A 2FQXA 5TPZA 2QAJA 1SQBH 2VHXA 1E1DA 2AX4A 4GEGA 4LF8B 3DTVD 1Y4MA 1CZLA 1J99A 3G0CA 1ZXBA 1BHJA 4FI3C 4JBXA 2VPTA 4PO8A 4HH3C 2JAHA 4HBNA 3VISA 4RKQA 2L17A 5J5VA 5B58T 2BFMA 1JDZA 4RETA 4BZWA 5GGXA 1J0CA 4JQYA 3QBEA 4WFQA 4RA9B 2HTEA 4K7JA 3MFQA 3DMYA 3W6OA 3HBAA 2OAGA 4OGWA 1O94A 3ANSA 4N54A 1XU9A 1GQRA 1MUUA 1EP3B 4O5AA 4R4JA 4M98A 2WLSA 5DNAA 1XZKA 3N74A 3CD6F 4BW0B 3NM5A 1KKMA 4Z54A 2BDTA 10MHA 5JMWA 1EWVA 3Q7RA 1GRRA 4XIFA 4OI0A 3C16C 2Y69B 1OFUA 4Q9JA 1DV2A 4Q9KA 1MOPA 2X7JA 1SQ5A 2YXNA 2XT6A 3R9WA 1VYTA 3QUTA 5HM6A 3RW9A 2JCVA 2BEVA 2W6ID 1DQPA 3FKSG 3RYIB 1M7BA 3UUEA 3I5AA 4KE6A 3NDPA 4OXNA 5A0VA 4RTPA 2OXFA 4RHCA 1UBKS 2ZUTA 4MVJM 3IIKA 3AEYA 4ZJYA 4HVCA 1TTHA 1Y4UA 3TG8A 3ZIAA 4BFSA 2K2WA 5FJIA 4XM2A 2F43G 4GNRA 4EPRA 1QP8A 1U11A 3IT2A 5BV1A 1NXXA 1FLDA 4LYDA 5DVZA 3OZXA 5DJ5A 4EHJA 3QG5A 3GJQA 4URFA 4UHFA 3JRXA 1DRWA 2CVHA 3L7BA 1L0BA 4INJA 1KQSF 1HDYA 3UHAA 1JHYA 1AXRA 3V1KA 1DUSA 1XQWA 3CCRV 1OJLA 3HFJA 3EVBA 3AKEA 1EWQA 1GUDA 4KE7A 1QHFA 3L8CA 5AR1A 2ONKA 3KVNA 1MAVA 2IYNA 5GM2A 1N34B 3D5QA 4OKNA 4I36A 3ROTA 1IY1A 4AUEA 1N33O 4UUQA 2GV9A 2GGSA 1CLEA 3G5LA 3L71H 2CZQA 2Z56A 4Y6RA 2XRYA 5I5EA 1TA4A 1ESZA 2Q3DA 4BVAA 2XD9A 5J2TB 4OU5A 3I1IA 4FYYA 2OCXA 2BR5A 3S1AA 4AX4A 1T0HB 2CK3G 3JQ8A 2OCGA 2Y4NA 1GAQA 4MUYA 1K4MA 3K3PA 5FEMA 1VE1A 5ICGA 3T52A 4O33A 4OLAA 2ZUCA 1RYBA 5IDWA 3T9FA 3DE5X 4EKGA 521PA 3UTCA 1P4HA 3BRSA 5IJ9B 2FUNB 3M70A 3QUBA 3VQWA 2WLLA 1SIOA 2QN3A 2C82A 1C7FA 2FPWA 5EKUA 5HIIA 1UBEA 3WMEA 1KYWA 4FS8A 3ZMZA 4URUR 1RJ9A 2HBRA 2HQSA 1J9ZA 3FVQA 5EXTA 1NTKH 1QVRA 3DGFC 2BE3A 4F5EA 3ZBQA 1YVWA 1H1TA 1JG6A 3AVVA 3NBMA 4V0LA 1MZVA 5JPCA 2SICE 4R84A 2ZIZA 1U2SA 4QYIA 1NLMA 2P0AA 