4X1YB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
428
structure length
428
Chain Sequence
b'EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 144
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1yB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1yB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1yB01
5KX5A 2RHJA 1TUBA 5GONA 4DXDA 3ZBPA 4X20B 2RHHA 3HKCB 3JATB 5J2TA 4YJ2A 3M8KA 5CB4A 4TV8B 1RQ2A 1FFXA 4WBNA 4X1IA 4U3JB 4YJ3B 5IJ9A 3HKBB 4HNAB 1JFFA 5CA0B 5EYPB 5CA1A 4X1KB 2RHOA 3WGLA 3RB8A 5LYJB 4EI8A 3JAKB 4O4JA 4O4HB 5EIBC 3RYCB 5IJ0B 5LOVB 3E22B 5LA6A 4FFBB 3VO9A 3VPAA 4B45A 3ZIDA 5LXTB 5ITZA 3WGJA 3RYFA 5LP6C 4ZI7B 3JAWB 3N2GB 3JASA 5FNVB 5KMGA 5JQGB 3HKEB 3N2KA 5M7EA 4I4TB 4TV9B 2R751 4IHJB 2BTOA 3WGMA 4F6RB 5BMVB 3RYHA 2VAWA 2Q1YA 5EZYB 3JARB 4X1YA 5KMGB 4E6EA 5KX5B 1TUBB 5GONB 4ZOLA 3HKDA 2XKAA 1W5AA 5IYZA 5J2TB 4YJ2B 4EB6A 2BTQA 5CB4B 2GVIA 3VOAA 1FFXB 1W59A 4WBNB 4X1IB 5IJ9B 3UT5B 4LNUA 4DRXA 1JFFB 4O4LA 5LP6A 1W5BA 1TVKA 5CA1B 4O4IA 5C8YA 5J2UA 4O4JB 1OFUA 4TUYA 3V3TA 4KWEA 3RYIA 1W5FA 5LA6B 4B46A 4I55A 4EI9A 4ZHQA 5JH7A 2RHLA 1RLUA 4IIJA 5ITZB 4M8IA 3RYFB 1SA0A 3WGNA 2Q1XA 3JALA 3JASB 5JVDA 5EIBD 4XCQA 3N2KB 4I50A 1FSZA 5MN5A 4O2AA 4O2BA 3N2GA 3ZBQA 3RYHB 4X20A 3VO8A 4X1YB 1RQ7A 3HKCA 3JATA 4ZOLB 4TV8A 3HKDB 1Z5VA 4YJ3A 4U3JA 5JCOC 3HKBA 4HNAA 5IYZB 4EB6B 2BTQB 5CA0A 5EYPA 4X1KA 5LYJA 4LNUB 3JAKA 4DRXB 1W5EA 4O4HA 3C8LA 4O4LB 5LP6B 1TVKB 3UT5A 1W581 3CB2A 2R6R1 3RYCA 4O4IB 5C8YB 5J2UB 5IJ0A 3VOBA 4U39A 5LOVA 4EI7A 3E22A 4FFBA 2VXYA 3WGKA 4TUYB 5MN6A 1Z5WA 5LXTA 3RYIB 2VAPA 4I55B 4ZI7A 3M89A 4ZHQB 3JAWA 5FNVA 5MN4A 5JH7B 5JQGA 3HKEA 4IIJB 4I4TA 4TV9A 1SA0B 5JCOA 3R4VA 2XKBA 2VAMA 3JALB 4IHJA 5JVDB 4F6RA 5BMVA 4I50B 5EZYA 4O2AB 3JARA 4O2BB
chains in the Genus database with same CATH superfamily
2NO9A 3GYQA 4JBYA 2D5AA 3B1KA 2XVZA 3TYXA 2A1UA 4H3HB 1W40A 3KSZO 2QVBA 2UUPA 1EJ0A 3PHIA 3LGAA 1XA4A 2YS7A 1V4BA 3ABKB 4HGYA 1K3FA 4MVJH 1MIHA 2JDIA 1SQQH 3BVOA 3S2FA 5M34A 1P0QA 1S96A 2E0IA 2HL6A 3PHBE 1Y8QA 4HBZA 3RADC 4KV7A 4EYKA 2VQ3A 1FFXB 4QLBA 3ZS8A 5FBZA 2VSYA 1Q77A 4BJ3A 3WVNA 3FJ1A 3OFNG 1FY2A 5EIEA 1SQFA 3KOXA 3KSMA 3H4VA 1I33A 5IDQA 3WGNA 1F23A 3T7RA 4GSKA 1SOVA 4RPKA 1G8MA 1HFWA 2Q7EA 1JJIA 3CB2A 2X2EA 4PIVA 4OXKA 1PWZA 2OXFA 4GLBA 3OBWA 1SRRA 4BEWA 4MTGA 1VXOA 2A30A 4TRMA 4WV3A 3FAZA 1EFKA 1KMNA 1QZ3A 5J47A 4TS3A 3G2IA 2HIAA 4PCVA 3TQSA 2Q3EA 1QIHA 3IQEA 1PNOA 1B3RA 4ZI3A 1KMHA 3EPHA 3U48A 1MJGA 5DPMA 1Q7RA 3GOQA 2IEYA 3K71B 3C8DA 4W7SA 4XW2A 1NAIA 1BE1A 1L5QA 2A9PA 3RNLA 4D5EA 3CH7A 2UUBO 3I3FA 3L7CA 1Z07A 1XELA 1S2MA 5IDVA 1TEHA 3A36A 3B5IA 4PQYA 1P19A 3O73A 3BK2A 3EN0A 2UVPB 4PX3A 3FSRA 1JQAA 1AZTA 4LV5B 1VL1A 3BVPA 2DUUA 5E38A 3QPBA 4YQFA 3HZRA 3KJFA 2V8BA 1W57A 4YUZA 5EE0A 2D7DA 3BJRA 4D7TA 5FNZA 3PD7A 2ZBQA 2LCAA 4L8LA 1MBZA 3PNBA 4LHVA 1X7XB 4EFEA 5FT9A 1N2EA 4BCDA 4URXR 4A0HA 3EG9A 3K9GA 2XDWA 1J2UA 3V7WA 2GTPA 3CSUA 2FFAA 1PGJA 4NZPA 3LFTA 4B7ZA 5KWJA 3L8EA 1JMKC 3ZRVA 4OLJA 3RBVA 4CIBA 1FDVA 3IAYA 1MVOA 4HDKA 5EZ5A 3PVZA 4JL8A 4F97A 2I6DA 3WIUA 1GUAA 5M2QA 4QTYA 3KDAA 2P9JA 4ZQHA 4AILC 2EBFX 5F98A 5AVJA 4JY7A 1TQ4A 4P4GA 2CHGA 3D00A 5E7JA 4NB5A 4CNBA 2C7OA 5C0OE 3E9QA 3IT2A 4DUZO 4I4TF 1CSEE 1P44A 4I1YA 4BVTA 1K7DA 4ZMBA 2UVDA 3ORYA 3VDNB 1ZL8B 2X6RA 4BO9A 2ZIMA 4H3SA 2IS4A 4E0BA 3GFFA 1NU8A 3C7CB 3N6RA 4B0PA 3IMKA 4MPDA 3S2UA 4OH7A 4M7PA 1Y7IA 4CEIA 2W48A 4F9GA 2HLNA 4P9NA 4M0PA 5E6RB 2QPTA 2FU5C 1V8DA 1KFBB 1OLOA 2CBXA 2EX1A 4AF6A 2B94A 3LHKA 4EY4A 4DXWA 4L27A 3CCUV 4DA6A 3RYCB 3C3KA 4AC9A 1QVGF 4EJ0A 2N0SA 1X1EA 1NVXQ 4GQBA 3ZGZA 1WA8B 4NFYA 2ODAA 3CIOA 3BCRA 3ZWOA 3AWDA 3PUKA 2QE6A 5DULA 4DCJA 4B7XA 2QRVA 4S35A 4POOA 3CSDA 5I4KA 4HH0A 1ID8A 4FGJA 3DKPA 2YWXA 3EOAI 1LXCA 1F4LA 5CIYA 3N1UA 4TTVA 2I9PA 2Z6UA 1WN7A 1Z9BA 5EIFA 1NRWA 1WVGA 3OM9A 1XHLA 1UMKA 4RVHA 4X63A 1QX3A 4U3FH 4MCIA 1J21A 1ZGBA 3D7MA 1ZGGA 4OV6B 3LP6A 5F1YA 1KORA 4GX5A 1KDYA 4FXOA 3TRHA 4FZJA 2YJTD 1BS1A 2YJ5A 3CPHA 2A3NA 4FB5A 4FCVA 1H0RA 4DV6O 2YC0A 1O0CA 4P82A 4HI0E 1OIVA 2P5UA 5I7EA 4O1HA 4DJAA 1X7PA 4D96A 4YWHA 3K0AB 4H60A 4PN7A 4D7SA 2TECE 4HDQB 3UBMA 2ZM6O 2V0GA 1PJAA 4OYLA 4C4RA 5EMHA 1CFJA 5EHNA 4QXPA 3WE7A 4GRDA 5TEWA 5B1BC 3C16C 4ESHA 3N86A 1G3RA 4JEIA 4QTXA 1WZUA 5A7FA 3HDHA 2GVDC 2WYWA 2BHRA 4ZYTA 1LRLA 4PDMA 4JP8A 1V95A 4LXXA 2A8YA 5DK6A 3FCXA 4N0QA 1I13A 2OFOA 4CQLA 3KJKA 4N0EA 5FBRB 3MWJA 5FUVA 3D4OA 5CLHA 4HN2A 4OCZA 2JJQA 4BV8A 1G8SA 2GWRA 2PY5A 1R3IC 1YS1X 5IS2A 5A7GA 3DBRA 4MTCA 3M9LA 2I7XA 2BFPA 2LP7A 1YT5A 4JC8A 2F43A 2QJ1A 4IZHA 5HIAA 3BEOA 1DF5A 3IDFA 3R0XA 4JXJA 4LZWA 5KNCA 1YFLA 1V5FA 5EP1A 2PAAA 4E08A 3R0VA 1OKKA 2GBLC 4K6MA 2I3AA 3QBEA 3TG8A 3K4HA 5E1OA 1SC4A 5BUCA 3KO8A 5C1OA 2PMFA 1IPEA 3FCAA 3TQOA 3HACA 3ZK9A 3CW8X 4FGSA 3QVOA 1BGWA 2WJAA 1GFSA 4Z1MG 2RSLA 4IRMA 4LNUB 3RR2A 2QB5A 1XL6A 4G85A 3A4TA 4QNMA 4UXIA 1E2BA 1ZN8A 2ORWA 3PIRA 3ZEDA 1MB9A 4PV7A 5IXYA 3HKBB 5CXXA 2GTHA 3APQA 4UC0A 3NHAA 4JI1B 3EAGA 4JEUA 4KYIB 4I4CA 1RACA 3VO2A 3S8YA 1QKIA 