3F0DA

High resolution crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphatase synthase from burkholderia pseudomallei
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
155
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 51
structure length 155
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f0dA00
1U3PA 3F0DA 3IEWA 2AMTA 3ESJA 3B6NA 1VHAA 3F0GA 1IV4A 2GZLA 1T0AA 1U40A 4C81A 3QHDA 1IV2A 3Q8HA 1YQNA 4C8GA 1JN1A 1IV3A 1W55A 1KNJA 5B8FA 3T80A 1JY8A 1KNKA 3ERNA 3F6MA 3P0ZA 4C8EA 3FBAA 1U3LA 3ELCA 3KE1A 1W57A 3IEQA 3F0EA 3RE3A 3GHZA 1GX1A 1U43A 1H48A 3P10A 4C82A 2PMPA 3IKFA 4C8IA 1VH8A 1IV1A 3JVHA 3FPIA 3IKEA 3F0FA 3K2XA 1H47A 3EORA 3K14A 3MBMA 2UZHA
chains in the Genus database with same CATH superfamily
3PAFA 2I6DA 3CCSF 5EIBC 2AMTA 3HKEA 4X1IB 1VQ4F 1VQOF 2VAWA 4NWOB 2CVLA 3MCQA 3CMEF 4ZOLA 1NMUB 3G4SF 3LWQC 5EO3A 5CA1A 2GLZA 4B5CA 3TD5A 1YHQF 1VQMF 5LYJA 5DCVA 2PMPA 3WGKA 4ZHQA 2AIFA 2QEXF 3RYIA 3L7QA 3OONA 1H47A 2DYYA 1OAPA 3HAXD 5HXZA 3WJQA 3ZP4A 3HTNA 4IHJB 1JJ2F 1VHAA 4ZI7A 5BMVB 5EWRA 5G4VC 2LCAA 5GAPK 4C8GA 3KJJA 1R1MA 5ITZB 3IR9A 5C8YA 4X3LA 3ERNA 1NQ3A 2UYNA 3G6EF 3JARA 3PLAC 3V7EA 3CCRF 4PWTA 4X1KA 3RA5A 3UT5A 4BT4A 4E6EA 2OZBA 2CHSA 3JALA 4XCQA 1FFXB 2DT4A 2EWCA 3VOAA 4C82A 1RA4A 3MDOA 3G71F 5JH7A 1IV1A 2P6YA 1J7HA 3HJWC 5IT9M 1E7KA 3JATA 1FSZA 2UYPA 2Z01A 3K14A 3WPXA 5CB4A 1XV2A 4X20B 1JFFB 1VQNF 3RYHB 4WBNA 4FFBB 4ZK7A 1RQ2A 2KTVA 5JCOA 2KG4A 5IJ9A 2RHLA 3V3TA 2F9ZC 3FBAA 3BYQA 4TUYB 3ZO8A 2BO1A 1CK2A 1FNJA 4B45A 4ZHVA 5EIBD 4X1YA 3ZOPA 3HKBB 3V7QA 1K73H 1QVGF 2UYJA 3VI6A 2HRUA 3VOBA 3K2XA 4BT6A 3S0YA 2OTJF 3ON1A 4BVRA 3I56F 3S03A 3JAWA 3B6NA 3F0GA 1X25A 1ODEA 5IYZB 3NK7A 2BTQB 4EI9A 4I55B 1Q7YH 2GVIA 4U39A 5IJ0B 4F6RA 5EYPA 2Z1UA 3F6MA 4O4JB 2LBXA 3VYTC 3QTYA 3E22A 1GX1A 4HNAB 2H8CA 2ZODA 2VAMA 2JNBA 3R0PA 3LFOA 2R751 3CC2F 1W42A 5EB1B 5LA6B 3RYCA 3CD6F 1W41A 1M90H 5HP7A 3ESJA 3N4YA 4O2BB 4ZHYB 3S06A 4RQOA 1M1KH 3QHDA 5LP6C 3WJPA 3CCJF 3S0HA 5EZYB 1KNKA 2HP0A 4BT3A 2L26A 3KE1A 4KWEA 1U43A 4O4LB 2OTLF 2LBTA 1SDSA 3GTZA 1VQ6F 1W5AA 1K8AH 2CWJA 3F0FA 5MN5A 3S0WA 