1N8RH

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome/antibiotic
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1n8rH00
2LBWA 3CMAF 3CD6F 2JNBA 3J81M 5GIPC 1VQKF 1W40A 1RLGA 3E20B 1QVFF 3GYQA 3I55F 1X7PA 1RA4A 3I56F 4LCKA 1PXWA 3IR9A 1M90H 1Q82H 2OHWA 1YJNF 1X7OA 3N4ZA 1W3EX 3NVKE 3OW2F 1Q7YH 1VQ5F 1VQ4F 4X3LA 1GO1A 3NVIB 3CCVF 2VGNA 1NMUB 1VQLF 3LWVC 5G4VC 1Q86H 1K73H 2BO1A 3RA6A 5G4UC 1M1KH 1KQSF 3FFMA 2QEXF 1GO0A 3CCJF 1S72F 1K8AH 3NK7A 3PAFA 3CPQA 1DT9A 1VQ7F 5FLXM 2OTLF 1KC8H 5IT9M 1W41A 1VQ6F 5DCVA 3OBYA 5FJ4C 3NMUC 3LWRC 1K9MH 3CCRF 3SIUA 3V7QA 3CCUF 3CC7F 2FC3A 1VQOF 3V7EA 2OTJF 3G71F 3LWQC 4NUTA 4BW0B 4X3MA 1SDSA 2LBXA 4C4WC 5GAPK 1E7KA 1YHQF 1QVGF 3G4SF 2ALEA 3OBWA 2KTUA 3LFOA 3LWOC 1VQNF 1YITF 2QI2A 1VQ8F 3SIVA 4BY9D 2HVYD 1VQ9F 1Q81H 3CCEF 3NK6A 3CXCF 1VQPF 3CMEF 3G6EF 3CC4F 1W42A 5GINC 2KTVA 1CN7A 3JAMM 3CCLF 3LWPC 3ON1A 3N4YA 1YJ9F 3HAXD 5A2QM 3JCMM 3PLAC 1W2BF 1NJIH 4TZZA 2AIFA 2WALA 1YJWF 1N8RH 2VGMA 5EO3A 3J80M 3AGKA 3WXMB 1GZ0A 1JJ2F 3E1YA 1X52A 2QA4F 1CK2A 1T0KB 1YI2F 1H7MA 1XBIA 3CG6A 3CCMF 1KD1H 2OZBA 2CZWA 1ZWZA 1IPAA 3CCSF 3VI6A 1YIJF 2KG4A 2I6DA 5GIOC 5GANK 3O85A 3J7AR 5EWRA 3CC2F 3CPWF 1VQMF 3RA5A 3VMFB 3HJWC 3MCAB 3CCQF
chains in the Genus database with same CATH superfamily
4ZOLA 1JN1A 4G4ZA 4EI8A 1IV3A 4YJ3A 1VQKF 5KX5A 3WPWA 2N48A 4WBNA 1Z5WA 3I55F 1DBFA 5B8FA 5CA0A 3IR9A 4BT4A 2Z1TA 3S0WA 3UT5B 3VYSC 4NQ3A 1IV2A 3L7QA 3N4ZA 1W3EX 3S0YA 2ZF8A 3MCQA 3OW2F 3I7TA 5LA6B 4ZHQA 4I50B 3CCVF 2VGNA 4ZHYB 4M8IA 3LWVC 3EORA 3RA6A 5G4UC 2HX0A 1FFXB 4X20A 3GTZA 3E22A 4O2BA 5EB0A 5KMGA 5J2UB 5CA0B 3QHDA 3FD6A 3VYTC 4BVSA 5J2TB 1W41A 3K12A 3VYUC 4B46A 4X1YB 3OBYA 2HRYA 1K9MH 1QD9A 1W59A 2IG8A 4F6RA 2CVLA 1H47A 4X1IB 5FNVB 1CLIA 4U39A 5AVMA 2BTQB 3HTNA 1VQOF 1W55A 3V7EA 1W5FA 3IEQA 3V4DA 1SZQA 2Q1YA 4NUTA 4BW0B 3DC2A 3LDTA 4ZK7A 3ZP7A 3ESJA 5GAPK 1XV2A 2VAPA 3N2GA 5KX5B 4ERHA 3LFOA 1VK3A 1YITF 2QI2A 2F9ZC 5ITZA 2VXYA 4HNAB 2HS0A 5HY1A 4HNAA 