3F0DA

High resolution crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphatase synthase from burkholderia pseudomallei
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
155
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 51
structure length 155
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0dA00
3F0DA 3FBAA 3JVHA 1IV1A 3P10A 3Q8HA 3GHZA 3IKFA 3B6NA 1YQNA 5B8FA 1VH8A 3F6MA 4C82A 3P0ZA 4C8GA 3QHDA 1VHAA 1U43A 3IEQA 4C8IA 1KNKA 2PMPA 3ESJA 3T80A 1W57A 1IV3A 1IV4A 3IEWA 1T0AA 1U3PA 1U40A 1KNJA 3KE1A 3F0FA 3K2XA 4C81A 3K14A 3MBMA 1JY8A 1IV2A 2AMTA 2UZHA 3EORA 3ERNA 4C8EA 2GZLA 1H48A 1GX1A 3ELCA 1U3LA 3F0EA 3RE3A 3F0GA 1W55A 1JN1A 3FPIA 3IKEA 1H47A
chains in the Genus database with same CATH superfamily
3GTZA 4X1IA 4B62A 4KWEA 3P10A 3HKDA 2MQEA 1YI2F 1J7HA 3VIUA 4I55B 3WGJA 5IYZA 5JCOC 1K9MH 1YIJF 3J7AR 3HKEA 2Q1XA 3G6EF 1VQKF 1SA0B 1X25A 4G4XA 1IV4A 1DT9A 4I50A 3CMEF 2CZWA 4ZHVA 5FNVB 5EYPB 1W5EA 2HRYA 3VOBA 3R0PA 3RA6A 5MN5A 4NQ3A 4ZI7A 4YJ3A 2LCAA 4DRXA 2ZODA 3VMFB 4X1KB 3RYIA 5J2TA 3MCQA 1W40A 4LNUB 2GLZA 1GO1A 2KGWA 4TUYB 5EWRA 2QEXF 4BVTA 3LWPC 4U3JA 3WGKA 3K12A 5G4UC 3S02A 3OBWA 2ZAUA 1W57A 1IV3A 2CW4A 4IIJA 4XCQA 4WBNB 5KX5B 5GAPK 2QTPA 1X7PA 2EWCA 2Q1YA 3C9TA 3RYHB 5JH7A 4B45A 2YXZA 2W8BC 5BMVB 5IJ0B 1CLIA 5C8YA 4TV9A 2H8CA 4X3MA 1H7MA 2OTLF 1JD1A 3S03A 3MCAB 3N2GA 1N8RH 3NMUC 3QUWA 1VQOF 1YHQF 2UYNB 1KD1H 4ZHQA 2RHJA 3ESJA 3V3TA 2JNBA 3HKBA 4FFBB 1W2BF 3RYCA 1XV2A 5J2UB 1OAPA 2HQSC 4I4TA 5GANK 4RQOA 3WJPA 3JAKB 2L26A 3K14A 4ZOLA 3FFMA 3S0WA 2KTVA 4X1IB 3CCUF 5CB4B 3HKDB 1COMA 3ELCA 5EB1B 3CCMF 5IYZB 3CPQA 3HKEB 1NQ3A 1RQ7A 1R1MA 4IHJA 4BT2A 3FBAA 3JAWA 3N4ZA 4G4WA 1YQNA 1VK3A 2HP0A 5LP6C 1M90H 3JASA 2BTOA 2VAPA 5HWEA 4ZI7B 4YJ3B 3VYTC 4DRXB 2OZBA 2HS3A 3RYIB 2IQQA 3VOAA 4TZZA 3IMPA 3U0OA 3ZP4A 3JALB 4U3JB 4YJ2A 1RQ2A 3G71F 4ZK7A 4IIJB 3JARA 1KQSF 3WJQA 4X1YA 1QD9A 1JFFA 5ITZA 5JH7B 2PMPA 1Q82H 3KHNA 3CCRF 4O4LA 3N4YA 4EB6A 5CA0B 2UYKA 2Z1UA 4C81A 1FFXA 3K2XA 2LBWA 4ERHA 3DC2A 3CCQF 3ERNA 4C8EA 3N2GB 4O4HA 1KC8H 4BT6A 3FPIA 1VQ5F 4ZHQB 3CCJF 4F6RA 1VQLF 3HKCA 5EAZA 