3M6XA 1WB8A 2JCVA 3U6KA 3O8NA 1KAQA 2GF9A 4C2AA 4F8YA 1A76A 4NCAA 3WKEA 5J4VA 5LZ4A 4D79A 3SYPA 2P3OA 2E9SA 4UMDA 3IMPA 3R1IA 1Y6JA 2C4VA 2RHRA 2PX0A 3B38A 4FZ3A 3WIVA 4OOEA 3NV9A 2ZVJA 1LDEA 1I9GA 3F9RA 1IRIA 4AYXA 4N48A 3AG2C 2V8OA 5DLYA 1RLMA 4TLCA 4E15A 1KBQA 4II2A 3E89A 3HCRA 1M57C 1H38A 2PUVA 4LIPD 2VXBA 3VZQA 3WWEA 4ZI7A 1W88A 4NTYA 4LY3A 3G71F 4M22A 2HPAA 4DCOA 1EE9A 1U2QA 1U3TA 1XCOA 3EZYA 4FPXA 2XLBA 3IURA 2GETA 3KQHA 1SK8A 1HR0O 4BNDA 1ADBA 3GI1A 2ISQA 1D1PA 1LQUA 4CU5A 1IOZA 4X00A 1RRVA 1CP2A 2XOKD 1XPUA 4MUIA 4YUAA 1FZQA 1QIKA 2VJQA 1QV6A 4NBWA 1P7YA 5BN1A 4MLDA 4J43A 3B85A 4UKDA 2AHRA 2JAQA 1WAZA 5LMUO 3ZJYA 4HAMA 3MT0A 2OESA 3TPFA 5F5LA 3DVSX 1G5IA 3F6PA 4LZAA 1YB6A 4JASA 4BR6A 1NN0A 3THSA 1AO3A 1Q7YH 2RC6A 4ZQGA 2YXEA 1NW7A 4JODA 4P31A 1WW3A 3O21A 2I1WA 1H5QA 4JI0O 3VKUA 1R0XA 2Q5EA 3LLCA 3K2BA 1XRPA 3RSGA 3W5DA 1FRQA 1XZ8A 4KSYA 1XFAA 4GOXA 3TTUA 4UQOA 1G60A 1PR0A 2W70A 1XX6A 1B16A 5C3MA 2CF5A 2HAEA 5EP4A 1XCPA 2YYZA 2P6PA 1A50B 2MMGA 1JXOA 2DM6A 4RTSA 5K99A 2XHEA 4JYAB 1SXJD 1YQ9A 3UZUA 2DWPA 5L3RA 3USCS 4W5JA 4J3NA 5B4UA 4EVSA 3ROEA 2W6ZA 3I37X 2C2GA 4EMUA 4NV3A 3E35A 3PQFA 3K9NA 2WILA 3OR6C 1GFWA 4K0RA 1ZISA 3OUUA 1VQ8V 1X87A 3TM5A 1QKJA 3RS0A 1E61A 1HQYE 4DPLA 3E9ZA 3I7TA 3OQPA 1PNTA 4QBTA 4AMYA 3K20A 4LI3X 4DC9A 2Z83A 5HCUA 3MYRA 4IXMA 2WSMA 1UL1X 2RHJA 2WTBA 1NLYA 3TTYA 3LOUA 3V7NA 3GMSA 3D7LA 1UT5A 5CDGA 2RGAA 3EGDA 5IULC 4M7OA 4CCWA 4LK3A 1M2HA 1LPOA 1U04A 1DEHA 2VNKA 3KNZA 3T8YA 5K09A 1QU9A 4LR3A 4FCTA 3USZA 3O4IA 3QMPA 2PA0A 2X19A 1LFAA 1H2YA 4L7QA 4H15A 3BMCA 3DMTC 1MVNA 7REQA 2CXSA 1ZSYA 3I5XA 1YA4A 3K6SB 3CLUD 1RI4A 3DGEC 3M83A 2BFBA 4NU5A 1JR3A 3PNMA 1HDJA 2SECE 1IB0A 8ADHA 5DN6G 2G72A 4PONA 3I01M 3VKFA 3NT2A 1WNTA 1H2ZA 3GFOA 4RDHA 1BWRA 4H4EA 5JHHB 3LXUX 1IY2A 1G4UR 1K6EA 2B4QA 3VV3A 5CFZA 2OK7A 1IV1A 3I0NA 1GG9A 4FYKA 4TYNA 5TIIA 4NJMA 1FX1A 1OZGA 1FB5A 1C1HA 4YRTA 3MJFA 1E1DA 5BVHA 2FPMA 2QUBA 3KYIB 4W7HA 1E5DA 2PI5A 4CLRB 4FKBA 2KB1A 1FBNA 1IXYA 3IQXA 3INGA 4C4PA 4NATA 5KYXA 2O8NA 5AKEA 1FTNA 4NNPA 2W2QA 1OFVA 5ALZA 3C1OA 4PZEA 4YY3O 3TJMA 3FTFA 2CCJA 1M0EA 1BQ0A 3ADPA 1RLUA 3IA2A 1GV0A 1CNEA 2WJ4A 4OM8A 1T24A 2G67A 5IC5A 4EEZA 3I73A 1X2EA 4ZKEA 4B6EA 3CSXA 2D1QA 1OB2A 1VKZA 4ZVNA 4M0CA 2H00A 1JLMA 2JDIG 3ZN2A 4CS3A 1RKUA 2QRPA 2HFKA 3AFIA 3UM7A 1H69A 2E5LO 5EZYA 5K0JA 5SY6A 2LCQA 4BMDA 1JQDA 3MQ2A 3UWDA 4LJ4A 2BSQA 5ALYA 4IKOA 1K68A 1O97D 3ZIUA 1BT8A 2G9ZA 2W8BA 3BXOA 1YS6A 1DXOA 4MVJI 4YALA 3QO5A 2H2HA 1U3FA 1RTKA 1P75A 4IIEA 1V2GA 2A1UB 2BF4A 3H65A 5EQTA 3RIEA 1JR3E 2WJVA 3HAXD 5KU1A 3IUBA 3OJ0A 3X2QC 1G0NA 4EG7A 3MOGA 3FTQA 3W2IA 1VIBA 2WB2A 4OPHA 1S8AA 4LJRA 3DLHA 3K0FB 1Y8QB 1CUZA 3QEBZ 1KP9A 2H0QA 1XBTA 2JCGA 3ZY5A 4P0QB 1ONIA 4NBLA 4UE3S 2OCIA 5AK4A 4PZLA 1CUFA 1QD9A 5EQDA 5JD4A 3EWAA 3NBZC 5LQSA 5BXZA 3R7WA 5DECA 1AKTA 2AC4A 1TK9A 2JI4A 2CL6X 2C61A 2UZIR 4DMRA 3OZDA 1U1EA 4JELA 3SM9A 4CV0A 3PICA 3QSYA 1GU0A 1QRUA 4WAUA 3ADDA 5GTDA 2PKCA 5D84A 3Q0EA 4I3GA 1COWD 1CQIA 5KNCH 4ENQA 3RF6A 2ZKLA 4HBNA 2A9RA 3P7MA 1KMHB 1CRPA 1CZLA 1M72A 1PGQA 2NPIA 4RF3A 4W6QA 1R73A 1HO3A 3DB1A 2I67A 5BN3A 1VPLA 4HV4A 1J7KA 1CY0A 3AUXA 4QUIA 1A7JA 3K5MA 3W4KA 4MMYB 4Y6QA 3DZCA 4TTTS 2PX2A 4RSMA 3E3LA 4I1OA 2H7XA 4TTQA 4B34A 4PCAA 2DMXA 4OQZA 4M38A 2ZRGA 1RNLA 1NVWQ 3SYRA 2OQIA 3ZK7A 5F64A 4KVGA 1FRVA 2E5FA 2GASA 3I1IA 2VQFO 4K3VA 2MOKA 1XHZA 4KP7A 3DZBA 5LCXA 5IBQA 4A1FA 2J0QA 4UCSA 4IH9A 1KI1A 4HRAA 1P7GA 3EG9B 2HXGA 1Y98A 3G6WA 3VJLA 4BNZA 1R9NA 2DGDA 2QKCA 4C88A 1N78A 2AUTA 4BVEA 5DW3A 4NV0A 3V4ZA 3NU1A 2RAVA 4BL5A 3K4PA 2WABA 3C7KA 3ZXIA 2VJMB 3VI3B 4HDKB 3N2ZB 1BMFD 3ZE2B 3L7BA 4LCBA 4UBIA 5E9WA 4MVWA 5AG2A 5HNKA 1UXGA 2JFZA 2PWYA 3FLEA 3A3PA 2J0UA 3K3PA 3CUEF 1W85A 4H7EA 2IU6A 4GG1A 3GO4A 4N5MA 3VHLB 1G21E 2F1OA 2ADFA 3JSNA 3BD7A 3OLCX 2YTZA 4MGIR 3PNSA 1M8FA 1T3SA 2QXUA 2OTJV 2PZGA 2JA1A 2JRLA 3EEYA 2PFKA 3HL0A 4ZCLA 4V02A 2EIJC 1Y5MA 5KYNA 3SZ3A 5IFKA 2HF2A 2Q7OE 1VBFA 1DJPA 5GIOE 2PX6A 4UMVA 4CEIB 3QU7A 1E58A 3BIJA 3OZEA 1Y1SA 1MEOA 1LJ8A 3HNOA 4FOOA 2HH9A 1HK7A 1X1AA 3CWQA 3MS4A 1A7AA 2NTYC 4GYJA 5F1OA 2XZPA 2A94A 1SK9A 2Y27A 3DHYA 3Q3GE 4JT4A 2FSUA 3DPSA 2PYIA 4F8EA 2Z08A 3RSQA 3NALA 1XNRO 2C4HA 3ZK8A 3FD8A 1KTIA 4Z0PA 4F6EA 3CCRV 3DWGA 2QRVB 5MN6A 1YQQA 2X8LA 4ESOA 1A88A 3AFGA 1B0PA 3WMGA 3VTFA 3IJPA 4YC7A 5EXTA 2PT7A 5C1DA 4NSNA 1JG2A 4M9XA 4EMBA 5F2KA 5A2QM 2FXVA 3ZWBA 3VO9A 2ZIOA 1R12A 1I5XA 4IFIA 5DWQA 3I2KA 3RBAA 2YWEA 1P49A 5DTEA 2F3SA 1ISJA 3MELA 1AA9A 5IC6A 5J2UA 1RTTA 4E31A 3KAJA 1EXDA 1HFJA 2J4DA 2C1ZA 1BYIA 2XNDD 1L7NA 3MK31 2FHSA 1KAEA 2AL7A 5IT4A 4B4UA 4BP8A 5BN5A 1M5UA 5FOSA 1PZHA 4O4JF 3SZOA 1HDOA 3GT4A 1FP1D 1SCUA 1B23P 3LNMB 3RVYA 1NMQA 4Z4CA 5I9IA 3U7GA 2AW9A 1F4MA 4RZSA 3PUIA 3AF1A 3KB1A 3LT5A 4BOYA 5IBRA 3HUDA 3S4YA 1THMA 3ZXUB 3CMAV 4PR3A 3EXAA 3OU6A 1L7OA 3NWPA 2J87A 4CMAA 2L0XA 4QGPA 2CXUA 4LTNA 3H2JA 2VJNA 1E3JA 4KIUA 4FGKA 2YH2A 5FPQA 1USVA 4CQLB 3EVGA 2PGIA 2H4HA 4OHXA 1E69A 3U09A 4NYJQ 3HKDA 1MAHA 3WDKA 4B1FA 3RHZA 1QO9A 3JR7A 5G0TA 