3UT5A 5MN4A 5J2UA 5IYZB 3G6EF 4B62A 3C9RA 2CW4A 5GINC 2IQQA 3ON1A 3N4YA 4XCQA 2PHNA 5A2QM 5LYJB 3JCMM 4ZHQB 1NJIH 3JALA 1U43A 4IHJB 3J80M 1W5BA 3E1YA 4EB6B 3ZO8A 3VCZA 1U40A 3RE3A 1T0KB 1FFXA 4ZHVA 2L26A 1H7MA 4X1KB 2LBTA 3M4SA 3CG6A 3WGLA 3JARA 2OZBA 2CZWA 3HKEB 4YJ2B 5JCOC 1UFYA 2PMPA 3QTYA 2I6DA 3M84A 4X1IA 3S0HA 2VAWA 5LA6A 3HKCB 3VMFB 3GHZA 3HJWC 4O4HB 3V3TA 4G4WA 1OFUA 1JY8A 2G9IA 4TV8B 2LBWA 3CMAF 2YYEA 3S03A 3HKBB 5EYPA 4C8EA 5GIPC 1RLGA 2RHLA 2KGWA 3E20B 3FD5A 2Z01A 4IIJB 1QVFF 3P0ZA 5BMVA 2R751 3RYFB 4EI7A 3C9TA 3IKEA 5EIBD 5IYZA 4BVTA 4G4XA 1SA0A 1UI9A 1Q8RA 2OHWA 1YJNF 3KJJA 1JFFB 5MN5A 1YGYA 5CA1B 5LOVA 4FFBA 3D54A 3JASA 4I55A 5FNVA 1VQ5F 2UYNA 1VQ4F 2DT4A 2P6YA 3WJQA 3C8LA 1U3PA 1VQLF 1X25A 5G4VC 3LMEA 1Q86H 5HY0A 1K73H 5CB4A 5EB1B 3B6NA 3D00A 5HXZA 2CWJA 3HWUA 5JH7B 2QEXF 1GO0A 1S72F 3K14A 3NK7A 4YJ2A 3WGMA 4O2BB 1DT9A 3JARB 2OTLF 5FLXM 1KNKA 1JFFA 4RQOA 3CCUF 1TUBB 4O4JB 3Q8HA 1FNKA 5CA1A 5LOVB 2OTJF 4O4HA 2GZLA 3RYIA 3LWQC 4X3MA 1FNJA 3G71F 1SDSA 4I50A 4C4WC 1YHQF 2NMUA 3OBWA 2Z1EA 3LWOC 3WJRA 4O4LB 1VQ8F 3KJKA 2HVYD 2HQSC 3N2KB 3CCEF 3F0DA 4O4LA 2ZODA 3CXCF 3MBMA 1VQPF 4LNUA 3ERNA 1H48A 2OTMA 3WGJA 3CCLF 2R6R1 4E6EA 4ZI7B 3C9UA 5EIBC 1YJ9F 1TUBA 4ZI7A 3PLAC 2AIFA 2HS3A 2WALA 1YJWF 3P4EA 5EO3A 4C82A 1NQ3A 1JJ2F 4C8GA 1PF5A 1GX1A 1W5AA 3HKBA 5EYPB 3OONA 3JAKB 1YI2F 3DDNA 4DRXB 2LCAA 5BMVB 3ELCA 2HP0B 1XHOA 4O2AA 3T80A 4C8IA 4BT5A 1J7HA 2DYYA 4BVQA 3IEWA 4U3JB 1VH8A 2GLZA 3F6MA 3O85A 5EAZA 3J7AR 3CPWF 1VQMF 3JASB 3K0TA 4FFBB 1W5EA 5HP8A 2BTOA 3CD6F 1W40A 5GONB 3GYQA 3MDOA 1X7PA 3I56F 5IJ9A 4LCKA 2V9YA 4TV9A 1PXWA 1TVKA 4LNUB 1W581 1M90H 1Q82H 3R0PA 3FBAA 4X1YA 4PWTA 3HKCA 2W8BC 1RLUA 3P10A 4X3LA 5C8YA 1GO1A 3NVIB 2I6RA 1OAPA 3RYIB 1NMUB 4B45A 3ZOPA 3CYQA 2BO1A 3C9SA 3CCJF 4TV9B 3KIZA 3F0EA 1KC8H 5IT9M 3CYPB 3S06A 5FJ4C 3NMUC 3HKDA 1ODEA 4F6RB 5LYJA 3JAWA 2AIZP 2H8EA 4I4TA 4BT7A 1QAHA 5HWEA 4G4VA 2LBXA 1QVGF 3G4SF 2ALEA 5C8YB 4X20B 1IV1A 3KHNA 1VQNF 5LP6C 3F0GA 