1NJIH 3IEWA 3LWOC 1W5BA 5HWEA 3J81M 3ZP7A 3LWPC 3JASA 2N48A 1IV4A 1YI2F 3DC2A 1PF5A 1SZQA 2WALA 5KMGA 5LOVB 3OW2F 4DRXA 1U3LA 1PXWA 3NVKE 4O4IA 3N2KB 1VQLF 1VQVA 1SA0A 1W5EA 3FFMA 5CA0A 1H48A 3CPWF 2FC3A 1VQ7F 3NVIB 3IKFA 1JD1A 4I4TA 4U3JB 1ZWZA 2RB9A 3FD5A 4M8IA 5J2UB 4O4HB 3HKDB 3N2GB 4YJ3B 4G4YA 1X52A 1FNKA 2RHJA 5JVDA 2H6LA 1YJNF 3I3FA 1TVKB 3C9TA 5J2TA 4I50A 4IIJB 1QVFF 2HS4A 5KX5A 5FNVA 5LP6B 3JAKA 2HP3A 3VMFB 2KGWA 1TUBA 4YJ2B 2IAFA 3CMAF 1XHOA 1KD1H 4BY9D 5GIOC 1GO1A 4X3MA 2G9IA 3RYFB 3VTIC 2Z1EA 3SIVA 3VYSC 2Z1TA 3WPWA 4DXDA 1Z5VA 1VQ9F 1Q86H 4TV8A 3HKCA 4G4WA 4O2AB 5FLXM 1N8RH 4BT5A 2GZLA 5LXTA 4C4WC 1GZ0A 2KTUA 5B8FA 4LNUB 3P0ZA 2BTUA 3QUWA 3HKEB 1W57A 2IG8A 5JQGA 2PHNA 4R40B 1VK3A 4ZOLB 4G4ZA 4BVTA 1QD9A 3WGJA 3D54A 1VH8A 5FJ4C 5GIPC 4NQ3A 5CA1B 1Q82H 5LYJB 5HY2A 1UFYA 3Q8HA 1YQNA 3MCAB 3RYIB 1DBFA 1YJ9F 2YYEA 2HVYD 2QA4F 2BTOA 4ZI7B 3GHZA 3D01A 1ONIA 4X1IA 1KQSF 5HY1A 3M1XA 3JVHA 5C8YB 2UYNB 2HS3A 2ZVZA 5EB0A 4C8EA 5GONB 2ZF8A 2ZAUA 5GINC 4X1KB 3UT5B 3DDNA 3JALB 3K0TA 3LYBA 3O85A 1QAHA 1U40A 5JH7B 3V4DA 3S02A 3JATB 4B46A 2HRYA 1XBIA 1K9MH 3E1YA 3RA6A 3ELCA 4O4HA 3IEQA 4IHJA 4YJ3A 2K1SA 1VQ8F 4WBNB 5BMVA 1VQPF 1W5FA 5EAZA 5IJ9B 3HWUA 2NMUA 4BW0B 1W59A 3TD3A 3MBMA 1DT9A 5ITZA 3C9RA 1CN7A 5HY0A 3GYQA 3CCEF 1CLIA 3M84A 3J7AR 4X1YB 1Q81H 2HQSC 1FFXA 3IMPA 5GANK 2ZOVA 3VCZA 4BVQA 1YGYA 3JAWB 3WXMB 1VQKF 4O2AA 4X20A 3MQWA 4RHAA 2LBWA 3CXCF 2B33A 1JFFA 2VGMA 1COMA 3LDTA 3RYHA 1W2BF 4FFBA 3VIUA 3I55F 2HX0A 4F6RB 5EYPB 3CCLF 3F0DA 2W8BC 5AVMA 3E22B 3WGNA 3D00A 4TUYA 5HY4A 3WJRA 3CCUF 1T0AA 1Q8RA 4ERHA 3SIUA 2CZWA 3HKBA 1YITF 1T0KB 3CYQA 1W55A 1KNJA 1W40A 2QI2A 2OHWA 3RYCB 1S72F 5A2QM 4BT2A 3VYUC 4EB6B 1RLGA 2VAPA 2OTMA 4LNUA 4C8IA 5IYZA 3JCMM 2RHHA 4I55A 1X7OA 3KIZA 2HP0B 4TV9B 2AIZP 5IJ0A 2UZHA 1U3PA 4O4JA 4ZHWA 1XRGA 3CG6A 1OFUA 2I6RA 4HNAA 3CPQA 3WGMA 1IV2A 1IV3A 3CB2A 5GONA 5G4UC 4EI7A 3TD4A 5LA6A 1H7MA 5JCOC 3RE3A 3JASB 4O2BA 3CC4F 2R6R1 3N4ZA 1KC8H 3KHNA 2Z1FA 3E20B 5KMGB 3CCVF 4DRXB 3VO8A 1RLUA 4O4IB 1IPAA 5EZYA 1SA0B 4NUTA 5CA0B 3LWRC 2FGYA 4I4TB 4O4LA 3OBWA 1UI9A 2CSLA 2VGNA 5MN6A 