4LMRA 3FCEA 3K2BA 3QVUA 2R6AA 4OB8A 3QBJA 2EL7A 4LNAA 1KI2A 4B75A 4PNZA 1OWNA 2P4SA 2GERA 1DBWA 2P65A 2CVQA 4ZHSA 4D81A 2K2QB 5DV9A 3M3DA 3UGTA 3FHTA 3RFVA 2GJ9A 4OXXA 4PU0A 1H2LA 3GX1A 3KOXA 4H37A 2BCGY 1VL6A 3BGWA 3TOVA 4HC4A 4EVQA 4B9EA 1QVWA 3GUZA 3AI3A 1Y7IA 4F5YA 2WV7A 2QUBA 4RHEA 1CC1S 1EA7A 4JXXA 1PX0A 4DPMA 4HGNA 2OCYC 2VYCA 1Z2AA 3H5OA 4UCUA 2YWFA 1K5GA 2WKPA 4ZMSA 1I3NA 1TUIA 1G20E 1P4AA 1WPQA 1HORA 3EPHA 4IG4A 4TSFA 2EGGA 1FUYB 2WIBA 1TQ6A 1NH2D 2BI7A 4AJOA 2HPAA 1K3TA 3FPAA 5TVKA 2PL3A 1B00A 2QAGC 1NPYA 4HLUC 1IXZA 1VXOA 1RZRA 5JNSA 3O38A 4OQMA 4MS4B 4DAEA 1V4VA 1ADFA 1QQ6A 2ZYVX 4RIIA 3BXEA 2A6PA 2C59A 4EW1A 4JLPA 3D2LA 1Z74A 4KQWA 2O1EA 4LVUA 5DHTA 3AF3A 4HRYA 4HAZA 1D2EA 1J0EA 1O4VA 1WSDA 4BC1A 1MRZA 2G82A 4ABTA 2LD4A 1BKDR 3H86A 4OGLA 4H7JA 3FAVB 2ZXUA 3LY5A 1G6UA 1VG1A 3L8DA 3CWZA 1T9GS 2QI9F 5CH8A 4MA5A 4NHOA 3F7TA 2ZYUX 4JI4O 4LFAO 3ER9A 3Q7SA 4X3CA 3PIRA 4B3DA 1X7HA 1SXJE 4NXMB 2HVKC 2A5YB 4HSEA 1DIAA 2C61A 1H2NA 3BL6A 4HMPA 3RQSA 1UBFA 1OREA 1JVMA 3GLIE 3TG2A 5DBFA 2XQIA 3GDGA 3V2IA 3G8CA 3NIBA 1XNJA 1N6HA 4LSZA 1XRJA 1K73W 2GM9A 4F2DA 3QLTA 1RI3A 4KVZA 2V9YA 2YWCA 2BF7A 3Q10A 1MG1A 2WA1A 1RXEA 2FK7A 3VVLA 4HNSA 3RAFC 1G9XA 3ZHSA 2UVPA 4ZV7A 1FJXA 3UAZA 2V03A 1H2KA 5EZYF 4PC2A 4JI6O 1GPH1 2FZ5A 4E88A 2Q6LA 4P84A 3ZLBA 4BN4A 1RWXA 4JT4A 1C4OA 4TTAA 5B4UA 3NWEA 1OH7A 1HZZC 4I6GA 1IQRA 1NVVR 4EIWA 2X0IA 1X19A 2A86A 3JQAA 4MZXA 2AFRA 1T0KB 1XNQO 1PL7A 3CCQF 1BMQA 1ZM9A 3UT6A 4ZAFA 2QN9A 1OT5A 3C8UA 1UFVA 2I4LA 4YN3A 2C20A 5EXDA 1BX1A 4IHQA 5D3KA 2OV3A 2BF4A 4Z99A 2A57A 5EJ8A 5C31A 2H6LA 1SFRA 1KEKA 5DBIA 1M5IA 3SR3A 2H3EA 3CHYA 1PSDA 4BGDA 4XX0A 1RRMA 3ULKA 3G5TA 4U2KA 4HG2A 3B12A 1MMMA 