3I9NA 2F9LA 1V8ZA 1NT2A 1KEEA 1PTJC 3KUUA 4URYR 3DBRB 3LWBA 4TXJA 1S01A 4W8OA 2ODMA 2F43B 4I2VA 5EB1B 3THOA 3SQXA 3JWGA 3OQHA 3TEMA 2HVYD 1KQSU 5JS7A 4XA8A 2WV7A 1QFYA 4ETIA 2BFDB 3N0RA 5F2VO 2C96A 1OTYA 2G5CA 5ILGA 3ND8A 4CM4A 3CPEA 4ZOAA 1N8SA 3CTPA 3WLAA 1S2DA 5LP6F 1NDQA 3HBAA 3UJAA 3AKYA 5J5VA 2DX7A 2PLWA 4KBYA 3VZPA 3V1LA 4XDKA 1DIRA 4M88A 4CV2A 2IU3A 2HI0A 2XUGA 1X7WA 2ZITA 2GK4A 3K6KA 2D5CA 5LQCA 4IR7A 4RFVA 4RPHA 3LWQC 3OBBA 1TYEB 2BEKA 1FK8A 3U4DA 2OV4A 3EMKA 4HGNA 5EJAA 4HGQA 5F78A 1ESCA 2C2BA 5HFNA 4FMPA 1JFLA 1QFSA 5L8VA 2VCHA 1W8IA 4DM4A 1OLUA 2H31A 3MXOA 2BJHA 5IK2A 1HA3A 4G4JA 1DKMA 1EN5A 1O6FA 1ZCAA 3NWOA 2DLNA 1LFDB 1W9MA 3JAWA 1NY5A 3GG9A 3DCJA 1HOTA 1NUUA 3IP9A 3R09A 2XA2A 5EJFA 4KR7A 5LFAA 2O7RA 4Z3DA 2OCBA 3PNVA 4AHCA 3CUSA 2VDWA 4XYEA 2DU8A 4ZI7B 1W88B 3U81A 4EY5A 4RK0A 2FNAA 4ZVSA 3RYHA 1ZP6A 3FETA 3R3ZA 5IYDO 1B0AA 1MA1A 2WLNA 1P62B 2JFWA 2GD0A 5I7UA 1AB5A 4I2NA 2VYQA 4A82A 4ZV4A 3H2ZA 1RQGA 3PE4A 4RWEA 4LYEA 1G8JA 4RKWA 1LBTA 5DTIA 4Q3BA 3W3AA 4BNDB 3TQRA 4J7KA 3NM5A 3HMQA 5CB4F 3OJEA 1RWNA 4JGSA 4YRQA 4C05A 3HKCA 1JNYA 3OSZA 4ONEA 5EJIA 1O95A 3T35A 3FKJA 2JJYA 3ETQA 3VTKA 1YWGO 3Q4HA 2V9ZA 1DCKA 3L06A 3MJDA 4NOMA 2RIPA 2AMTA 3NQ41 1EIZA 2VRWA 4BT7A 4D8TA 4EY3A 2OD2A 1Q0HA 16PKA 5A4KA 4JASB 1A7UA 3MN1A 3SR3A 3T1YO 1Z7YA 4HEJA 2ZDIA 2I2WA 3RKUA 2AQKA 4J6EA 4ZO9A 3GJ7A 5T5QA 3W5CA 1SRYA 2HBQA 3D0KA 3PK0A 4IDQA 5AO9A 4XM1A 1OFIA 2X5NA 2BMJA 3TW0A 5I9SA 1L7PA 2FG7C 1YF2A 3PQ4A 4OATA 1DAIA 1N3IA 2IXAA 3WQBA 1SVOA 3CF0A 4BW9A 4HX5A 1K4YA 5BQ3A 1IVYA 2VBGA 1H8EG 3B36A 3SXJA 4NECA 4RHFA 2RHMA 3NUGA 4KL8S 1YCDA 2P3SA 2JGKA 8ABPA 2XRMA 4YCBA 4EMTA 1YS4A 3GRFA 4D9GA 1JALA 3S2ZA 1OXSC 3A8TA 2ZEJA 1WJGA 4WBXC 1QZTA 2IDZA 3DLAA 4G1MB 4L50A 1RJFA 4RETA 4ZZIA 1NQOA 1T9CA 4YDHB 5JPIA 2NXCA 2BOCC 4IMPA 3GLKA 4JJKA 4PZ0A 3X1WA 4Q93A 3O85A 3KYCB 1GDTA 2HR3A 3Q15C 2M98A 5HF9A 1VMAA 5JASA 1I36A 1XNGA 5C4MA 4R1TA 2CF6A 2CUZA 2P4UA 4F72A 1WBBA 1GAJA 1KERA 1RM1B 1RDFA 5AKXA 3EGDB 1Y66A 1K27A 3DUFA 3Q87B 2O3QA 1UDBA 4PRKA 3DM9B 1PDVA 3IUMA 1R6XA 1TDJA 2AQHA 4QYSA 3IV7A 5DNVA 5L45A 2IGTA 4TVKA 1GPLA 1K9MW 7REQB 2REXB 4DR4B 4ZO7A 5D00A 2BFBB 2DLCX 1ZH0A 2ZOVA 1ZH8A 2IP4A 3EPLA 5TQ2A 2C97A 4WOBA 3WZ2A 4Q21A 2QA4F 5TISZ 3ZCCA 1SVMA 3L1JA 621PA 2YNMC 3CVWA 1Y4UA 3RGBA 1E2HA 3TXQA 1ZOPA 4NYMR 1AI6A 3BTVA 2B30A 4HYYA 4NJMB 3UMYA 3GJYA 5A5VA 4D80A 5HKKD 5BVHB 1DEAA 3HH8A 3MA0A 4LJYA 3VOAA 2O6LA 1VGVA 3P0HA 4R5MA 2JGUA 1XNQO 1YCGA 1X86B 3QXSA 2NTVA 3QOFA 2Z01A 1N77A 2YIMA 4BNKA 3ZXXA 1M6YA 1Z88A 2PTGA 2RHLA 5TT0A 5KYXB 4OQFA 1WMDA 1U6KA 3HB0A 1W2BU 4M46A 4YIKA 2FPIA 3AFOA 2J3QA 1DTSA 4RFLA 4QDOA 4KCGA 1VQPF 4Z1MA 1KJJA 2DEUA 3NS7A 5T4HA 2R2AA 4HEHA 2HGZA 1DTEA 4CLEA 4ZJZA 3DQZA 1XDWA 4FFPA 4ZRDA 1T5OA 3K5OA 4OMFG 5BV2P 1CZNA 2VRZA 2Y1KA 2DE0X 1U3PA 2AK2A 3I01A 4RXTA 4I1VA 3RRNA 4L9WA 1KQOA 1FMJA 2YIBD 1DOAA 4AJKA 3RLFA 5LPNA 1KY2A 4O2AF 4NX2A 2QTWB 3UAOA 1TM4E 3B1JA 4IO0A 2CWWA 2RGNA 1D04A 2PBLA 2HKIA 5EZYB 5CBFA 3FI9A 4J1SA 3PXUA 3ZP7A 4F8JA 4AQYO 2UYJA 1S1MA 2EGGA 2W8BB 3PXXA 1UDXA 3V7YA 4B09A 1LY1A 1G16A 4QOEA 2VDUE 4J0JA 4LYGA 1NH2B 3IEWA 1WA5A 1ZI8A 4HH1A 2COUA 3RUPA 5JS2A 4CIYA 2CCGA 1RCTE 4KH0A 4OMDA 4RY0A 3GFTA 2RDMA 3HTNA 2Z2ZA 4CCSA 2BZ1A 5TE9A 2RAUA 5J4HA 4A27A 4G41A 2NNWB 3D4LA 3IH5A 5B6IA 1Q5PA 2HHCA 2QS9A 2VHTA 3L92A 4BDTA 3CZQA 3LLUA 4TTSA 1KSFX 3COWA 2Q27A 1UWCA 1YQEA 5B7PA 2GN6A 1WWKA 1L4FA 4LQ4A 3RUHA 1IU9A 4KQ6A 1ZJYA 4F7DA 1DJLA 2GJKA 4M98A 1X7ZA 5JATA 3WGVA 2QZ4A 4ZTBA 1YVWA 3SPCA 1J0DA 4TKLA 1OASA 5HYVA 1Z2GA 4ICGA 1OGYA 1SU7A 2YCLA 3R7WB 5DFAA 1Q3HA 2FN8A 5I7RA 1T15A 2H3EA 2WD9A 1Y6QA 3CEMA 2G17A 4ZVRA 1SUWA 4CQJA 4H31A 5H9VA 5C4IA 3F90A 4R8VA 1V1MA 3D6NB 1XRGA 3AO0B 3UUGA 2WTUA 3UQZA 2NYVA 2XR1A 3GF4A 2VJYA 1SWVA 4D8VA 3AI7A 4L3OA 4ZAGA 1CQIB 1PBNA 4EQ6A 2JKVA 3VPDA 2JK1A 1W76A 2PFSA 3AP3A 2ZI3A 3G8CA 2Q3BA 1U2DC 1Y3AA 5LNK1 3TNDA 1R18A 2A86A 2FPUA 3ZH2A 1WCIA 1N7HA 3TW6A 1HT3A 1KDOA 4J3JA 3RO7A 2F93B 5BN3B 4NUTA 3ZWDA 5DO9A 2B34A 1ZIYA 1P39A 3KHKA 2VUHB 1YZHA 4IILA 2FFJA 4X6UA 1KRXA 3TBFA 1D6JA 1C8LA 4PYOA 2GJ8A 4YAOA 4G4SO 3HB9A 1NN5A 3G8DA 1MNAA 3CKMA 2I8LA 1A4UA 3MMZA 3WNDA 3QF7A 2ZUEA 2P7TC 1S89A 2X40A 1E99A 3NHWA 5IVKA 4K86A 2TMGA 1IBCA 1VF6C 3BGSA 3V9AA 5LXTF 5G0UA 4J8PA 3ZQUA 5DHQA 1Z4MA 3AMVA 1YRQA 2DFLA 3NYWA 4OGGA 4V0QA 1K75A 4U7TB 3S5JA 1ATIA 3GN2A 1VF5B 1ZUIA 1LQTA 2JIOA 3IILA 1GOTA 3ER8A 2XBUA 5IM4F 1C4KA 4KTVE 1JKXA 4P4NA 5E4YA 2ZS7A 1L3IA 2P9EA 4EUNA 4L6IA 4U6SA 2JIPA 2B4YA 1XD2A 2OO5C 1MLDA 4YQZA 3G85A 2BCCH 4MW0A 2ZRQA 3CT6A 4UVBA 2ES4A 2HYDA 2IOFK 4N21A 2EZ9A 2NZ2A 4GO1A 2J0UB 1W85B 2Q0OC 4F3RA 3B77A 5ENVA 1ZVVA 4H1VA 3DFZA 2C8LA 3H01A 2O23A 3ZWMA 3M9WA 3L7JA 3D01A 2XNKA 1EA5A 3CVUA 3UB3A 1WU7A 4C21A 4ND1A 4CS4A 2CGNA 2IFTA 1NTOA 3ZDFA 4LZPA 1E3IA 4FZ5A 1ZO8A 1ICEA 3W3AH 3RWRD 4QM7A 4ZAWA 2R6DA 3O3NB 1Y8CA 4Q03A 3GUUA 1J06A 1GLNA 5DN6A 2SBTA 4HTAA 1CK4A 5AOAA 3EUEA 3EVNA 2NO0A 4TM8A 1TQDA 1YE5A 4MLCA 3EA4A 5AW6A 1XREA 3B09A 1G6KA 1NBWB 4LYDA 2M2IA 3UAZA 4CUKA 