4ZHQB 1JY8A 2CW4A 2V9YA 2QTPA 5HXUA 1X7PA 2MQEA 3NMUC 3P10A 5JVDB 5HP8A 2IQQA 3LWVC 3IKEA 5J2TB 3I7TA 3NK6A 4I50B 5KX5B 5LOVA 5FNVB 3JARB 3C9UA 3JAKB 4BVSA 3N2KA 3CC7F 1VQ5F 4EI8A 3JAMM 1TUBB 2ZVYA 3FD6A 2YXZA 3J80M 1JN1A 4G4VA 3C9SA 3CCMF 2CHTA 4U3JA 4TV8B 5CB4B 3HKCB 2HS0A 4G88A 3F0EA 5J2UA 1GO0A 3HKDA 3N2GA 5LXTB 4LCKA 1YIJF 3LMEA 2UYKA 1YJWF 3FPIA 1W3EX 1TVKA 3WGLA 4IIJA 3OBYA 4EB6A 5JQGB 1W581 3CCQF 2Q1XA 5LP6A 1Z5WA 2ALEA 4C81A 3CYPB 4B62A 3KJKA 4TZZA 4YJ2A 3T80A 3RYFA 3P4EA 4TV9A 2H8EA 2Q1YA 1QU9A 3C8LA 2VXYA 3M4SA 4BT7A 1RQ7A 3AGKA 5MN4A 2RHOA 3EORA 3K12A 4G4XA 3U0OA
chains in the Genus database with same CATH topology
1U3PA 3F0DA 3IEWA 2AMTA 3ESJA 3B6NA 1VHAA 3F0GA 1IV4A 2GZLA 1T0AA 1U40A 4C81A 3QHDA 1IV2A 3Q8HA 1YQNA 4C8GA 1JN1A 1IV3A 1W55A 1KNJA 5B8FA 3T80A 1JY8A 1KNKA 3ERNA 3F6MA 3P0ZA 4C8EA 3FBAA 1U3LA 3ELCA 3KE1A 1W57A 3IEQA 3F0EA 3RE3A 3GHZA 1GX1A 1U43A 1H48A 3P10A 4C82A 2PMPA 3IKFA 4C8IA 1VH8A 1IV1A 3JVHA 3FPIA 3IKEA 3F0FA 3K2XA 1H47A 3EORA 3K14A 3MBMA 2UZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3P A;  3F0D A;  3IEW A;  2AMT A;  3ESJ A;  3B6N A;  1VHA A;  3F0G A;  1IV4 A;  2GZL A;  1T0A A;  1U40 A;  4C81 A;  3QHD A;  1IV2 A;  3Q8H A;  1YQN A;  4C8G A;  1JN1 A;  1IV3 A;  1W55 A;  1KNJ A;  5B8F A;  3T80 A;  1JY8 A;  1KNK A;  3ERN A;  3F6M A;  3P0Z A;  4C8E A;  3FBA A;  1U3L A;  3ELC A;  3KE1 A;  1W57 A;  3IEQ A;  3F0E A;  3RE3 A;  3GHZ A;  1GX1 A;  1U43 A;  1H48 A;  3P10 A;  4C82 A;  2PMP A;  3IKF A;  4C8I A;  1VH8 A;  1IV1 A;  3JVH A;  3FPI A;  3IKE A;  3F0F A;  3K2X A;  1H47 A;  3EOR A;  3K14 A;  3MBM A;  2UZH A; 
#chains in the Genus database with same CATH topology
 3PAF A;  2I6D A;  3CCS F;  5EIB C;  2AMT A;  3HKE A;  4X1I B;  1VQ4 F;  1VQO F;  2VAW A;  4NWO B;  2CVL A;  3MCQ A;  3CME F;  4ZOL A;  1NMU B;  3G4S F;  3LWQ C;  5EO3 A;  5CA1 A;  2GLZ A;  4B5C A;  3TD5 A;  1YHQ F;  1VQM F;  5LYJ A;  5DCV A;  2PMP A;  3WGK A;  4ZHQ A;  2AIF A;  2QEX F;  3RYI A;  3L7Q A;  3OON A;  1H47 A;  2DYY A;  1OAP A;  3HAX D;  5HXZ A;  3WJQ A;  3ZP4 A;  3HTN A;  4IHJ B;  1JJ2 F;  1VHA