1H47A 3CC4F 1IV1A 3E1YA 3RYCB 3CG6A 1VH8A 3E22A 3CXCF 3CC2F 4I4TB 3UT5A 3N2KA 3ON1A 1NJIH 4C8GA 2KG4A 3G4SF 2K1SA 3NK7A 4O2BB 3CCEF 1Q81H 3QTYA 1M1KH 2DT4A 2RHLA 4IHJB 2ZOVA 3JAWB 3CCVF 1VQVA 3S06A 3OW2F 1YGYA 2HP3A 3JASB 1GO0A 3VI6A 3JVHA 4NWOB 2BTQB 3WPXA 3DDNA 5HXUA 1SDSA 2VGNA 2HRUA 5LYJB 1K8AH 1TUBA 5FJ4C 5AVMA 5HY4A 3CMAF 1Q7YH 1RLGA 3T80A 2AIFA 3LWQC 5LA6A 1T0AA 5MN6A 3KJJA 3I3FA 2UYJA 4YJ2B 2NMUA 4R40B 4HNAB 3ZOPA 1Q86H 1U3LA 4X3LA 4X1YB 5EO3A 4BVRA 4BVQA 3J80M 2RHHA 1PXWA 1NMUB 5ITZB 1TVKA 4O4JA 1K73H 1YJNF 3GHZA 4O4LB 4EB6B 5IJ9A 3MDOA 1QVFF 3CC7F 3LFOA 3FD5A 4G88A 2HVYD 1ONIA 4O4HB 5G4VC 2FC3A 2IAFA 2N48A 3CYPB 4F6RB 3HKCB 5LP6A 1QU9A 1VQ7F 3LWOC 1YJWF 4O2AA 4BT3A 1CN7A 2ZVZA 5LOVA 4LCKA 3JATA 3UT5B 3N2KB 3F0GA 4ZHWA 2CHTA 3O85A 1VQ9F 3F0DA 1YITF 3WJRA 1S72F 4C4WC 2BO1A 4I50B 2B33A 3QHDA 4G4ZA 3HAXD 2VAWA 5EB0A 1Z5WA 2Z1FA 1KNJA 3KE1A 3RA5A 4BVSA 3WGNA 3M1XA 1JY8A 1Q8RA 5J2TB 2BTUA 5JQGA 1H48A 2CHSA 4BY9D 5HY2A 1W581 3C9UA 4B46A 1GZ0A 1TUBB 1RA4A 1FNJA 2WALA 2CVLA 4C82A 3NK6A 3LWVC 3SIUA 4EI7A 2R6R1 5LA6B 1FSZA 1XBIA 5MN4A 4TV8A 2RHOA 4EI8A 2HS0A 5EZYA 2ALEA 4B5CA 1UI9A 3IEWA 4U39A 5C8YB 1W59A 4TV9B 3JAMM 3MBMA 2UZHA 1TVKB 2AMTA 3E20B 4O4JB 3C9SA 4ZHYB 4WBNA 1QAHA 5IJ9B 2OTJF 3C9RA 3V4DA 3WGMA 3K0TA 1VQPF 3RYHA 3LDTA 1JN1A 3TD4A 2QA4F 5KMGA 3CB2A 1XHOA 5HP8A 1JJ2F 3HKBB 3RYFA 2G9IA 1CK2A 1YJ9F 3PAFA 5LP6B 2P6YA 2Z01A 4ZOLB 1VQNF 3WXMB 5LOVB 2UYNA 3JATB 3KJKA 1IPAA 2V9YA 3IR9A 1QVGF 4G4VA 1ZWZA 4FFBA 5IT9M 3FD6A 3J81M 2QI2A 5J2UA 2PHNA 3L7QA 2KTUA 3NVIB 3RE3A 2HP0B 5HY1A 5HP7A 3CYQA 4BT4A 2ZF8A 1X7OA 3PLAC 5CB4A 4X20A 1DBFA 2YYEA 3D54A 1OFUA 1W42A 1X52A 5HXZA 5JQGB 3BYQA 1W5FA 1U3PA 5A2QM 2AIZP 4NUTA 1RLUA 1UFYA 1Z5VA 1GX1A 3HJWC 3JARB 4TV8B 1W55A 1JFFB 3ZP7A 5HY0A 3OBYA 5EZYB 3VTIC 2LBXA 3JALA 3CPWF 3Q8HA 3VYUC 3B6NA 3V7EA 3F6MA 3HTNA 2VAMA 1FFXB 3P0ZA 1VQ8F 5EIBD 4EI9A 2HS4A 5GIPC 5FLXM 3M84A 3AGKA 5KMGB 3HWUA 5JVDA 5CA0A 3RYFB 2UYPA 5LXTA 5EIBC 5GONA 3KIZA 3E22B 1VQ6F 5CA1A 3S0YA 3IKEA 1VQMF 3TD3A 3WPWA 3VYSC 4O4IA 3ZO8A 3C8LA 2LBTA 1VHAA 3IEQA 2H8EA 1KNKA 2FGYA 3I7TA 4BW0B 4I55A 