3EASA 4P3XA 1ZUHA 2OAP1 3R23A 5J4LA 1ZM7A 2OCYC 5EQJB 4ZGWA 3ZCPA 3AVYA 1OV6A 1YVPA 1MA3A 1G3MA 1N92A 4BGIA 3AYZB 4Q3KA 4NCKA 1H2GA 2D2CB 2FETA 2CUKA 4WINA 3RIHA 1XA3A 4Q6WA 2G9QA 4PVCA 5CFMA 3EA5A 2KSDA 1HM5A 4MI3A 1Q91A 2P62A 2X4LA 1AMNA 2PV7A 3HN2A 1IOVA 1P1JA 3GCGA 1IBMB 3D8HA 5AHWA 3MLAA 3RFRA 5K03A 2ORIA 3V8EA 1TZMA 3GGPA 3CN9A 2XQKA 2R4UA 5J43A 4YRRA 1CV2A 1ST2A 1D0IA 3E8FA 4EFLA 1KDRA 1GL6A 4FGLA 4YRZA 5BWLA 2FVYA 1XZJA 2P40A 5J2UB 3M7IA 3JSXA 4L5CA 2K1EA 1PJQA 3HL4A 2O48X 4TQAA 5JCOA 3JPWA 2CWJA 1TKBA 2PRSA 5BN5B 1ZWZA 3NKVA 1UBCA 3IRVA 5FBVB 3COJA 3K0FA 1SCUB 1U7OA 1DLJA 2W6PA 4BB9A 2OCPA 2YI8A 1ZWIC 3G2KA 2M6SA 4X92A 3GLTA 3T41A 1E2IA 2B21A 2HXYA 3SYMA 5IHPA 1GY8A 1A1VA 4LVUA 2I62A 2VAVA 3B78A 4TLLB 3SKXA 3S81A 4DRXA 3NB0A 4DABA 4BP1A 4DC1A 4PSDA 2GTAA 1HW7A 3P9XA 4AICA 3Q9LA 2ZW9A 3K5IA 4J11A 4J91A 2P41A 4O63O 3QYJA 2J4CA 5A2QA 4N41A 4F2HA 3EY4A 4PTLA 3QTTA 4GWGA 1TL7C 5AM4A 4TVSA 1CEYA 4JOQA 5H9WA 4UTNA 3HKDB 2BGTA 4JIMA 4WERA 4IWYA 2P27A 3LRXA 1NT2B 1KEEB 1K5DA 4YROA 1Q22A 3S44A 1GXSA 3SXPA 2BMAA 4GC5A 4CBVA 2GDJA 5AVMA 3H83A 1N1GA 2ON6A 1COWG 3R7LA 1ORQC 3QY9A 2CDYA 3ZVRA 1RXEA 1SD1A 4PX5A 5AKHA 1V54C 1RKXA 3UHJA 4TWKA 2Z2KA 4DCNA 1H6DA 2WW8A 3G0GA 4RPGA 4CM4B 3LSTA 4CV1A 5H82A 3G67A 1VHQA 3O8DA 3F7YC 1P2GA 2FVXA 4RLFA 5EWMA 1ZY2A 5HE9A 3D5EA 1QGYA 1X7WB 3C3XA 5A5EA 1LW6E 2DYKA 3I6IA 1XMQB 2WAOA 3NEAA 4KQCA 4WI1A 5CDTA 2UZ0A 2LGQA 3OZUA 4X1KA 3C7DB 5JJCA 2JAHA 2ZWOA 5KTYA 1BXRA 4WEOA 2CW4A 4O33A 1F7VA 3RC3A 5LBQA 2OCAA 1QHFA 2J5BA 4X0EA 1YBFA 2O2ZA 3QENA 2VJMA 2GRJA 2NW6A 4E3ZA 3CCLF 3LP8A 2PVSA 4WLOA 5C93A 1FTSA 3R0PA 3L84A 2J08A 3SJBA 3RRBA 4G0UA 4J90A 1I30A 1OLUB 4DLVA 2D3WA 3BIWA 2ZSIA 1BWPA 1FP2A 2PKEA 2FSGA 4YYZA 1XTPA 5EUQB 3JCMM 5IVIA 3E86A 1OSNA 4L5YA 4UJ3A 1I5EA 3U1BA 1UODA 4YRDA 1X7DA 4J42A 2FN4A 3JAWB 1PWEA 1P1CA 5TLSA 3ODGA 2ICAA 4BAGA 4DR6O 1GPKA 4ARIA 4MYDA 2DYSC 5IKOA 2XWJI 3OE7D 4JDPA 4J4TA 3EEFA 3AFMA 1HLFA 4DARA 2VDWB 4TLMB 4NL4H 3H75A 3T06B 3CUYA 3OQVA 2BGMA 4P7JA 1D8AA 2VQ6A 4ZJUA 2H5LA 3RYHB 2FY8A 1R2QA 1Z5VA 1ITZA 2QWPB 3L49A 3SHWA 2HEPA 4W9NA 3EULA 4Q00A 3NBAA 4ER5A 2VUUA 5IJAA 4C0JA 2AHYA 2FSSA 3W2FA 3E2IA 3WLJA 3REQA 1GZ6A 2ZE7A 1JEEA 1H4QA 3M89A 1AS2A 3M1XA 3K79A 5A0TA 3HKCB 4BQPA 2IP2A 3LDCA 2DBQA 1MC8A 1YSCA 3FUWA 2XQFA 2P4QA 4F3KA 2BH9A 4KYVA 4DJJA 2GF2A 1CR4A 3Q4HB 3FDFA 2ARKA 3DZFA 2Q2WA 2LW1A 3CZ9A 1B8VA 3N2KA 1V1RA 4X3PA 4QJIA 5LMCA 4AZWA 4L8JA 1UWVA 3K16A 2ZVYA 1X15A 1LLDA 4NCJA 4PG7A 1S7GA 1OXKB 3TJRA 4IMJB 2RG7A 5ILOA 1T13A 3OE4A 1WZNA 1VYHA 2A33A 2N04A 3EW7A 4FGZA 2XB6A 3UOAB 3B1XA 1ZPDA 4UCWA 3R8FA 1CY2A 3EISA 1EX6A 1C2YA 3AKZA 1X1RA 3JQBA 4DDVA 1M66A 3ABTA 3H1KH 3WK9A 4GMXA 1LK5A 2H9YA 1O89A 2JEXA 1EEXB 4CMHA 2A9VA 4GLXA 1KYTA 4X85A 4EKEA 3CRZA 5J2TA 1GQRA 1ZNZA 1Q1EA 2DY1A 4ENPA 4L02A 2A59A 2OG1A 4MARA 2HP0A 2HSJA 2C4NA 5EZSA 1VHWA 3CRCA 5FB3A 4JROA 4ZOLA 1CTQA 1JXQA 2KBEA 3FMOB 3CX6A 2M1ZA 4DJEC 4OMUA 2OAGA 5JBNA 3HXKA 2FB5A 1GPNA 2DHQA 1B74A 4AZTA 3NPMA 1MJHA 2Q62A 2DPMA 4DC0A 1G18A 1JTEA 3SOPA 5LMNB 1IQ0A 3IKJA 2FFBA 3PVSA 1F0NA 1JJAA 2YWBA 5TGTA 4AMGA 4C0KA 4E2FA 4DAOA 3C15C 4IRXA 1AF7A 2W0SA 4G2KA 1JQEA 3I12A 4DNFA 4L72A 1UPBA 3H9QA 3IVMA 4C7JA 3DUFB 4B9EA 2UXBO 4LGYA 2HMYB 1X7OA 3ILYA 2XA9A 2Y1CA 3RT9A 1BEEA 4GXNA 4CKBA 1T2UA 2CTQA 1RHUA 5FLEX 1VJRA 5C37A 1VK3A 4MV7A 2GV9A 4EYEA 1G42A 4RD6A 3W2GA 1U31A 1CZOA 1NIPA 2QU7A 1ENYA 2B0CA 5EE3A 1B2RA 2R7NA 2BFDA 4RE5A 4R68A 1YU6A 1DEOA 2PKXA 3OPXA 3AESA 5TQ2B 4OQPA 2XH8A 1PKXA 3QJGA 4AY4A 3QI7A 3D3WA 2QYSA 5IWCA 2XUDA 2VLIA 1JVSA 3ELUA 1GITA 1OCRB 2QYOA 2RK4A 1AQLA 2ZJ4A 5JNVA 1YJWV 1XKLA 1GV1A 3OHMA 4ARVA 2WOJA 1MV5A 2VYVD 2P2GA 1GQFA 1O6BA 3U7QA 4B80A 1DRWA 4K81B 5IEBA 1EPUA 1VDMA 2W6OA 3A37A 2GK6A 3L0PA 4UBNA 1SBYA 1TA9A 1C29B 4ID3A 4B8ZA 2H85A 5LLTA 4QARA 2HK6A 3G9TA 5EY5B 1L5VA 2FPIB 3MZ0A 2C4TA 4MWDA 4YR7A 1N2HA 5D5HA 2QUKA 2C1EA 3P2OA 4TWAA 2RHTA 5FXMA 4MYHA 4II7A 4E4YA 2XEXA 3P8ZA 3GDHA 5CN0A 1B42A 3V8RA 1EZ1A 1IZZA 3IR6A 1UZNA 4GNKA 3Q88A 3L8FA 3C9SA 1VLHA 3SPXA 1QP8A 3BZWA 2VXOA 5LOVF 5F1PA 3ETCA 5FFMA 4EKYA 5LQMA 1LPNA 1T2VA 1XL0A 2PD3A 1YAHA 2AWNA 4K9OA 5JH7A 1VI5A 3PQCA 4RTQA 1SGWA 2C7GA 4GKJO 2X9QA 3O8QA 5IAKA 3QFRA 1IATA 3QK7A 4WK4B 3UAXA 1QHNA 3CGWA 5JHGB 5JBIA 4WN3A 2VSOA 2GESA 5A4JA 2IDKA 2QTPA 1FTWA 3JWJA 4NXNO 1JBEA 2JLVA 5AW8A 2OOSA 1YB7A 2DT5A 4IEFB 2HVKC 5AR1A 2UUCO 4UFPA 3EVDA 4R40A 3C5VA 1SCKA 4XGNA 3E61A 5L3ZA 3DE0X 4P2BA 5NULA 4BNGA 1PFYA 5KREA 3WMWA 3GEMA 3SPJA 2XT9A 2ECQA 3ESQA 2ZSJA 1Q16A 3SHTA 2JAOA 2QM3A 2DOSA 4E2YA 2RHCA 2QW8A 4R2LA 3LGXA 1X7ZB 4J0DA 5CITA 3DL0A 3CG6A 1T3HA 4IKPA 2EFDB 4RS4A 2HS0A 1KI7A 3W9YA 1E9BA 1XI2A 4E2XA 4C8EA 1Z2OX 4GPZA 4HNAA 4GW3A 4DE5A 1LK7A 4MVOA 2X76A 1U9IC 3PXBA 4M1TA 2W43A 2XHZA 1U98A 2RCYA 2FLVA 4LXYA 2AKYA 4LDZA 3MRVA 1ADGA 4QPJC 1IZ8A 1ICIA 3JYLA 3ZEAA 1V1MB 1EUYA 3L93A 3BA9A 3HU3A 1VQ1A 1DUVG 3HCAA 4AP9A 2WLKA 2RBKA 4MA4A 4HYEA 4IL5A 4ZQBA 2DPLA 1M2JA 5KHAA 1KJ9A 2WUVA 2D0DA 4EQ6B 1RSOA 1HYBA 3G2HA 5K8JB 5J4KA 2NVWA 3HMKA 