4ZOLB 2K1SA 1VQ9F 1Q81H 4EB6A 3LYBA 2HP0A 1U3LA 3NK6A 3KE1A 3CMEF 4RHAA 1W42A 1TVKB 2RHJA 4G4YA 1CN7A 2HRUA 3JAMM 2MQEA 3FPIA 3VOBA 2GVIA 1W2BF 3HKDB 4TZZA 1ONIA 4KWEA 4O4IA 5EZYB 1N8RH 2VGMA 3WXMB 5HY2A 1GZ0A 1RQ7A 5GONA 2Z1UA 5ITZB 1YQNA 4X1KA 3RYCB 5JCOA 3RYHA 3CCMF 3JVHA 3VTIC 4O2AB 3CCSF 3JATB 1YIJF 2EWCA 3ZP4A 3TD5A 5EWRA 3CC2F 3RA5A 5MN6A 3MCAB 3CCQF 2HP3A 2ZOVA 2IAFA 5EZYA 2UZHA 2JNBA 2ZVZA 3J81M 2RHOA 3E22B 3VO8A 4BT2A 5IJ9B 4TUYA 4BT3A 5LP6B 1RA4A 2RB9A 3RYFA 1W57A 2Z1FA 2RHHA 1X7OA 3NVKE 5HXUA 1VQVA 2H6LA 3MQWA 3VOAA 2B33A 3WPXA 5JVDB 3U0OA 4I4TB 4EI9A 5JQGA 3F0FA 3S02A 1Q7YH 3JAWB 2YXZA 5IJ0B 3TD4A 4TV8A 2UYPA 2QTPA 1IV4A 2VAMA 4DRXA 4WBNB 4C81A 1M1KH 1KQSF 3FFMA 2CHTA 3VIUA 5KMGB 1K8AH 3PAFA 3CPQA 2ZVYA 4TUYB 5LP6A 5J2TA 1VQ7F 1VQ6F 5DCVA 3LWRC 1JD1A 4R40B 3CCRF 3SIUA 3CB2A 3V7QA 3CC7F 4B5CA 5LXTB 2FC3A 2UYKA 4IHJA 4O4IB 5IJ0A 3K2XA 3I3FA 1E7KA 1QU9A 3N2GB 2KTUA 3WGKA 3IMPA 3JAKA 1VHAA 3N2KA 4BY9D 3SIVA 4IIJA 3WGNA 4NWOB 2BTUA 2HS4A 3TD3A 2ZAUA 3RYHB 3CC4F 3RYCA 2KTVA 3IKFA 5HY4A 3WJPA 3LWPC 3M1XA 1XRGA 3HAXD 1SA0B 1RQ2A 2UYNB 4O4JA 5JQGB 3D01A 2H8CA 5LXTA 2Q1XA 3BYQA 4BVRA 3AGKA 2CHSA 4ZHWA 4G88A 1X52A 2QA4F 1CK2A 2CSLA 5JH7A 5CB4B 1Z5VA 4DXDA 1XBIA 1KD1H 1ZWZA 1IPAA 3JATA 2FGYA 3HKEA 3VI6A 1T0AA 5HP7A 2KG4A 1R1MA 5JVDA 5GIOC 4U3JA 3JALB 5GANK 1FSZA 1KNJA 2UYJA 1COMA 4I55B 4BT6A 2AMTA 3QUWA 4YJ3B
chains in the Genus database with same CATH topology
2LBWA 4EI8A 3CMAF 3CD6F 2JNBA 3J81M 5GIPC 1VQKF 1W40A 1RLGA 3E20B 1QVFF 3GYQA 3I55F 1X7PA 1RA4A 3I56F 4EI7A 4LCKA 1PXWA 3IR9A 4BVTA 1M90H 1Q82H 2OHWA 1YJNF 4NQ3A 1X7OA 3N4ZA 1W3EX 3NVKE 5HXUA 3OW2F 4EI9A 1Q7YH 1VQ5F 1VQ4F 4X3LA 1GO1A 3NVIB 3CCVF 2VGNA 1NMUB 1VQLF 3LWVC 5G4VC 1Q86H 5HY0A 1K73H 2BO1A 3RA6A 5HXZA 5G4UC 3D00A 1M1KH 1KQSF 3FFMA 2QEXF 1GO0A 3CCJF 1S72F 1K8AH 3NK7A 3PAFA 3CPQA 1DT9A 4BVSA 1VQ7F 5FLXM 2OTLF 1KC8H 5IT9M 1W41A 1VQ6F 5DCVA 3OBYA 5FJ4C 3NMUC 3LWRC 1K9MH 3CCRF 3SIUA 3V7QA 3CCUF 3CC7F 2FC3A 