A;  4ZI7 A;  5BMV B;  5EWR A;  5G4V C;  2LCA A;  5GAP K;  4C8G A;  3KJJ A;  1R1M A;  5ITZ B;  3IR9 A;  5C8Y A;  4X3L A;  3ERN A;  1NQ3 A;  2UYN A;  3G6E F;  3JAR A;  3PLA C;  3V7E A;  3CCR F;  4PWT A;  4X1K A;  3RA5 A;  3UT5 A;  4BT4 A;  4E6E A;  2OZB A;  2CHS A;  3JAL A;  4XCQ A;  1FFX B;  2DT4 A;  2EWC A;  3VOA A;  4C82 A;  1RA4 A;  3MDO A;  3G71 F;  5JH7 A;  1IV1 A;  2P6Y A;  1J7H A;  3HJW C;  5IT9 M;  1E7K A;  3JAT A;  1FSZ A;  2UYP A;  2Z01 A;  3K14 A;  3WPX A;  5CB4 A;  1XV2 A;  4X20 B;  1JFF B;  1VQN F;  3RYH B;  4WBN A;  4FFB B;  4ZK7 A;  1RQ2 A;  2KTV A;  5JCO A;  2KG4 A;  5IJ9 A;  2RHL A;  3V3T A;  2F9Z C;  3FBA A;  3BYQ A;  4TUY B;  3ZO8 A;  2BO1 A;  1CK2 A;  1FNJ A;  4B45 A;  4ZHV A;  5EIB D;  4X1Y A;  3ZOP A;  3HKB B;  3V7Q A;  1K73 H;  1QVG F;  2UYJ A;  3VI6 A;  2HRU A;  3VOB A;  3K2X A;  4BT6 A;  3S0Y A;  2OTJ F;  3ON1 A;  4BVR A;  3I56 F;  3S03 A;  3JAW A;  3B6N A;  3F0G A;  1X25 A;  1ODE A;  5IYZ B;  3NK7 A;  2BTQ B;  4EI9 A;  4I55 B;  1Q7Y H;  2GVI A;  4U39 A;  5IJ0 B;  4F6R A;  5EYP A;  2Z1U A;  3F6M A;  4O4J B;  2LBX A;  3VYT C;  3QTY A;  3E22 A;  1GX1 A;  4HNA B;  2H8C A;  2ZOD A;  2VAM A;  2JNB A;  3R0P A;  3LFO A;  2R75 1;  3CC2 F;  1W42 A;  5EB1 B;  5LA6 B;  3RYC A;  3CD6 F;  1W41 A;  1M90 H;  5HP7 A;  3ESJ A;  3N4Y A;  4O2B B;  4ZHY B;  3S06 A;  4RQO A;  1M1K H;  3QHD A;  5LP6 C;  3WJP A;  3CCJ F;  3S0H A;  5EZY B;  1KNK A;  2HP0 A;  4BT3 A;  2L26 A;  3KE1 A;  4KWE A;  1U43 A;  4O4L B;  2OTL F;  2LBT A;  1SDS A;  3GTZ A;  1VQ6 F;  1W5A A;  1K8A H;  2CWJ A;  3F0F A;  5MN5 A;  3S0W A;  1NJI H;  3IEW A;  3LWO C;  1W5B A;  5HWE A;  3J81 M;  3ZP7 A;  3LWP C;  3JAS A;  2N48 A;  1IV4 A;  1YI2 F;  3DC2 A;  1PF5 A;  1SZQ A;  2WAL A;  5KMG A;  5LOV B;  3OW2 F;  4DRX A;  1U3L A;  1PXW A;  3NVK E;  4O4I A;  3N2K B;  1VQL F;  1VQV A;  1SA0 A;  1W5E A;  3FFM A;  5CA0 A;  1H48 A;  3CPW F;  2FC3 A;  1VQ7 F;  3NVI B;  3IKF A;  1JD1 A;  4I4T A;  4U3J B;  1ZWZ A;  2RB9 A;  3FD5 A;  4M8I A;  5J2U B;  4O4H B;  3HKD B;  3N2G B;  4YJ3 B;  4G4Y A;  1X52 A;  1FNK A;  2RHJ A;  5JVD A;  2H6L