1EJBA 1PS0A 4BNZA 1HV8A 1G8MA 1FTYA 4WK6A 4MWSA 3NHYA 4XJSA 3AF5A 1I8TA 5P8WA 2RKBA 5DNWA 1GGFA 5K0SA 1IHYA 1SOAA 2FMKA 3PC8A 1D0IA 1PK9A 3K9NA 2B0CA 1MQSA 4FSDA 4Y2QA 4XVHA 4AW9A 1PR6A 1GT91 4IXWA 4QPZA 2Q2WA 3P9ZA 4KH1A 5T8KC 3EQ6A 3TTTA 3QZUA 2R72A 3L1HA 4MWDA 3H2IA 4G27B 1UC8A 3NZEA 5A4MS 3AK2A 2HUPA 3H2SA 1JWBB 1ISHA 1T4MA 1GJRA 2JEYA 2BOCC 3LC7O 3EXIB 4D5GA 1ETUA 4FJ0A 4NJEA 1LUWA 3CNLA 5KNDD 3NWJA 4E4EA 1YEWA 4YPFA 5ICFA 3B1WA 3C8LA 4IFEA 3LL7A 3DDWA 2FVXA 1XD9A 3JZMA 2N0SA 4EY3A 1TA9A 5CLHA 4JUFA 3HCCA 5JSHA 4WBNB 5EWLB 4JITA 2PH3A 2KW5A 2W43A 1KY4A 4RV4A 2YIVX 3R5SA 1F4PA 3MW8A 3KVVA 2CNBA 4CV1A 2HMWA 1V5IA 4JBYA 4DWWA 3T4UA 4M8KA 4RTNA 2O59A 1WNFA 2R7NA 4UBKA 4QT4A 2Y4UA 1Q1NA 3GEPA 2QEQA 3IDZA 4U7NA 2YRWA 2YYYA 5A7FA 2FN9A 5LOVA 3RS9A 5AIAA 3J81M 1N5DA 3GJYA 2CKMA 4ZVTA 4B71A 2JDIG 4PZAA 2OK8A 4CF4A 4LDNA 1C9DB 4FK5C 3KQSA 1QGZA 1X52A 2ISQA 1IBMO 3PA6A 3T4EA 1D2CA 3LSSA 2DFVA 4WZZA 1E2HA 1N1GA 1GYPA 2YI9A 4Y2RA 2JD2A 2QVCA 4QIHA 4B3JA 2KBFA 4H27A 4JAVC 3IMCA 3QK7A 1FBNA 1JQJC 2KB0A 3GWZA 1Q21A 3DSRA 5LQAA 5E1DA 2Y1CA 1IEQA 5K3DA 1RHQA 2ZWMA 5LD2B 1JMVA 4WN9A 3HWWA 3N39C 1U2DC 3S7ZA 2B5UA 1GAEO 1ZYUA 4QHTA 2F2TA 1EBBA 4IIJB 3QUWA 3WAGA 1KI1A 1VP3A 2WEKA 1W47A 1GUYA 3ZU5A 1X7OA 1JAHA 3KR2A 3H8VA 3MSXA 1OFVA 5LMCA 1PG0A 1UMDA 2F1OA 2ZPAA 1F20A 4CMKA 1N9GB 1FF9A 2WE8A 3H4MA 3WQRA 5BWMA 3PUIA 5CBFA 4MMZB 5FLEX 1FSSA 3WLSA 4R5HA 4EI8A 5KS2A 1Q15A 4ZT7A 4X90A 1G19A 2A1IA 4I1OA 1P18A 1UCFA 1XLVA 1QIMA 3T3GA 3DXYA 3NTLA 4FEYA 5LZ2A 3SXJA 3TJTA 4W1PA 3QUSA 4ARSA 1JA9A 4J3FA 1IN8A 4PLPA 4A8TA 3OZTA 1KECA 4JOSA 1VHWA 1Y4ZA 3ZY2A 2WKSA 2P9GA 4Q18A 4A73A 5IK2D 4PLWA 2O0HA 3WIBA 1IBRA 3FNEA 4R41A 4F84A 