1VQOF 3V7EA 2OTJF 5HWEA 4NUTA 4BW0B 3LWQC 4X3MA 3G71F 2LBXA 1SDSA 4C4WC 5GAPK 1E7KA 1YHQF 1QVGF 3G4SF 2ALEA 3OBWA 2KTUA 3LFOA 3LWOC 1VQNF 1YITF 2QI2A 1VQ8F 3SIVA 2F9ZC 4BY9D 2HVYD 1VQ9F 1Q81H 3CCEF 5HY1A 3NK6A 3CXCF 1VQPF 3CMEF 3G6EF 3CC4F 1W42A 5GINC 2KTVA 1CN7A 5HY4A 3JAMM 3CCLF 3LWPC 3ON1A 3N4YA 1YJ9F 3HAXD 4XCQA 5A2QM 3JCMM 3PLAC 1W2BF 1NJIH 4TZZA 2AIFA 2WALA 1YJWF 1N8RH 2VGMA 5EO3A 4BVRA 3J80M 3AGKA 3WXMB 5HY2A 1GZ0A 1JJ2F 3E1YA 1X52A 2QA4F 1CK2A 1T0KB 1YI2F 1H7MA 1XBIA 3CG6A 3CCMF 1KD1H 2OZBA 2CZWA 1ZWZA 1IPAA 3CCSF 2FGYA 3VI6A 1YIJF 2KG4A 4BVQA 2I6DA 5GIOC 2GLZA 3O85A 5GANK 3J7AR 5EWRA 3CC2F 3CPWF 1VQMF 3RA5A 3VMFB 3HJWC 3V3TA 3MCAB 3CCQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBW A;  3CMA F;  3CD6 F;  2JNB A;  3J81 M;  5GIP C;  1VQK F;  1W40 A;  1RLG A;  3E20 B;  1QVF F;  3GYQ A;  3I55 F;  1X7P A;  1RA4 A;  3I56 F;  4LCK A;  1PXW A;  3IR9 A;  1M90 H;  1Q82 H;  2OHW A;  1YJN F;  1X7O A;  3N4Z A;  1W3E X;  3NVK E;  3OW2 F;  1Q7Y H;  1VQ5 F;  1VQ4 F;  4X3L A;  1GO1 A;  3NVI B;  3CCV F;  2VGN A;  1NMU B;  1VQL F;  3LWV C;  5G4V C;  1Q86 H;  1K73 H;  2BO1 A;  3RA6 A;  5G4U C;  1M1K H;  1KQS F;  3FFM A;  2QEX F;  1GO0 A;  3CCJ F;  1S72 F;  1K8A H;  3NK7 A;  3PAF A;  3CPQ A;  1DT9 A;  1VQ7 F;  5FLX M;  2OTL F;  1KC8 H;  5IT9 M;  1W41 A;  1VQ6 F;  5DCV A;  3OBY A;  5FJ4 C;  3NMU C;  3LWR C;  1K9M H;  3CCR F;  3SIU A;  3V7Q A;  3CCU F;  3CC7 F;  2FC3 A;  1VQO F;  3V7E A;  2OTJ F;  3G71 F;  3LWQ C;  4NUT A;  4BW0 B;  4X3M A;  1SDS A;  2LBX A;  4C4W C;  5GAP K;  1E7K A;  1YHQ F;  1QVG F;  3G4S F;  2ALE A;  3OBW A;  2KTU A;  3LFO A;  3LWO C;  1VQN F;  1YIT F;  2QI2 A;  1VQ8 F;  3SIV A;  4BY9 D;  2HVY D;  1VQ9 F;  1Q81 H;  3CCE F;  3NK6 A;  3CXC F;  1VQP F;  3CME F;  3G6E F;  3CC4 F;  1W42 A;  5GIN C;  2KTV A;  1CN7 A;  3JAM M;  3CCL F;  3LWP C;  3ON1 A;  3N4Y A;  1YJ9 F;  3HAX D;  5A2Q M;  3JCM M;  3PLA C;  1W2B F;  1NJI H;  4TZZ A;  2AIF A;  2WAL A;  1YJW F;  1N8R