3AHEA 1IXBA 4ARBA 1WCIB 3ZCSA 5CYOA 5FPPA 5KHIA 2JLXA 3KFLA 1DX4A 1P9LA 3O31A 1EH5A 1CJSA 2E37A 4U2BA 2IXDA 2LGWA 1JLRA 4I3HA 3GGDA 3OZSA 4EDFA 1QGED 1IK6A 1JWBB 3ZW7A 3PRJA 3KYCA 4I50A 5DTQA 1IG3A 3X1DA 4TZ0A 4ZT4A 2C4UA 1H8EA 4BRZA 1W35A 3E9NA 3T9CA 1I4EB 2CWDA 2IZ6A 4GMDA 2QN8A 4RMJA 3CRMA 3LWNA 5K2OA 5B5EZ 4PJ0Z 5EEGA 4WFFA 4NCNA 4QL3A 2P06A 2LBPA 1K3UB 2AF3C 1B0UA 4HH4A 2VDRB 3A58B 3MTIA 3BJIC 2ZWMA 1TPYA 2P30A 3HVRA 3HJUA 4UUQA 3GYGA 1ZJZA 1CDZA 3NC4A 4LPKA 3LO5A 4KH1A 2ZT9B 3WK8A 1XD2B 1Q95A 3LX8A 2OFWA 1JFSA 3SC4A 2ONJA 2YV3A 3B12A 3VR6D 3VPHA 3ITEA 5IAEA 1JTFA 1O1YA 2AZ0A 2DUNA 5JVDA 4OSPA 4H37A 4LDRA 4CMBA 3TX2A 1OU0A 2MMCA 3WRYA 1KGSA 4G63A 5ICGA 4M9UA 1Z34A 3DO5A 3GWKC 2WMOB 1JYSA 2VKQA 3BKWA 4KSBA 2C5GA 4GL4A 5IASA 1X1DA 1DO2A 3H1JH 4O02B 2GMWA 2XAFA 1V47A 1WTAA 3TIXB 5KVCA 2WYUA 4TN5A 3W05A 4AW9A 3RCBA 1M7BA 1AROP 1T3LA 2JGLA 2WA2A 3TH5A 4HB2A 2QRQA 1E20A 3TECE 1T3GA 2ITCC 3HABA 3QLUC 4O1IA 1XV5A 4BJHB 3E58A 2WE8A 1TVCA 1O7JA 1A96A 3WLQA 3FSEA 4QEDA 1GDHA 4GZLA 1EWTA 5IRCD 1QX4A 3R74A 4ZO6A 1R1BA 4H0CA 2XI4A 2JPDA 2G08A 3MTGA 2I6FA 3F3YA 1JEDA 3H97A 5CVTA 1ILWA 5AVWA 2UXDB 4Q9NA 2XAJA 1L4YA 1RBYA 2EIKB 3WJPA 2EW1A 2L35A 2GHIA 1QLHA 3E70C 3LDHA 1W73A 3KAKA 1KDZA 3KHSA 5GM1A 1Z63A 3V2GA 4IQFA 3M6FA 5HX7A 1MH1A 1ZZGA 4TYYA 4U2KA 4FBLA 4IG9A 3DSQA 4JI3O 4ZCRA 1T91A 1VSVA 1DFHA 1IJBA 3H11A 5LGNA 5BUQA 1LJLA 4DQXA 1EP3B 3WL4A 1P5RA 1FXWF 3KAPA 2FZ4A 1N8RW 4ZZ1A 4DW8A 4JUBA 2Q21A 3GLGA 1XL1A 2QYHA 3OVMA 4BQSA 4ND7A 3LDEA 3ZS8C 3U4QA 3EIQA 3U6BA 4J29A 3WR5A 2WTXA 6YASA 1JIUA 2ZRAA 3L9DA 1CP3A 4MWZA 4NYMQ 2ZKIA 3OJLA 3EIEA 1D6NA 2ZDGA 1ZD5A 1WMBA 3CCSV 5T6MA 4DRXB 4JTDB 2DYRB 5KEIA 2WEKA 3I6MA 3P2JA 1GN3A 2ZI5A 4HLDA 3OLXA 4GE0A 3ZZ0A 4RC9A 3U4MA 1Z2NX 2NU9A 3VMMA 4DVJA 1VL0A 4ZYVA 4EHIA 2JFPA 3X43A 4PU0A 2PU5A 4EPXA 1K06A 2XOKA 2LJ2A 4TS1A 2ZRLA 4Q1EA 3CX3A 4PLCA 2YXDA 3SOZA 5AVKA 1UAGA 1JPXA 1GXSB 1AQIA 2AYXA 2ZD9A 3KLPX 1FSSA 4TV8F 3CCEF 4FD2A 5EHGA 1NLMA 5AVQA 2ZYSA 5TGZA 5CCDA 1YDMA 3RTGA 4L4SA 1M73E 5C5EA 1A82A 5EMJA 4NEHB 4LCUC 1Y74A 1VECA 3K2QA 1MTZA 1L4KA 2VUTA 3KZVA 4FYHA 4ALKA 2KG4A 3VH1A 3A70A 5CB8A 1DHRA 5FIUA 4B48A 5F76A 4DF3A 4TXNA 1Z3CA 1W36B 4EARA 2C3OA 3DUWA 2BPOA 4PYJA 5EWMB 3I1YA 4I1RA 1P7CA 2C9YA 4XJXA 2BMEA 2W58A 5HQJA 2R3SA 3H7IA 4UUAA 1AKMA 5HKOA 4OB6A 3S29A 1RHKA 2PF4E 2ALEA 5EZQA 1P3Y1 4YUWA 4QPDA 4D4IA 3OWOA 4K05A 3A1FA 3DVRX 4X1KB 2RHOA 2IQIA 4NJEA 3F7MA 1BXRB 4UCVA 1SXJA 1G4AE 4B79A 3IOEA 5HF6A 1ENVA 3RFUA 2WFMA 1DC5A 1QG2A 5ALEA 1YRAA 3M1AA 3PDHA 4YIPA 1QFMA 4JUCA 1NYLA 3HCDA 1WMSA 5AHOA 1UM9A 3ONEA 3ZUPA 5B58T 2Q7XA 3GLGE 2B3DA 3CXRA 1QIDA 2UXNA 2PUHA 3ENVA 4UASA 1VIYA 4N18A 4H3VA 4M4SA 3I55V 3WG7C 1U0LA 2O7VA 1SHTX 4DV5O 3AVVA 3MM4A 2QSYA 4JNKA 3KEOA 2L42A 1AKWA 2IPAB 5HGXA 1VE6A 4AMUA 1ZBQA 2ZROA 1O0SA 1VGQA 5K20A 2BY4A 2VP4A 4PG5A 3BAZA 1ESNA 2XBLA 4WCVA 1E2DA 2VZEA 3A9WA 3DEZA 3HXTA 2EP8A 5KMGA 2WHEA 3KKMA 1QVVA 4YRBA 1PL0A 2V6FA 2CVPA 1JR9A 1EFUA 5LZ5A 5CFRA 1AIPA 2R6GA 1QCZA 5FADA 3J81k 2CLDX 1WMEA 1JA0A 3HCBA 1K4MA 3REQB 4DW0A 4HN9A 3T80A 4AWAA 2V3WA 3ZDAA 1KYIA 3U3MA 2BGNA 2ZU0C 1K9SA 2Z0AA 1H2EA 2C2YA 1R50A 4R9RA 3G79A 1EN6A 3M2TA 4UCOA 4RVOA 1K5GA 3OT4A 3U7HB 1HE5A 3N2KB 3ND9A 4F9TA 2FUKA 1MFPA 3TLKA 3N3AC 3QXGA 2DPGA 1V1RB 4UUBA 4WLNA 5LZ7A 4BO5A 3KLBA 4NDZA 4K1XA 4CT4B 2RGDA 1YJ8A 4GMHA 4NE7A 5PGMA 2VFAA 4HQLA 2W5UA 2OUKA 3OUZA 4NF2A 3AHJA 1T5BA 2JLZA 2IF0A 4Q39A 1WVMA 2TYSB 2YWHA 1V6CA 4DV0O 4PSAA 1M6HA 2XTNA 1QP0A 1PEAA 2RH4A 4BMYA 1HDYA 1MZEA 5BVGA 4HLQB 2KJQA 4KJZA 4X9XA 2IOHA 1SXJE 1EBBA 3UK1A 4RSHA 1JEYA 1YK1A 2ZBUA 1VI6A 2YEVA 5I9LA 5J2TB 5IE9A 3DZJA 5IVPA 1MQ9A 2X9LA 4HLNA 4GPTA 4P86A 2QSAA 3SFZA 2CJXA 5E0KB 3ED5A 3D6FA 3P9IA 3RQSA 2D1TA 3TKAA 2VS0A 2HP0B 4R5HA 4K87A 4TTJA 5BT9A 3PFKA 2D3TA 1NY6A 3PGA1 4E4TA 4ZOLB 1IBKB 2PV0A 1Z2EA 5C5DA 4EKIA 3IPAA 4LJAA 3JWIA 3RU7A 3B8EA 3U4CA 1BO6A 4F6LA 2R1UA 1WHTA 4D2IA 4OXRA 4UAVA 4GPBA 3IC7A 1PFVA 3COPA 4F5EA 4KO3S 3TJTA 1T0HB 2KLBA 5A6VA 2JFYA 4GDMA 2IS2A 4FM9A 2NQTA 3JYCA 1R0WA 3L6OO 2A0LA 2ZTUA 5ERXA 3EIWA 3P2MA 1P0MA 4JX8A 3QWBA 1PNLA 5TF0A 1D2DA 1GKFA 1VKJA 4GM4A 3T38A 3TZEA 3LC1O 2RIRA 1A97A 5A2QN 4CKBB 2XYHA 2X7HA 2GBIA 4BMXA 1AA6A 1VM6A 2A1TS 3UF0A 1Q0UA 2J45A 2EINC 1RYFA 1XDDA 3TAHA 1SU6A 2ZT7A 1QVFU 1KRWA 1X3LA 1P2TA 4MDEA 4WKNA 4IUYA 4YP0A 2GPTA 3ZTTA 3KV3O 4YJGA 3AESB 2LBWA 4KR9A 4AO7A 1S02A 3D3WB 3HJTA 2QA5A 3MD9A 3T34A 4HDRB 1E9DA 1JU3A 3A6PC 3KL4A 1USIA 5HY1A 2P6RA 3OTQA 1ZCFA 4LE0A 4E3WA 5ICCA 4KIGA 4LWQA 2VF5X 5DB4A 8MHTA 1XYYA 4A8JC 4JBHA 5A4MS 2QWRB 2R1VA 2MDTA 4IY1A 2IQQA 5HRUA 3U7QB 4C0XA 4L3WA 1COWA 3GBVA 5IMBA 1V96A 1ZM9A 4H77A 3FB7C 3GWZA 2ZJ6A 1WUKS 2WD8A 1KO7A 3PUHA 2O8EA 3TXXA 2YFKA 3FSJX 2HS3A 5JXGA 3A31A 2PUWA 4WFEA 2ZYGA 4D8XA 3LIPA 4TYMA 3I8XA 2GPSA 3SWWA 5IWAB 4EFNA 3F5QA 4ZHQA 2DKOA 3KOYA 2FEAA 3OW2U 1OYVA 1V39A 1B8OA 2ZYIA 1GJRA 3Q8LA 1L5FA 2ZUCA 5ARDA 4BYGA 1RXCA 2ISSD 5EGNA 3LCUA 3E9RA 4LBWA 4XUCA 4BGVA 4FHDA 1M2FA 1BCCH 2WINI 4J7CA 4DV2B 1SVLA 1UKZA 2GKSA 4GYKA 