A;  1YJN F;  3I3F A;  1TVK B;  3C9T A;  5J2T A;  4I50 A;  4IIJ B;  1QVF F;  2HS4 A;  5KX5 A;  5FNV A;  5LP6 B;  3JAK A;  2HP3 A;  3VMF B;  2KGW A;  1TUB A;  4YJ2 B;  2IAF A;  3CMA F;  1XHO A;  1KD1 H;  4BY9 D;  5GIO C;  1GO1 A;  4X3M A;  2G9I A;  3RYF B;  3VTI C;  2Z1E A;  3SIV A;  3VYS C;  2Z1T A;  3WPW A;  4DXD A;  1Z5V A;  1VQ9 F;  1Q86 H;  4TV8 A;  3HKC A;  4G4W A;  4O2A B;  5FLX M;  1N8R H;  4BT5 A;  2GZL A;  5LXT A;  4C4W C;  1GZ0 A;  2KTU A;  5B8F A;  4LNU B;  3P0Z A;  2BTU A;  3QUW A;  3HKE B;  1W57 A;  2IG8 A;  5JQG A;  2PHN A;  4R40 B;  1VK3 A;  4ZOL B;  4G4Z A;  4BVT A;  1QD9 A;  3WGJ A;  3D54 A;  1VH8 A;  5FJ4 C;  5GIP C;  4NQ3 A;  5CA1 B;  1Q82 H;  5LYJ B;  5HY2 A;  1UFY A;  3Q8H A;  1YQN A;  3MCA B;  3RYI B;  1DBF A;  1YJ9 F;  2YYE A;  2HVY D;  2QA4 F;  2BTO A;  4ZI7 B;  3GHZ A;  3D01 A;  1ONI A;  4X1I A;  1KQS F;  5HY1 A;  3M1X A;  3JVH A;  5C8Y B;  2UYN B;  2HS3 A;  2ZVZ A;  5EB0 A;  4C8E A;  5GON B;  2ZF8 A;  2ZAU A;  5GIN C;  4X1K B;  3UT5 B;  3DDN A;  3JAL B;  3K0T A;  3LYB A;  3O85 A;  1QAH A;  1U40 A;  5JH7 B;  3V4D A;  3S02 A;  3JAT B;  4B46 A;  2HRY A;  1XBI A;  1K9M H;  3E1Y A;  3RA6 A;  3ELC A;  4O4H A;  3IEQ A;  4IHJ A;  4YJ3 A;  2K1S A;  1VQ8 F;  4WBN B;  5BMV A;  1VQP F;  1W5F A;  5EAZ A;  5IJ9 B;  3HWU A;  2NMU A;  4BW0 B;  1W59 A;  3TD3 A;  3MBM A;  1DT9 A;  5ITZ A;  3C9R A;  1CN7 A;  5HY0 A;  3GYQ A;  3CCE F;  1CLI A;  3M84 A;  3J7A R;  4X1Y B;  1Q81 H;  2HQS C;  1FFX A;  3IMP A;  5GAN K;  2ZOV A;  3VCZ A;  4BVQ A;  1YGY A;  3JAW B;  3WXM B;  1VQK F;  4O2A A;  4X20 A;  3MQW A;  4RHA A;  2LBW A;  3CXC F;  2B33 A;  1JFF A;  2VGM A;  1COM A;  3LDT A;  3RYH A;  1W2B F;  4FFB A;  3VIU A;  3I55 F;  2HX0 A;  4F6R B;  5EYP B;  3CCL F;  3F0D A;  2W8B C;  5AVM A;  3E22 B;  3WGN A;  3D00 A;  4TUY A;  5HY4 A;  3WJR A;  3CCU F;  1T0A A;  1Q8R A;  4ERH A;  3SIU A;  2CZW A;  3HKB A;  1YIT F;  1T0K B;  3CYQ A;  1W55 A;  1KNJ A;  1W40 A;  2QI2 A;  2OHW A;  3RYC B;  1S72 F;  5A2Q M;  4BT2 A;  3VYU C;  4EB6 B;  1RLG A;  2VAP A;  2OTM A;  4LNU A;  4C8I A;  5IYZ A;  3JCM M;  2RHH A;  