3I56F 3F0FA 4M8IA 1W41A 1SA0A 2Z1EA 4O2BA 1W5BA 4X20B 2ZVYA 5GINC 1ODEA 2VXYA 3F0EA 3D01A 5FNVA 5EYPA 3OONA 4E6EA 2RB9A 2CWJA 5GIOC 5B8FA 3NVKE 1T0KB 3V7QA 3LWRC 2R751 4X1KA 2Z1TA 3D00A 3CD6F 4LNUA 4C8IA 4TUYA 5LYJA 1W5AA 2OTMA 3M4SA 2OHWA 3MQWA 4BT7A 3LMEA 3EORA 4DXDA 3SIVA 2GZLA 3TD5A 3I55F 2F9ZC 2IG8A 5KX5A 3JCMM 1E7KA 2CSLA 4G4YA 1FNKA 4HNAA 1XRGA 4BT5A 5DCVA 1VQ4F 4PWTA 2HX0A 3VCZA 5BMVA 3IKFA 5IJ0A 2VGMA 3P4EA 1U43A 3GYQA 1PF5A 1SZQA 1W3EX 5JVDB 4O2AB 5LXTB 2GVIA 3S0HA 2I6RA 5GONB 1U40A 2I6DA 5CA1B 5JCOA 1IV2A 3WGLA 3VO8A 2DYYA 3CCLF 4O4IB 4RHAA 3CCSF 3JAKA 2H6LA 3LYBA
chains in the Genus database with same CATH topology
3F0DA 3FBAA 3JVHA 1IV1A 3P10A 3Q8HA 3GHZA 3IKFA 3B6NA 1YQNA 5B8FA 1VH8A 3F6MA 4C82A 3P0ZA 4C8GA 3QHDA 1VHAA 1U43A 3IEQA 4C8IA 1KNKA 2PMPA 3ESJA 3T80A 1W57A 1IV3A 1IV4A 3IEWA 1T0AA 1U3PA 1U40A 1KNJA 3KE1A 3F0FA 3K2XA 4C81A 3K14A 3MBMA 1JY8A 1IV2A 2AMTA 2UZHA 3EORA 3ERNA 4C8EA 2GZLA 1H48A 1GX1A 3ELCA 1U3LA 3F0EA 3RE3A 3F0GA 1W55A 1JN1A 3FPIA 3IKEA 1H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0D A;  3FBA A;  3JVH A;  1IV1 A;  3P10 A;  3Q8H A;  3GHZ A;  3IKF A;  3B6N A;  1YQN A;  5B8F A;  1VH8 A;  3F6M A;  4C82 A;  3P0Z A;  4C8G A;  3QHD A;  1VHA A;  1U43 A;  3IEQ A;  4C8I A;  1KNK A;  2PMP A;  3ESJ A;  3T80 A;  1W57 A;  1IV3 A;  1IV4 A;  3IEW A;  1T0A A;  1U3P A;  1U40 A;  1KNJ A;  3KE1 A;  3F0F A;  3K2X A;  4C81 A;  3K14 A;  3MBM A;  1JY8 A;  1IV2 A;  2AMT A;  2UZH A;  3EOR A;  3ERN A;  4C8E A;  2GZL A;  1H48 A;  1GX1 A;  3ELC A;  1U3L A;  3F0E A;  3RE3 A;  3F0G A;  1W55 A;  1JN1 A;  3FPI A;  3IKE A;  1H47 A; 
#chains in the Genus database with same CATH topology
 3GTZ A;  4X1I A;  4B62 A;  4KWE A;  3P10 A;  3HKD A;  2MQE A;  1YI2 F;  1J7H A;  3VIU A;  4I55 B;  3WGJ A;  5IYZ A;  5JCO C;  1K9M H;  1YIJ F;  3J7A R;  3HKE A;  2Q1X A;  3G6E F;  1VQK F;  1SA0 B;  1X25 A;  4G4X A;  1IV4 A;  1DT9 A;  4I50 A;  3CME F;  2CZW A;  4ZHV A;  5FNV B;  5EYP B;  1W5E A;  2HRY A;  3VOB A;  3R0P A;  3RA6 A;  5MN5 A;  4NQ3 A;  4ZI7 A;  4YJ3 A;  2LCA A;  4DRX A;  2ZOD A;  3VMF B;  4X1K