4BFZA 3U9LA 2OCHA 1HNWO 3V97A 5JH7B 2PGDA 3QI2A 5K45A 4TRNA 3NWEA 3SVTA 3QSGA 1CD5A 4MMZB 3NCTA 1FXKA 3AI1A 1OA1A 3OOJA 5BMOA 2ZQ5A 4RADA 3O8QB 1ZGAA 1UINA 5I9BA 2Q68A 1MC5A 1I7PA 3EJWA 5K4GA 3BE4A 2Y0EA 3T9FA 5B64A 3T1HO 4AURA 1BMFA 3W6ZA 3K0HA 2R00A 1G19A 1CJCA 4R40B 1CUHA 3PT5A 2EX4A 4AP6A 2Z8XA 2J3HA 5IZCA 4M1OA 3B7PA 4P4TA 4JBLA 2P5SA 4C87A 3DTUB 1A4RA 2B4KA 1PJZA 4LF5O 4DMLA 1JPUA 2GN4A 4ZQEA 3NLLA 4QGFA 4ZJYA 5SZIA 3RKRA 5DNEA 1SZDA 4CM9D 3G2OA 4CKCA 4OBBA 4RQEA 2QAGC 3LHDA 2EZTA 1M4UA 4H4CA 4QFCA 3C6BA 1MKYA 1WXWA 2CFOA 4YMVA 4YJDA 1NQVA 1DLBA 4YTEA 3UA4A 4HNAB 3U9SA 4XDYA 4CBCA 4KBGA 1YRLA 1IEXA 2MU1A 5ENDA 5J59A 3IAM6 2EFHB 3CJHA 5MFZA 1WUIS 3I4FA 2C3YA 3LX4A 3WRXC 2OIGA 4B8YA 3U3ZA 2I33A 1AS3A 2D7CA 1QVAA 5CIWA 4C5AA 2QJTA 1RSOB 3OG9A 4CR7A 5DRYA 4RABA 3I2IA 1HZZA 4FDVA 3H1AA 1SOMA 5FULA 4C4SA 4HEA6 4WWHA 1TJ5A 2AZ2A 2G3YA 3CCQF 3KT6A 4S1OA 1YXMA 1GTRA 1AR4A 4N5HX 5I6DA 3O4RA 4D3DA 2CLHB 2QIOA 3PYMA 4EP1A 4TGLA 2LR0A 1E0DA 3LRPA 1I1HA 1L5GB 4RIFA 4I50B 3IP3A 2VQEB 1T5HX 4HNRA 2QRMA 1U1FA 2IX9A 4ZPXA 4ABMA 2A0XA 5IDXA 1JAYA 1IG0A 1RM1C 1XTVA 4KHPO 3EXHA 1FVHA 1Y0BA 4Y2RA 3Q10A 3CMMA 2EJTA 4DUYO 1YL5A 4E2LA 3O65A 4EHBA 3WGMA 4BZXA 3KPYA 2XNDA 1SOAA 1QTRA 3H9JA 4IJWA 4KMRA 1M90W 3V4OA 4XH9B 4AIIA 3UUEA 3LTEA 1WEHA 4XQGA 4CF5A 3F7VC 4H35A 4LHWA 5K0EA 4AUMA 3O4VA 4JR1A 1ZRNA 2EW2A 3JATA 2FP4A 3JQAD 5LKAA 4P7KA 4ZDIA 3PGJA 3PC6A 1R0ZA 2KSQA 3Q5DA 2G9IA 3G2PA 1SR8A 3RD5A 3HVKA 1JUDA 1BXKA 1C30A 5JVDB 4MV5A 4CG2A 3H5TA 1ENOA 1E4EA 3ZZ1A 4BAYA 1HP8A 3I64A 3RSFA 3BXEA 4YONB 1XVTA 3HJBA 3AHGA 1AV6A 1SHUX 4LQLA 2O4CA 2GM5A 4WLUA 2GVNA 4RKEA 4G5QA 3U7FB 4J07A 4HY3A 1I6WA 1NI8A 3D1VA 4DTIA 1YA8A 3UOWA 4BVFA 4BC1A 1DOHA 2Y69C 1P29A 5JAOA 1PDWA 5DM70 4BO3A 3RTEA 4FSXA 3G4SV 3R66A 2D2EA 3KQQA 3BMNA 4DQLA 4KFUA 1YQXA 1WZCA 5EJMA 1XJQA 5ELXA 3OMXA 1AKRA 1U7WA 1NW3A 2J5QA 1Z4NA 4AYWA 2DERA 4UCTA 2E21A 1RQXA 4WFAV 1KY5A 3WL6A 1PD3A 1TO2E 4FHFA 1PK7A 4U2FA 3OHSX 4D6YA 1Z47A 1ORTA 5DTRA 5L3GA 4BFTA 4YT5A 2Q7GA 3BB3A 4QBKA 5AVZA 2NLJC 3G0CA 5ALVA 1H7MA 5FHRA 3D3NA 3N2LA 1MENA 2PH5A 1WRBA 3BDAA 1K4DC 2W8BC 3NIWA 4KSCA 1E5TA 3NASA 3D6HA 3DBIA 1FYFA 3W1WA 4E21A 1TMOA 1N9ZA 1FYEA 3KR9A 4JUIA 3CE6A 1M5IA 2Q9LA 4LFCO 3UAYA 2EJVA 3H11B 2O0LA 2BTEA 4IFEA 2IOQA 5C32A 3EARA 3OO0A 1T4DA 4M9RA 3JD0A 1A4IA 1U8YA 4DCSA 3N75A 1XRQA 2XOKG 5AJXA 2C0CA 3L04A 3GLGB 1YASA 2CSLA 1KO8A 3OTFA 4X8LA 4QU0A 3U4QB 4LJKA 5E4FA 2Z4RA 3EIXA 1HYEA 1H65A 4U7GA 4AMVA 4FDTA 3GLHA 4NVPA 2DQ3A 1DAKA 5DLQC 1PFKA 2P6NA 3B6JA 2VYFA 2PRYA 1DT3A 3NC1C 4FUQA 2Q9AA 2XUMA 5IEJA 1KVSA 5EP2A 3DH0A 2BGWA 4F3YA 3E15A 3BD9A 2ROQA 4JQSA 2OV6A 3CD6V 1HQKA 1UZMA 1NE2A 5GIOC 1DK1A 4WD3A 2QN1A 3NETA 1OAOC 4E5NA 2NU9B 3RC8A 2QJOA 2BL4A 2ZDQA 2GX6A 3FTDA 4P34A 5AM5A 5EC8A 5CJ2A 3V1UA 4HXFB 1EEHA 2EZOA 4GKKO 3KPVA 4UCFA 2VLBA 1PG2A 4C6HA 5KYYA 4LJ9A 4M49A 2HK9A 1MQAA 3PTLA 4AJLA 2A1TR 2HDNB 1VJ5A 3SLRA 3EZGA 1ENZA 3M8AA 3QXJA 4AJ9A 2PY6A 2EBHX 2FPOA 4MW7A 3CLTD 1G5TA 1WM1A 1HRKA 3EMVA 3GCZA 3SX4A 3B6EA 4FFBA 3D0OA 1Y74B 4OK5A 3VKWA 4ME6A 4CKYA 2HA7A 4L2IA 1DXYA 2O07A 1NV9A 3EQ8A 5A2GA 5BWBA 4XEUA 1B3QA 4CUZA 2W0MA 2Q07A 3GJTA 4A8PA 1OXVA 1A9YA 2Q6VA 1KQ3A 3TZKA 4A9AA 2FEMA 3UWSA 4LJ6A 3I8SA 3QVVA 4OHZA 2ZI9A 1YR9A 1HDXA 3MAGA 3V5NA 1KZHA 5KJ6A 1KPIA 4QFDA 5KTRA 4PXYA 4NJEB 4PN3A 2I4LA 1SXJB 1DRVA 2C42A 4CC5A 1BDHA 3HPLC 4UHDA 1S2GA 5ALRA 4DR2O 2QM4A 4JAAA 4L08A 2IW3A 2Q8VA 1OCCC 2YWJA 1G2IA 4IX9A 2AXPA 5KOYA 1Q21A 1ST3A 1T9HA 5J5AA 1MFZA 5EESA 1UM9B 2ZT5A 1TC2A 3W5SA 3C97A 2LKCA 4KL1A 1FQJA 3TQFA 2EWVA 3SBDA 4L8WB 3ZZMA 3EGIA 5BMVA 2IH1C 3IS3A 5EKSA 5KS2A 2CHVA 4P22A 2MSDB 3KTOA 1CU1A 4RTJA 3GLHE 3AF5A 1M6VA 2QHXA 4IDFA 4ZVUA 1YHQF 4PFSA 5CW2A 5EZ6B 2ZB8A 2I1VB 3O6VA 1NG9A 2C9MA 1ZX3A 5KMGB 1J1IA 2GN2A 2G7MC 3VA7A 5HDBB 4G1CA 1CB7A 2IH5A 4Y2XA 1N6OA 4DB4A 4UUJC 1W4LA 2VOEA 2O2CA 4UNSA 5FJIA 2REBA 4ZTZB 4RV4A 3R76A 3CO5A 3G7SA 4NRDA 4D57A 3OFKA 3AP1A 3KHTA 1J49A 3RLIA 1OROA 1A5AB 4FOSA 4YMSA 4OJTA 4N6NA 4KRFA 1GYQA 4RK6A 5AHRA 3FFBA 1EVLA 1L7EA 4EUKA 2W8ZA 1K0FA 1HFEL 4MP6A 5EJ6A 2PG3A 3WFZA 2Q0AA 3BXPA 1B00A 3CPWF 3DOFA 4RD1A 3TGWA 4FUTA 3WYBA 1IXSB 4NOKA 3RK1A 4BMVA 1YQTA 1GGHA 5HKKA 4IGIA 3UATA 5FCDA 4Y9SA 4EZBA 4X6YA 5AK3A 3HHPA 2BV3A 1YH3A 4UZFA 4CETA 2Y1WA 2BRUA 2OFXA 2ZQZA 2XUZA 3URKA 1GVNB 4D9JA 2H57A 1ZD2P 3FUXA 1F8YA 3PXAA 1FXVA 2L17A 4QO7A 3K7EA 2FN9A 1QANA 4IDAA 5BVGB 1WCYA 3RANA 1CWUA 1N3YA 4EI9A 3AK2A 1SDSA 3OAAD 4EG3A 1TCCA 5ALPA 1JEYB 4RAOA 5HGJA 1VJ0A 3ABKC 5AXAA 4U9HS 4B84A 2ZIZA 2YEVB 2AOWA 1RE0A 4G8BA 3NMUF 1SG9A 3VTZA 2A0KA 1DEKA 3L8CA 4DA9A 1Z6AA 1QR6A 1DRJA 3ZJ4A 3FAKA 4GYCB 4MWOA 2YIBA 5KKCA 4DKXA 1O94C 2F48A 5KTOA 1RABA 4C7OA 4LFBB 4EM6A 3KCYA 4AX8A 4N5DA 2JBHA 2Y68A 3ML1A 3GWGA 3SQNA 4JLVA 1F17A 5E6UA 3BMOA 2VF4X 1AZWA 3F49S 4LRQA 4MUNA 4KLNA 1QHXA 1WHTB 1NVAA 2H51A 1J42A 2FZLA 1TK2A 3CJQA 2ZP1A 2DF8A 3D36A 1WLSA 3HNPA 1R0YA 1ZH4A 1PPJH 4L4ZA 1VE5A 1M1YA 3C3CA 1FFEA 5A5GA 1OXMA 1HETA 3RYIA 4J4BA 1LBSA 2PKQP 4P83A 2X1MA 3VGJA 1TEVA 2DQYA 