4I55 A;  1X7O A;  3KIZ A;  2HP0 B;  4TV9 B;  2AIZ P;  5IJ0 A;  2UZH A;  1U3P A;  4O4J A;  4ZHW A;  1XRG A;  3CG6 A;  1OFU A;  2I6R A;  4HNA A;  3CPQ A;  3WGM A;  1IV2 A;  1IV3 A;  3CB2 A;  5GON A;  5G4U C;  4EI7 A;  3TD4 A;  5LA6 A;  1H7M A;  5JCO C;  3RE3 A;  3JAS B;  4O2B A;  3CC4 F;  2R6R 1;  3N4Z A;  1KC8 H;  3KHN A;  2Z1F A;  3E20 B;  5KMG B;  3CCV F;  4DRX B;  3VO8 A;  1RLU A;  4O4I B;  1IPA A;  5EZY A;  1SA0 B;  4NUT A;  5CA0 B;  3LWR C;  2FGY A;  4I4T B;  4O4L A;  3OBW A;  1UI9 A;  2CSL A;  2VGN A;  5MN6 A;  4ZHQ B;  1JY8 A;  2CW4 A;  2V9Y A;  2QTP A;  5HXU A;  1X7P A;  2MQE A;  3NMU C;  3P10 A;  5JVD B;  5HP8 A;  2IQQ A;  3LWV C;  3IKE A;  5J2T B;  3I7T A;  3NK6 A;  4I50 B;  5KX5 B;  5LOV A;  5FNV B;  3JAR B;  3C9U A;  3JAK B;  4BVS A;  3N2K A;  3CC7 F;  1VQ5 F;  4EI8 A;  3JAM M;  1TUB B;  2ZVY A;  3FD6 A;  2YXZ A;  3J80 M;  1JN1 A;  4G4V A;  3C9S A;  3CCM F;  2CHT A;  4U3J A;  4TV8 B;  5CB4 B;  3HKC B;  2HS0 A;  4G88 A;  3F0E A;  5J2U A;  1GO0 A;  3HKD A;  3N2G A;  5LXT B;  4LCK A;  1YIJ F;  3LME A;  2UYK A;  1YJW F;  3FPI A;  1W3E X;  1TVK A;  3WGL A;  4IIJ A;  3OBY A;  4EB6 A;  5JQG B;  1W58 1;  3CCQ F;  2Q1X A;  5LP6 A;  1Z5W A;  2ALE A;  4C81 A;  3CYP B;  4B62 A;  3KJK A;  4TZZ A;  4YJ2 A;  3T80 A;  3RYF A;  3P4E A;  4TV9 A;  2H8E A;  2Q1Y A;  1QU9 A;  3C8L A;  2VXY A;  3M4S A;  4BT7 A;  1RQ7 A;  3AGK A;  5MN4 A;  2RHO A;  3EOR A;  3K12 A;  4G4X A;  3U0O A; 
#chains in the Genus database with same CATH homology
 1U3P A;  3F0D A;  3IEW A;  2AMT A;  3ESJ A;  3B6N A;  1VHA A;  3F0G A;  1IV4 A;  2GZL A;  1T0A A;  1U40 A;  4C81 A;  3QHD A;  1IV2 A;  3Q8H A;  1YQN A;  4C8G A;  1JN1 A;  1IV3 A;  1W55 A;  1KNJ A;  5B8F A;  3T80 A;  1JY8 A;  1KNK A;  3ERN A;  3F6M A;  3P0Z A;  4C8E A;  3FBA A;  1U3L A;  3ELC A;  3KE1 A;  1W57 A;  3IEQ A;  3F0E A;  3RE3 A;  3GHZ A;  1GX1 A;  1U43 A;  1H48 A;  3P10 A;  4C82 A;  2PMP A;  3IKF A;  4C8I A;  1VH8 A;  1IV1 A;  3JVH A;  3FPI A;  3IKE A;  3F0F A;  3K2X A;  1H47 A;  3EOR A;  3K14 A;  3MBM A;  2UZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...