B;  3RYI A;  5J2T A;  3MCQ A;  1W40 A;  4LNU B;  2GLZ A;  1GO1 A;  2KGW A;  4TUY B;  5EWR A;  2QEX F;  4BVT A;  3LWP C;  4U3J A;  3WGK A;  3K12 A;  5G4U C;  3S02 A;  3OBW A;  2ZAU A;  1W57 A;  1IV3 A;  2CW4 A;  4IIJ A;  4XCQ A;  4WBN B;  5KX5 B;  5GAP K;  2QTP A;  1X7P A;  2EWC A;  2Q1Y A;  3C9T A;  3RYH B;  5JH7 A;  4B45 A;  2YXZ A;  2W8B C;  5BMV B;  5IJ0 B;  1CLI A;  5C8Y A;  4TV9 A;  2H8C A;  4X3M A;  1H7M A;  2OTL F;  1JD1 A;  3S03 A;  3MCA B;  3N2G A;  1N8R H;  3NMU C;  3QUW A;  1VQO F;  1YHQ F;  2UYN B;  1KD1 H;  4ZHQ A;  2RHJ A;  3ESJ A;  3V3T A;  2JNB A;  3HKB A;  4FFB B;  1W2B F;  3RYC A;  1XV2 A;  5J2U B;  1OAP A;  2HQS C;  4I4T A;  5GAN K;  4RQO A;  3WJP A;  3JAK B;  2L26 A;  3K14 A;  4ZOL A;  3FFM A;  3S0W A;  2KTV A;  4X1I B;  3CCU F;  5CB4 B;  3HKD B;  1COM A;  3ELC A;  5EB1 B;  3CCM F;  5IYZ B;  3CPQ A;  3HKE B;  1NQ3 A;  1RQ7 A;  1R1M A;  4IHJ A;  4BT2 A;  3FBA A;  3JAW A;  3N4Z A;  4G4W A;  1YQN A;  1VK3 A;  2HP0 A;  5LP6 C;  1M90 H;  3JAS A;  2BTO A;  2VAP A;  5HWE A;  4ZI7 B;  4YJ3 B;  3VYT C;  4DRX B;  2OZB A;  2HS3 A;  3RYI B;  2IQQ A;  3VOA A;  4TZZ A;  3IMP A;  3U0O A;  3ZP4 A;  3JAL B;  4U3J B;  4YJ2 A;  1RQ2 A;  3G71 F;  4ZK7 A;  4IIJ B;  3JAR A;  1KQS F;  3WJQ A;  4X1Y A;  1QD9 A;  1JFF A;  5ITZ A;  5JH7 B;  2PMP A;  1Q82 H;  3KHN A;  3CCR F;  4O4L A;  3N4Y A;  4EB6 A;  5CA0 B;  2UYK A;  2Z1U A;  4C81 A;  1FFX A;  3K2X A;  2LBW A;  4ERH A;  3DC2 A;  3CCQ F;  3ERN A;  4C8E A;  3N2G B;  4O4H A;  1KC8 H;  4BT6 A;  3FPI A;  1VQ5 F;  4ZHQ B;  3CCJ F;  4F6R A;  1VQL F;  3HKC A;  5EAZ A;  1H47 A;  3CC4 F;  1IV1 A;  3E1Y A;  3RYC B;  3CG6 A;  1VH8 A;  3E22 A;  3CXC F;  3CC2 F;  4I4T B;  3UT5 A;  3N2K A;  3ON1 A;  1NJI H;  4C8G A;  2KG4 A;  3G4S F;  2K1S A;  3NK7 A;  4O2B B;  3CCE F;  1Q81 H;  3QTY A;  1M1K H;  2DT4 A;  2RHL A;  4IHJ B;  2ZOV A;  3JAW B;  3CCV F;  1VQV A;  3S06 A;  3OW2 F;  1YGY A;  2HP3 A;  3JAS B;  1GO0 A;  3VI6 A;  3JVH A;  4NWO B;  2BTQ B;  3WPX A;  3DDN A;  5HXU A;  1SDS A;  2VGN A;  2HRU A;  5LYJ B;  1K8A H;  1TUB A;  5FJ4 C;  5AVM A;  5HY4 A;  3CMA