1IY0A 2CNOA 1FFTB 3HSYA 4PW0A 2GFQA 5AK5A 2NU6A 3UJ6A 3CMEV 3O82A 4B2PA 3H99A 3DW1X 4D41A 3L7LA 2VK2A 3H2HA 1VPDA 2X0FA 4HPXB 4OXIA 2AIFA 1XPJA 2H17A 2E89A 3Q8WA 4QSHA 3CC2V 5AUPB 3EDYA 1EX1A 4YJGB 3H3JA 1E0KA 2WYOA 3S3XA 1CUGA 1YAJA 4X44A 2H3HA 4N0MA 5B6JA 2W2LD 1L4NA 4N7BA 5G2OA 4ZYLA 3QPVA 1CK2A 5JDIA 3ERCA 2XKAA 4K9MA 1YNSA 4MUXA 3NAGA 3F5WC 2QX4A 4DIMA 5DHRA 1EDBA 3KP1A 4KC0A 2R1VB 4KPEC 1CY8A 4JBGA 3F6EX 4X6LA 3ZLTA 2ID7A 5KO2A 4FQ8A 2Y1XA 4ZYZA 1WXEA 4DA8A 3K53A 4E1AA 2O8EB 1LD3A 1KMQA 2IUSA 3FVQA 3VAAA 1HTWA 1WNSA 2C4MA 4D9MA 1PLKA 1U5BA 4EHHA 3IHWA 4C4YA 3CW2A 1DC7A 5KVAA 3SP1A 4PA3A 4ZHQB 3WNCA 3EFBA 4XYMA 5LUBA 4XOUA 3R7SA 3VTIC 1BMFG 4AX4A 2R70A 2PYDA 3ANTA 4B8WA 4HAUA 1WXQA 4XPZA 3VR4A 2VK4A 5B2FA 1YDHA 3CCJF 4DV3B 4OO3A 4QDKA 1FXKB 5BWNA 1GA4A 1EWRA 1O57A 1K92A 3PHLA 1KYWA 1M1YE 2FJUA 4IIDA 5T4BA 4RLQA 1V3UA 1RPNA 1EZJA 3FBAA 5K1PA 1I4DD 1JSRA 1L5MA 4EPYA 3K5WA 1J5PA 4LOHA 4QPKA 3BHIA 3VO1A 3EMBA 3N9IA 1D9ZA 3BYZA 4AJNA 4R9UC 3RASA 2B7LA 3DA8A 1CFZA 2DBVO 4NY1A 3HUUA 2EWMA 3RC2A 1B15A 2Y05A 2IV2X 3BA6A 3QBVA 1CHNA 1W4BA 3HRIA 4PELA 1X1QA 4DLWA 5DN9A 5CVEA 2PKWA 3DWFA 2QE7D 4KLRA 3RE3A 2X23A 4CKCB 1O2DA 2XUHA 4EZEA 4XARA 4RX1A 4R84A 4WVLA 4CIXA 5HUJA 3L41A 1O4VA 3UB4A 2PT9A 2MT9A 1LPSA 4NIMA 4HDOB 2EP5A 4MPJA 1G38A 3SR2C 3VU0A 1JMYA 2I6UA 3R9IA 4LV8B 4LDQA 3NBKA 4KN9S 4G4GA 1KU6A 3WBFA 3RBZA 3CJHB 4X71A 3E81A 3NIFB 4I9NA 2BDTA 1A77A 3DEJA 3K57A 3LO8A 1S2NA 8GPBA 3GVPA 4BJ5A 4WVFA 4CL2A 1NBOA 1TQ2A 4RORA 4O4HA 5ICFA 3SM3A 3PE3A 1T6BY 1WUHS 1P4AA 4FLMA 4E94A 2XNDG 3HG7A 3K9CA 1Y48E 3ZDEA 1U0BB 1C8BA 3NHZA 3LY5A 1KO1A 1VFNA 2O9JA 5IN4A 1ZA1A 2AMVA 1YHYA 3AK1A 1Q81H 4PGFA 2MSEB 1T29A 1W55A 2ZS8A 1VFPA 1C9NA 3ESDA 4D9HA 4TL9A 3OA0A 2ZG6A 2YJ4A 2Q6KA 1GUBA 2XYPA 3EXHB 2LDBA 4BO7A 1U3VA 1P91A 4QM6A 2ACKA 4KZKA 2AOXA 2F90A 2EBOA 4OH1A 2XRYA 2CB9A 5GONF 5IAJA 2GFHA 4F84A 1IK4A 4MIOA 2GYVA 1ODLA 1P4HA 5L3QA 1IZ7A 4H1HA 1U3GA 2K5UA 3UJ8A 3FFTA 2F1JA 2Y48A 3LKVA 3LM8A 2F4VO 2PBZA 3T4EA 2DULA 4J80A 3INYA 5B58C 3JVHA 1BX0A 1DKNA 3DMGA 5I4BA 5F33A 4CQMD 4KTTE 3E5RA 5AVRA 3WHPA 1GO2A 2H11A 3K59A 3QKIA 2XD4A 3JATB 2FP4B 4JBWA 2ZRPA 2YZ7A 4FYPA 3LSSA 3O4FA 5DCVA 1OYOA 2V7UA 4MGHA 4HDRA 1WPQA 3GPDG 1RXWA 2F55A 3UW1A 5FR2A 3ZVMA 1OCRC 1VQKV 5CDUA 3WBKA 2VHWA 3RAFC 1NUAA 1C30B 3R6TA 1G3UA 2GD6A 4A2WA 3LFUA 1E4EB 5KJFA 3ZDRA 4LGCA 1IDSA 2ITDC 1GNLA 5A62A 1VJDA 4MKGA 3LUDA 4HQKA 4ISCA 2AYYA 4CHGA 4HVLA 2AI2A 3BZBA 5DK4A 1Z0JA 4TUYA 3G2LA 4UVIA 1IFXA 2Q2VA 5D1NA 1NU1H 4HWKA 1JX9A 5EXXA 2ZR8A 3ZGLA 1T1IA 2PKQO 1I51A 3ZE1B 3FYIB 2HHHB 3TI9A 4EB8A 3WK6A 2Z8ZA 3F6MA 1U8AA 1WB9A 2QOEA 5BSWA 3F5FA 5FL7D 4MA0A 4BNUA 1N0UA 1GAQA 3BMNB 4G37A 3B40A 4UBOA 3UJ7A 1Z75A 2UVQA 4N3GA 4B3JA 2UAGA 3FAVA 4RYLA 1UPCA 7GPBA 1OOEA 3QFTA 4UEWA 5GTIZ 2C5BA 1ORWA 5HP8A 1SIUA 2FOXA 3PHCA 1E6UA 5JXIA 4N5NA 2IHTA 4Q0MA 1I10A 4BFXA 3OIVA 4ND5A 1QIEA 3BDVA 1FS6A 5F21A 4FM2A 5L3CA 3HR0A 3I0MA 3T7JA 4JLJA 3QNEA 1QJCA 2PE5A 3K8QA 1BN6A 1H2BA 4D0LB 3CRW1 3A6LA 1AY0A 4ZT2A 1Y9AA 3GB9A 5JAIA 3GT0A 1ONOA 2KPOA 4A7PA 3GG2A 1S6YA 3MTQA 2BUAA 5H2FZ 3LUCA 2WSBA 5KWIA 3EVZA 3OX4A 1JZTA 2LKDA 3OFSA 1SBTA 4QXAA 4CLHA 1OXUA 1UKEA 5JOQA 4KBFA 2CH7A 1E77A 5ALNA 1AC5A 3CC8A 3OE7A 1DXQA 3PDWA 1G6UA 4J0GA 2HJ9A 4KE7A 3Q0IA 4DDKA 3GEBA 4R71A 2C54A 2E82A 4NP6A 3GLHB 2P4KA 3QU2A 3L0DA 3IAEA 1IVNA 2QR5A 4IX1A 4GXTA 4ZOEA 2I65A 3A27A 5JJNB 5TT1A 1M2OA 1F0YA 1NU6A 4WE3A 2FMHA 4OK6A 2P2ZA 1KZYC 4PLWA 1TQHA 4OU4A 3R3JA 4K3AA 5BWMA 1PVVA 2WZQA 2ZR0A 4IBOA 4G07A 3CC7F 2BI8A 3VO8A 1OYWA 1QQTA 5FOUA 4QC2A 3FBWA 1NNUA 4A6XA 2ZWAA 4QXOA 5ADHA 1QUFA 2WC1A 2FZEA 1U4OA 2PEYA 2KW5A 5KYYB 4JFAA 1EXVA 4GQIA 4P92A 2VBFA 5B57C 4QJBA 1GLVA 3CW9A 3KKZA 1DOZA 3SGIA 4Y2PA 2RK6A 2WAXA 2PWAA 1SVWA 2WPNA 3QE0A 2ETXA 1V9LA 3OC6A 1NDHA 3RV3A 4GICA 2LVBA 4FR2A 3O75A 1FUYB 1Z25A 1KSHA 2HA3A 4FFBB 3I4LA 2PTHA 3AIMA 4I5IA 1EM8A 4E88A 4DLBA 2FEOA 2YOHA 1IC6A 1XZAA 2BM0A 4L2IB 3NGXA 4RPLA 5K1ZA 3ZV4A 3P4XA 1ZJJA 3RPEA 2GLXA 2HLHA 4NYKA 1G7RA 4EAQA 2VT3A 4F2PA 2FW8A 3L7QA 4IHJF 1GSHA 2X15A 2V45A 1PZFA 4XB6B 1NTKH 2QG6A 3QVNA 4MHTA 4ACBA 1BRMA 3F4KA 1VYTA 5JE8A 5L3DA 4I0WB 5LZ2A 3L71H 1JT9A 3T1CA 5A3RA 1ZI9A 1JDZA 5TJ9A 1ZGZA 2FAXA 1GO1A 1K8AW 3GPBA 3K05A 3H5IA 2RH8A 4YT4A 3AINA 4UXHA 2HNKA 4F6RA 4RKYA 3VR3D 1IUNA 1JHVA 2HMAA 3V1YA 3L02A 3ABOB 4EEKA 3W5BA 3TN7A 2G8NA 3T7KA 3X2FA 3SGLA 2HEGA 3DEFA 1CIJA 2ZLBA 3U5TA 1JHXA 1YRHA 2H0RA 5DM2A 3EWIA 3VR4H 1Y4MA 4RJTA 5DHFA 1NNI1 5AW7A 4P9OA 5BMVB 2RGEA 1C9EA 4RF4A 1F14A 2Z9DA 1V0JA 1W25A 3GD5A 1NUSA 1M6VB 4ENRA 5COQA 3VR5D 4YV0A 3T3MB 4ZDWA 1E18A 4RUKA 1V6AA 3NDRA 3KDSE 2ODWA 4QICA 1G9SA 3C8UA 2NMUA 2IE8A 1VCMA 3P94A 1MUUA 2Q5QA 1JILA 5IH7A 2ZT6A 4U02A 2G40A 1LX7A 2CE7A 2HMWA 2P91A 5K0GA 3RVDA 4E51A 2Z2IA 3CVVA 5KYWA 4PAMA 1EKXA 2GYUA 1Z6YA 1VARA 2OBBA 1E3DA 2W71A 2EWCA 3ZGXA 3FLMA 1U0TA 4W5WA 4KR2A 1H2SB 3WLLA 4S3MA 3C3YA 4ZIRA 3R5SA 4KX5A 4UU7A 3BORA 2APJA 1Q0SA 3E8HA 1HL7A 5LQRA 4DR1O 4CMGA 2GJ9A 5CD9A 4YO7A 4NPHA 3EAFA 1PE0A 3U4GA 2VYVA 3L6UA 4FMDB 