H;  2VGM A;  5EO3 A;  3J80 M;  3AGK A;  3WXM B;  1GZ0 A;  1JJ2 F;  3E1Y A;  1X52 A;  2QA4 F;  1CK2 A;  1T0K B;  1YI2 F;  1H7M A;  1XBI A;  3CG6 A;  3CCM F;  1KD1 H;  2OZB A;  2CZW A;  1ZWZ A;  1IPA A;  3CCS F;  3VI6 A;  1YIJ F;  2KG4 A;  2I6D A;  5GIO C;  5GAN K;  3O85 A;  3J7A R;  5EWR A;  3CC2 F;  3CPW F;  1VQM F;  3RA5 A;  3VMF B;  3HJW C;  3MCA B;  3CCQ F; 
#chains in the Genus database with same CATH topology
 4ZOL A;  1JN1 A;  4G4Z A;  4EI8 A;  1IV3 A;  4YJ3 A;  1VQK F;  5KX5 A;  3WPW A;  2N48 A;  4WBN A;  1Z5W A;  3I55 F;  1DBF A;  5B8F A;  5CA0 A;  3IR9 A;  4BT4 A;  2Z1T A;  3S0W A;  3UT5 B;  3VYS C;  4NQ3 A;  1IV2 A;  3L7Q A;  3N4Z A;  1W3E X;  3S0Y A;  2ZF8 A;  3MCQ A;  3OW2 F;  3I7T A;  5LA6 B;  4ZHQ A;  4I50 B;  3CCV F;  2VGN A;  4ZHY B;  4M8I A;  3LWV C;  3EOR A;  3RA6 A;  5G4U C;  2HX0 A;  1FFX B;  4X20 A;  3GTZ A;  3E22 A;  4O2B A;  5EB0 A;  5KMG A;  5J2U B;  5CA0 B;  3QHD A;  3FD6 A;  3VYT C;  4BVS A;  5J2T B;  1W41 A;  3K12 A;  3VYU C;  4B46 A;  4X1Y B;  3OBY A;  2HRY A;  1K9M H;  1QD9 A;  1W59 A;  2IG8 A;  4F6R A;  2CVL A;  1H47 A;  4X1I B;  5FNV B;  1CLI A;  4U39 A;  5AVM A;  2BTQ B;  3HTN A;  1VQO F;  1W55 A;  3V7E A;  1W5F A;  3IEQ A;  3V4D A;  1SZQ A;  2Q1Y A;  4NUT A;  4BW0 B;  3DC2 A;  3LDT A;  4ZK7 A;  3ZP7 A;  3ESJ A;  5GAP K;  1XV2 A;  2VAP A;  3N2G A;  5KX5 B;  4ERH A;  3LFO A;  1VK3 A;  1YIT F;  2QI2 A;  2F9Z C;  5ITZ A;  2VXY A;  4HNA B;  2HS0 A;  5HY1 A;  4HNA A;  3UT5 A;  5MN4 A;  5J2U A;  5IYZ B;  3G6E F;  4B62 A;  3C9R A;  2CW4 A;  5GIN C;  2IQQ A;  3ON1 A;  3N4Y A;  4XCQ A;  2PHN A;  5A2Q M;  5LYJ B;  3JCM M;  4ZHQ B;  1NJI H;  3JAL A;  1U43 A;  4IHJ B;  3J80 M;  1W5B A;  3E1Y A;  4EB6 B;  3ZO8 A;  3VCZ A;  1U40 A;  3RE3 A;  1T0K B;  1FFX A;  4ZHV A;  2L26 A;  1H7M A;  4X1K B;  2LBT A;  3M4S A;  3CG6 A;  3WGL A;  3JAR A;  2OZB A;  2CZW A;  3HKE B;  4YJ2 B;  5JCO C;  1UFY A;  2PMP A;  3QTY A;  2I6D A;  3M84 A;  4X1I A;  3S0H A;  2VAW A;  