F;  1Q7Y H;  1RLG A;  3T80 A;  2AIF A;  3LWQ C;  5LA6 A;  1T0A A;  5MN6 A;  3KJJ A;  3I3F A;  2UYJ A;  4YJ2 B;  2NMU A;  4R40 B;  4HNA B;  3ZOP A;  1Q86 H;  1U3L A;  4X3L A;  4X1Y B;  5EO3 A;  4BVR A;  4BVQ A;  3J80 M;  2RHH A;  1PXW A;  1NMU B;  5ITZ B;  1TVK A;  4O4J A;  1K73 H;  1YJN F;  3GHZ A;  4O4L B;  4EB6 B;  5IJ9 A;  3MDO A;  1QVF F;  3CC7 F;  3LFO A;  3FD5 A;  4G88 A;  2HVY D;  1ONI A;  4O4H B;  5G4V C;  2FC3 A;  2IAF A;  2N48 A;  3CYP B;  4F6R B;  3HKC B;  5LP6 A;  1QU9 A;  1VQ7 F;  3LWO C;  1YJW F;  4O2A A;  4BT3 A;  1CN7 A;  2ZVZ A;  5LOV A;  4LCK A;  3JAT A;  3UT5 B;  3N2K B;  3F0G A;  4ZHW A;  2CHT A;  3O85 A;  1VQ9 F;  3F0D A;  1YIT F;  3WJR A;  1S72 F;  4C4W C;  2BO1 A;  4I50 B;  2B33 A;  3QHD A;  4G4Z A;  3HAX D;  2VAW A;  5EB0 A;  1Z5W A;  2Z1F A;  1KNJ A;  3KE1 A;  3RA5 A;  4BVS A;  3WGN A;  3M1X A;  1JY8 A;  1Q8R A;  5J2T B;  2BTU A;  5JQG A;  1H48 A;  2CHS A;  4BY9 D;  5HY2 A;  1W58 1;  3C9U A;  4B46 A;  1GZ0 A;  1TUB B;  1RA4 A;  1FNJ A;  2WAL A;  2CVL A;  4C82 A;  3NK6 A;  3LWV C;  3SIU A;  4EI7 A;  2R6R 1;  5LA6 B;  1FSZ A;  1XBI A;  5MN4 A;  4TV8 A;  2RHO A;  4EI8 A;  2HS0 A;  5EZY A;  2ALE A;  4B5C A;  1UI9 A;  3IEW A;  4U39 A;  5C8Y B;  1W59 A;  4TV9 B;  3JAM M;  3MBM A;  2UZH A;  1TVK B;  2AMT A;  3E20 B;  4O4J B;  3C9S A;  4ZHY B;  4WBN A;  1QAH A;  5IJ9 B;  2OTJ F;  3C9R A;  3V4D A;  3WGM A;  3K0T A;  1VQP F;  3RYH A;  3LDT A;  1JN1 A;  3TD4 A;  2QA4 F;  5KMG A;  3CB2 A;  1XHO A;  5HP8 A;  1JJ2 F;  3HKB B;  3RYF A;  2G9I A;  1CK2 A;  1YJ9 F;  3PAF A;  5LP6 B;  2P6Y A;  2Z01 A;  4ZOL B;  1VQN F;  3WXM B;  5LOV B;  2UYN A;  3JAT B;  3KJK A;  1IPA A;  2V9Y A;  3IR9 A;  1QVG F;  4G4V A;  1ZWZ A;  4FFB A;  5IT9 M;  3FD6 A;  3J81 M;  2QI2 A;  5J2U A;  2PHN A;  3L7Q A;  2KTU A;  3NVI B;  3RE3 A;  2HP0 B;  5HY1 A;  5HP7 A;  3CYQ A;  4BT4 A;  2ZF8 A;  1X7O A;  3PLA C;  5CB4 A;  4X20 A;  1DBF A;  2YYE A;  3D54 A;  1OFU A;  1W42 A;  1X52 A;  5HXZ A;  5JQG B;  3BYQ A;  1W5F A;  1U3P A;  5A2Q M;  2AIZ P;  4NUT A;  1RLU A;  1UFY A;  1Z5V A;  1GX1 A;  3HJW C;  3JAR B;  4TV8 B;  