2OHXA 2ALJA 2GBOA 4RIGA 4DIDA 3QX9A 1L3CA 1IBLO 3T3PB 1A9RA 4GZ6A 2NYRA 5DNUA 2WJGA 5I9NA 4OAPA 1SZCA 5BYJA 4DSTA 2Q3JA 4XWTA 3QKWA 1FPOA 2HBRA 1W2WB 3UK2A 4DSZA 2HK8A 2GLZA 1EAYA 2O8BA 4FPPA 1U7DA 2V3VA 5LL6P 3BMXA 2VJOA 2PXHA 4MW4A 1C7QA 4KO8A 3F0FA 2V1DA 2H9AA 3OBIA 4QNRA 5B66Z 1N4CA 4DG5A 2CNBA 4C7OB 2X0KA 2ST1A 3U80A 3O03A 1FYVA 3DPUA 2WWGA 1TQ8A 2BE9A 4M1ZA 3VPCA 3HDVA 1H2LA 1EP9A 5E6UB 3BMOB 4HF7A 3WLNA 4EG5A 2IYLD 3BILA 2QLFA 1KECA 4YMUA 4GSLA 4Q16A 2FL4A 2YIAA 1QJ4A 2NOAA 3GFRA 3BA1A 2VF7A 2CKDA 3ZY3A 1M1YB 1DBPA 1W2BF 3UM9A 2C5EA 1W41A 3RYIB 3Q3VA 3GLRA 2ISCA 4Z4EA 2O8CA 2CT8A 1E3WA 3V80A 4GBMA 1T1SA 3HSKA 3WRWA 4RZ3A 4YIOA 1SUAA 3EDOA 2NU6B 4PFKA 1T8YA 3B20A 3FNEA 3WWOA 2I71A 4JL5A 2W6ID 3NYQA 4TZ6A 4K6GA 3QIAA 4BW0B 3U2QA 2XZDA 2FW0A 1Y7TA 2PPLA 3U4HA 5FQNA 1E92A 4GF5A 3GH3A 5CA0F 2I4RA 1V41E 4UOEA 2MTBA 4GSYA 2O3RA 2EP7A 3LW7A 4TT3D 2F95B 3HQ4O 1QTQA 2G9UA 3LNTA 3VH2A 4U2CA 3MG9A 3E2PA 4JFRA 2UKDA 3JZFA 4CIDA 2IX3A 4W5HA 3K0TA 4MS1A 3ZWCA 4G0PA 4I3FA 3RAEC 2E6KA 2H8GA 2FR1A 2JJ8A 2R6FA 1KR5A 2C84A 4UNPA 3I30X 2C8JA 2ACWA 5SYAA 3L9WA 5FJ4C 5SYMA 1S72V 3MRXA 3Q11A 1KI2A 3SBXA 1XCJA 2EILB 3K15A 2E3CA 2CW5A 1UM8A 5D2CA 3FKSD 2FGKA 4YI3A 3Q2IA 3UC9A 3NR7A 3E84A 2VNJA 3KCXA 2V58A 1JH9A 1GPJA 1U5BB 3EW9A 3R8CA 1PVOA 4KFCA 3GH1A 1PT8A 3KT8A 1UI9A 4XQ9A 3IVGA 5HP7A 4BNLA 5F1KA 2XE4A 4CXMA 1BMQA 3KUDA 4RH0A 1P4JA 1G20A 2BUBA 3BRQA 3SSOA 2PWBA 2XNHA 1AKQA 4UPDA 2X6CA 2OBNA 2EIMB 4N01A 1D5AA 1GL7A 4P32A 3WGYA 4MP8A 5ALDA 5KDDA 3BY6A 1H66A 3K04A 2BONA 1NW9B 2PS1A 1COMA 2ONKA 1WB4A 3JY6A 4BNMA 1PSZA 1JSZA 2PMKA 1RAFA 4NG5A 3NIGB 1MEJA 2V6BA 4ZT3A 2G6BA 2ODPA 2ZUTA 1PQPA 4YAIA 1X92A 4Y1EA 1OC2A 4KOEC 4PHGA 5J1SB 1IZ0A 4GX0A 1WDMA 5TR9A 4EENA 2O19A 3QOWA 2QDKA 4XIYA 2AJDA 3OOHA 1AJQA 4B3TB 3VR6A 2EJBA 3DMYA 5E4JA 4NI5A 4DCUA 5D3QA 2HPHA 1MX5A 2W2XA 3GR6A 3EY9A 2BFWA 3TRJA 1AILA 2Q8NA 3G0OA 4EPTA 2B4RO 5C31A 3GRVA 4JP1A 2C7RA 3X1KA 4ARCA 3R3UA 2R7AA 4C6TA 2C31A 3C9UA 4MKIA 1K34A 1UBTS 3R7FA 4BLUA 3WXMB 3NH6A 1DBRA 2ZANA 1I94B 2B2NA 2VHJA 3EGEA 3TR6A 1FVFA 3TDNA 2OA0A 5F2OA 1RJEA 4BEBA 1PJSA 1KYVA 5EIWA 2H2DA 3CCFA 3WRVA 4DMFA 4BVBA 3AIIA 1E2LA 1R4MA 1D2CA 3IDZA 1B73A 2NO4A 3HN6A 3LCCA 2G06A 4UCUA 4JITA 4O4HB 3MJEA 4IIVA 3OAAG 1DWPA 4YK7A 2QMOA 4EO4A 1RLTA 4L78A 4BZZA 3AL2A 1D5WA 2FTKA 4C3VA 4LSWA 2FMFA 3BAAA 3UA3A 1G20E 2CMKA 3O1JC 5FNVF 4IOMA 1JEQA 2GGSA 4PYMA 1LUVA 2Q41A 4B7CA 4V39A 1ECBA 2V4UA 4Z0HO 4AQ7A 3LY9A 1GFZA 1ZUWA 1HH4A 3B8NA 3SS9X 3AL0C 3IE0A 4UNIA 1N32O 3U13A 4LX8A 2JFGA 3SHOA 4LRUA 2ODTX 5EG5A 1B6SA 2PSDA 1VQOF 1YJ9F 3JQEA 3RDPA 4EF4A 2EARA 3E3NA 4HC4A 5L3QB 4AJOA 1RQ2A 4TYWA 2MINA 4KYUA 4B0OA 4DIBA 3U7RA 1DQNA 1MMMA 3KOUA 4AWBA 2Q6TA 4D4MA 3FWPA 5DLPA 1NJFA 1GZSA 3W8RA 4JSTA 1JIKA 1YFJA 4HAXA 2HLDD 3HVJA 2CYCA 2J48A 4RIHA 4YACA 3EUWA 1SERA 4XCQA 1FU4A 4R05A 3IQFA 1BCSA 3IUSA 4HQFA 4N3CA 1FYXA 3OUFA 1QYWA 2IYFA 3AEYA 3KZOA 3DF9A 3WLKX 2VJBA 4TUYB 3DDHA 1M93A 1VEWA 2J32A 3FMVA 1NURA 1ONPA 1NP7A 3LLMA 3N7AA 1EDZA 1KKDA 3HDGA 2V7GA 3QVWA 4KUEA 2LP4Y 4G8CA 2DUWA 1NBEA 4NZOA 5HXUA 3F5MA 3U56A 3S7ZA 3PBKA 2Y0IA 1N6HA 3CKYA 4CKEA 1Q7GA 2C4WA 1JQLB 4BX2A 4V0OA 4IVPA 1I08A 1FQWA 2FTKE 2I91A 4P5EA 1FS5A 4JQOA 4IVNA 2DW4A 3BPZA 4DMCA 1DBIA 1BDMA 3OLQA 1Y1RA 3FAVB 2AEEA 4RAQA 4PYLA 1KHTA 4MRMA 4P3KA 2WFLA 4CF4A 4EKNB 2P9TA 3G5LA 3ASZA 3L05A 1BKDR 4Y9RA 3GW8A 4IDHA 4O59O 1S4QA 2JVIA 3MDSA 3K14A 2GJ4A 5F73A 2ZYAA 4PGGA 1Z0KA 3OE7G 4HAWA 3LA8A 2I8CA 1SHZA 4XJSA 5ALGA 5EBWC 1VSTA 1P73A 5I7WA 3M7MX 1X9GA 5H3LA 2AGVA 3LF2A 3E1GA 4TQDA 4HO1X 5KDLA 3IHLA 4NONA 2V4DA 3BSWA 5BR8B 1FU8A 1MQ8B 5KSOA 4XOIA 3I6BA 3WSTA 1WSDA 1NYTA 2CH7B 4M89A 5AT1A 4LWPA 3E27A 3O8BA 4RCVA 1YB4A 1ZITA 3SHFA 2OGWA 3DWIA 4F45A 4MP3A 4ZO4A 2PGOA 3OT1A 2Q67A 4POAA 3C45A 4US1R 3W0LB 1OTXA 2HSWA 5KINB 4GKVA 1Z0AA 1NOJA 2QE7G 1II8A 2YKGA 1M2OB 3E22A 3NJ4A 4CIVA 3NKFA 4UU8A 4IOLA 2CFIA 2AJ8A 2BSXA 2JFFA 3KJIA 1WCV1 5FTKA 5MF6A 2HQSA 1BEUB 2ATKC 3R3SA 3VHQA 4I1IA 2YYYA 3AIKA 2AOVA 1JY8A 1XZFA 4AUNA 1ISPA 3DONA 1U9ZA 3TRFA 2NGRA 3HLTA 1PV1A 1HDEA 2ZVZA 4LDPA 1W4CA 3DLBA 3CYPB 2VDVE 4GPIB 3SIUA 4GKBA 1BD4A 1EFVA 9LDBA 3AR7A 1XZEA 2WU4A 3L7NA 1EM8B 4Q9LA 2AW5A 4MRRA 3ENQA 1DWQA 2A7XA 1E4YA 2L6LA 1HDZA 2XECA 3I3OA 3H6GA 1I0IA 4YAGA 1JDPA 3TXYA 2J7PD 2REOA 1N2BA 3GEPA 4NC9A 3LC7O 1NG1A 2CLLB 3V4LA 4Z4IA 2PJDA 3CLHA 3RJ9A 2R87A 4PX2A 1ATZA 3TPCA 3LQYA 4J7JA 5JAHA 3LWZA 4BRUA 2PGGA 1Q0LA 4JI6O 4PM4A 2E4WA 3TFOA 1NZDA 1FNKA 4MWSA 2J3DA 1KZ7B 1ZUD1 3HBJA 4PDRA 4G97A 3KIPA 4RFSA 4QLOA 4D26A 4TMFA 3ISTA 2ET6A 4Y0AA 4F6RB 2IZZA 4BB0A 4KZPA 5KX5F 4TWBA 3EMDA 1U0EA 1FDOA 2IF2A 2QZZA 3UYKA 4A10A 3X0DA 1FP6A 1P45A 1ZGJA 4JJAA 5JTTA 1RWOA 1BN7A 2HDHA 1R6TA 3G7UA 3WAGA 3DJFA 3LQ4A 2LIPA 2ZJ5A 1YITV 4WZBA 3G8YA 2P3LA 3PL5A 4FEGA 2AQ8A 4LF6B 1QR9A 1NKTA 5LZ9A 1QK4A 3M5WA 4ZT5A 1NXVA 3TD2A 1P74A 5L4SA 1OPXA 5JMTA 3OMAB 1NVVR 3BQMB 4KKVA 2CXPA 1JR2A 4JV5O 5D01A 3LG2A 5FBLB 4B7EA 4AKTA 1Q0ZA 2QKAA 3CV3A 3NHBA 2P3QA 3TOVA 4HDCA 3WAKA 4IOJA 4XLZA 3C4JA 2QLJA