5LA6 A;  3HKC B;  3VMF B;  3GHZ A;  3HJW C;  4O4H B;  3V3T A;  4G4W A;  1OFU A;  1JY8 A;  2G9I A;  4TV8 B;  2LBW A;  3CMA F;  2YYE A;  3S03 A;  3HKB B;  5EYP A;  4C8E A;  5GIP C;  1RLG A;  2RHL A;  2KGW A;  3E20 B;  3FD5 A;  2Z01 A;  4IIJ B;  1QVF F;  3P0Z A;  5BMV A;  2R75 1;  3RYF B;  4EI7 A;  3C9T A;  3IKE A;  5EIB D;  5IYZ A;  4BVT A;  4G4X A;  1SA0 A;  1UI9 A;  1Q8R A;  2OHW A;  1YJN F;  3KJJ A;  1JFF B;  5MN5 A;  1YGY A;  5CA1 B;  5LOV A;  4FFB A;  3D54 A;  3JAS A;  4I55 A;  5FNV A;  1VQ5 F;  2UYN A;  1VQ4 F;  2DT4 A;  2P6Y A;  3WJQ A;  3C8L A;  1U3P A;  1VQL F;  1X25 A;  5G4V C;  3LME A;  1Q86 H;  5HY0 A;  1K73 H;  5CB4 A;  5EB1 B;  3B6N A;  3D00 A;  5HXZ A;  2CWJ A;  3HWU A;  5JH7 B;  2QEX F;  1GO0 A;  1S72 F;  3K14 A;  3NK7 A;  4YJ2 A;  3WGM A;  4O2B B;  1DT9 A;  3JAR B;  2OTL F;  5FLX M;  1KNK A;  1JFF A;  4RQO A;  3CCU F;  1TUB B;  4O4J B;  3Q8H A;  1FNK A;  5CA1 A;  5LOV B;  2OTJ F;  4O4H A;  2GZL A;  3RYI A;  3LWQ C;  4X3M A;  1FNJ A;  3G71 F;  1SDS A;  4I50 A;  4C4W C;  1YHQ F;  2NMU A;  3OBW A;  2Z1E A;  3LWO C;  3WJR A;  4O4L B;  1VQ8 F;  3KJK A;  2HVY D;  2HQS C;  3N2K B;  3CCE F;  3F0D A;  4O4L A;  2ZOD A;  3CXC F;  3MBM A;  1VQP F;  4LNU A;  3ERN A;  1H48 A;  2OTM A;  3WGJ A;  3CCL F;  2R6R 1;  4E6E A;  4ZI7 B;  3C9U A;  5EIB C;  1YJ9 F;  1TUB A;  4ZI7 A;  3PLA C;  2AIF A;  2HS3 A;  2WAL A;  1YJW F;  3P4E A;  5EO3 A;  4C82 A;  1NQ3 A;  1JJ2 F;  4C8G A;  1PF5 A;  1GX1 A;  1W5A A;  3HKB A;  5EYP B;  3OON A;  3JAK B;  1YI2 F;  3DDN A;  4DRX B;  2LCA A;  5BMV B;  3ELC A;  2HP0 B;  1XHO A;  4O2A A;  3T80 A;  4C8I A;  4BT5 A;  1J7H A;  2DYY A;  4BVQ A;  3IEW A;  4U3J B;  1VH8 A;  2GLZ A;  3F6M A;  3O85 A;  5EAZ A;  3J7A R;  3CPW F;  1VQM F;  3JAS B;  3K0T A;  4FFB B;  1W5E A;  5HP8 A;  2BTO A;  3CD6 F;  1W40 A;  5GON B;  3GYQ A;  3MDO A;  1X7P A;  3I56 F;  5IJ9 A;  4LCK A;  2V9Y A;  4TV9 A;  1PXW A;  1TVK A;  4LNU B;  1W58 1;  1M90 H;  1Q82 H;  3R0P A;  3FBA