1W55 A;  1JFF B;  3ZP7 A;  5HY0 A;  3OBY A;  5EZY B;  3VTI C;  2LBX A;  3JAL A;  3CPW F;  3Q8H A;  3VYU C;  3B6N A;  3V7E A;  3F6M A;  3HTN A;  2VAM A;  1FFX B;  3P0Z A;  1VQ8 F;  5EIB D;  4EI9 A;  2HS4 A;  5GIP C;  5FLX M;  3M84 A;  3AGK A;  5KMG B;  3HWU A;  5JVD A;  5CA0 A;  3RYF B;  2UYP A;  5LXT A;  5EIB C;  5GON A;  3KIZ A;  3E22 B;  1VQ6 F;  5CA1 A;  3S0Y A;  3IKE A;  1VQM F;  3TD3 A;  3WPW A;  3VYS C;  4O4I A;  3ZO8 A;  3C8L A;  2LBT A;  1VHA A;  3IEQ A;  2H8E A;  1KNK A;  2FGY A;  3I7T A;  4BW0 B;  4I55 A;  3I56 F;  3F0F A;  4M8I A;  1W41 A;  1SA0 A;  2Z1E A;  4O2B A;  1W5B A;  4X20 B;  2ZVY A;  5GIN C;  1ODE A;  2VXY A;  3F0E A;  3D01 A;  5FNV A;  5EYP A;  3OON A;  4E6E A;  2RB9 A;  2CWJ A;  5GIO C;  5B8F A;  3NVK E;  1T0K B;  3V7Q A;  3LWR C;  2R75 1;  4X1K A;  2Z1T A;  3D00 A;  3CD6 F;  4LNU A;  4C8I A;  4TUY A;  5LYJ A;  1W5A A;  2OTM A;  3M4S A;  2OHW A;  3MQW A;  4BT7 A;  3LME A;  3EOR A;  4DXD A;  3SIV A;  2GZL A;  3TD5 A;  3I55 F;  2F9Z C;  2IG8 A;  5KX5 A;  3JCM M;  1E7K A;  2CSL A;  4G4Y A;  1FNK A;  4HNA A;  1XRG A;  4BT5 A;  5DCV A;  1VQ4 F;  4PWT A;  2HX0 A;  3VCZ A;  5BMV A;  3IKF A;  5IJ0 A;  2VGM A;  3P4E A;  1U43 A;  3GYQ A;  1PF5 A;  1SZQ A;  1W3E X;  5JVD B;  4O2A B;  5LXT B;  2GVI A;  3S0H A;  2I6R A;  5GON B;  1U40 A;  2I6D A;  5CA1 B;  5JCO A;  1IV2 A;  3WGL A;  3VO8 A;  2DYY A;  3CCL F;  4O4I B;  4RHA A;  3CCS F;  3JAK A;  2H6L A;  3LYB A; 
#chains in the Genus database with same CATH homology
 3F0D A;  3FBA A;  3JVH A;  1IV1 A;  3P10 A;  3Q8H A;  3GHZ A;  3IKF A;  3B6N A;  1YQN A;  5B8F A;  1VH8 A;  3F6M A;  4C82 A;  3P0Z A;  4C8G A;  3QHD A;  1VHA A;  1U43 A;  3IEQ A;  4C8I A;  1KNK A;  2PMP A;  3ESJ A;  3T80 A;  1W57 A;  1IV3 A;  1IV4 A;  3IEW A;  1T0A A;  1U3P A;  1U40 A;  1KNJ A;  3KE1 A;  3F0F A;  3K2X A;  4C81 A;  3K14 A;  3MBM A;  1JY8 A;  1IV2 A;  2AMT A;  2UZH A;  3EOR A;  3ERN A;  4C8E A;  2GZL A;  1H48 A;  1GX1 A;  3ELC A;  1U3L A;  3F0E A;  3RE3 A;  3F0G A;  1W55 A;  1JN1 A;  3FPI A;  3IKE A;  1H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...