2YJGA 5DGXA 3ZDAA 3NDRA 3CH4B 2H51A 4AO8A 4TWZA 3GFTA 3BYQA 2GUWA 1YZYA 5E2AA 1W3EX 4MEJA 4M87A 1V4BA 1QX3A 2RDMA 1C3XA 4E7OA 4JR1A 4KN9S 3PUWA 4CN9A 4IGFA 2WQ6A 4ZKDA 4MCAA 1R4AA 4YRSA 2KJQA 5U4XA 1PJ4A 4DCOA 2JD0A 2WIFA 2Z2IA 4X7BA 2QWPB 3HDHA 1Y76B 5FRDA 1VYVA 4MWTA 2DTEA 4ZGWA 2ZKIA 1KF0A 4XDKA 1L1RA 3W6ZA 2H2DA 2JFWA 4Y0NA 3T5DA 1BQZA 1E2LA 1H6DA 4ACBA 3S7TA 2JRLA 4DS3A 4PPQA 4UM9D 3I0NA 2AN9A 1G2QA 1AN0A 1JQAA 2J32A 1JIXA 1A50B 1HYEA 2OYQA 3OTFA 1QZZA 4PZDA 1NVMB 4KJZA 1NZ6A 2Z8ZA 4IFTA 2X40A 1XDGA 3STWA 1P39A 4WADA 4L07A 2G04A 1YI0A 2B2NA 4KQFA 1FDRA 5HOQA 2OK7A 1W2WB 3EF1A 3CUYA 4KWTA 1AI7A 1Q7CA 4D8YA 1GCGA 2HNAA 1QG0A 421PA 4H3HB 1CJVC 2GYVA 1VQ5F 5LD2C 4CH4A 1VQLV 1BL8A 3G8DA 3HWX1 1KNKA 4KXQA 3KOWA 3ZH9B 4NU6A 3IR6A 1MC5A 2FSFA 3A6LA 3O8RA 3P3NA 4CODB 3D4BA 2RH8A 5HX7A 4KE8A 4CM7A 2HSWA 5HIMA 2WY2D 2ZF8A 2IQ5A 4LC9A 3CX3A 2EU8A 2C92A 3PT9A 1Q3HA 3BE5A 2J0VA 4FOSA 1BGYH 1CX9B 5JMTA 4TKUB 4AX8A 1MPXA 5HMLA 3ZD6A 4EF6A 1R5NA 4ID9A 5FXMA 4ITRC 5IH3A 1X2BA 2CHVA 4B33A 3U19A 3OE5A 1V96A 3KLBA 3ZWAA 1H3NA 3DNFA 4L0DA 1QPBA 3D4OA 3G89A 2IEIA 1D5WA 2FPSA 1PT7A 5FR1A 1J2EA 4B3TB 1B0PA 1JIQA 1IV4A 4MIKA 5KWSA 4JYAO 1V11B 1JQ0A 1LQ2A 2C5EA 4QBKA 1KY5A 4PRLA 4BVJA 3BFRA 3OFJA 5AVTA 3QPUA 3A1SA 3WSTA 4YBZA 1IWBB 1FIUA 3QX3A 1NDQA 4GX0A 4G1MB 4QOJA 4YASA 4MV0A 1ZO8A 5IJAA 1XYYA 1JAXA 3IELA 5FWAA 4NFHA 2Q0SA 4KPUA 4FKMA 5KHKA 1WS6A 4MQUA 1XF9A 4TSFG 2QRLA 2GXQA 4BFTA 2HFJA 3HXLA 1LW7A 4R1MA 4DMHA 3UHOA 2O3UA 5ALXA 3KKKA 3DL2A 5HY4A 3AERB 2PL5A 1MOQA 4K46A 3ME5A 2QR4A 1S4QA 5FNVA 3IQFA 4QRHA 1QJ4A 4WT7A 3HXKA 1LD3A 3QP9A 4FGSA 2HU5A 4CG1A 4KHPO 3DMGA 3C43A 2H94A 2UZ0A 4PAOA 3C1AA 4LCUC 5E7IA 1EP9A 1N77A 1YS2