A;  4X1Y A;  4PWT A;  3HKC A;  2W8B C;  1RLU A;  3P10 A;  4X3L A;  5C8Y A;  1GO1 A;  3NVI B;  2I6R A;  1OAP A;  3RYI B;  1NMU B;  4B45 A;  3ZOP A;  3CYQ A;  2BO1 A;  3C9S A;  3CCJ F;  4TV9 B;  3KIZ A;  3F0E A;  1KC8 H;  5IT9 M;  3CYP B;  3S06 A;  5FJ4 C;  3NMU C;  3HKD A;  1ODE A;  4F6R B;  5LYJ A;  3JAW A;  2AIZ P;  2H8E A;  4I4T A;  4BT7 A;  1QAH A;  5HWE A;  4G4V A;  2LBX A;  1QVG F;  3G4S F;  2ALE A;  5C8Y B;  4X20 B;  1IV1 A;  3KHN A;  1VQN F;  5LP6 C;  3F0G A;  4ZOL B;  2K1S A;  1VQ9 F;  1Q81 H;  4EB6 A;  3LYB A;  2HP0 A;  1U3L A;  3NK6 A;  3KE1 A;  3CME F;  4RHA A;  1W42 A;  1TVK B;  2RHJ A;  4G4Y A;  1CN7 A;  2HRU A;  3JAM M;  2MQE A;  3FPI A;  3VOB A;  2GVI A;  1W2B F;  3HKD B;  4TZZ A;  1ONI A;  4KWE A;  4O4I A;  5EZY B;  1N8R H;  2VGM A;  3WXM B;  5HY2 A;  1GZ0 A;  1RQ7 A;  5GON A;  2Z1U A;  5ITZ B;  1YQN A;  4X1K A;  3RYC B;  5JCO A;  3RYH A;  3CCM F;  3JVH A;  3VTI C;  4O2A B;  3CCS F;  3JAT B;  1YIJ F;  2EWC A;  3ZP4 A;  3TD5 A;  5EWR A;  3CC2 F;  3RA5 A;  5MN6 A;  3MCA B;  3CCQ F;  2HP3 A;  2ZOV A;  2IAF A;  5EZY A;  2UZH A;  2JNB A;  2ZVZ A;  3J81 M;  2RHO A;  3E22 B;  3VO8 A;  4BT2 A;  5IJ9 B;  4TUY A;  4BT3 A;  5LP6 B;  1RA4 A;  2RB9 A;  3RYF A;  1W57 A;  2Z1F A;  2RHH A;  1X7O A;  3NVK E;  5HXU A;  1VQV A;  2H6L A;  3MQW A;  3VOA A;  2B33 A;  3WPX A;  5JVD B;  3U0O A;  4I4T B;  4EI9 A;  5JQG A;  3F0F A;  3S02 A;  1Q7Y H;  3JAW B;  2YXZ A;  5IJ0 B;  3TD4 A;  4TV8 A;  2UYP A;  2QTP A;  1IV4 A;  2VAM A;  4DRX A;  4WBN B;  4C81 A;  1M1K H;  1KQS F;  3FFM A;  2CHT A;  3VIU A;  5KMG B;  1K8A H;  3PAF A;  3CPQ A;  2ZVY A;  4TUY B;  5LP6 A;  5J2T A;  1VQ7 F;  1VQ6 F;  5DCV A;  3LWR C;  1JD1 A;  4R40 B;  3CCR F;  3SIU A;  3CB2 A;  3V7Q A;  3CC7 F;  4B5C A;  5LXT B;  2FC3 A;  2UYK A;  4IHJ A;  4O4I B;  5IJ0 A;  3K2X A;  3I3F A;  1E7K A;  1QU9 A;  3N2G B;  2KTU A;  3WGK A;  3IMP A;  3JAK A;  1VHA A;  3N2K A;  4BY9 D;  3SIV A;  4IIJ A;  3WGN A;  4NWO B;  2BTU A;  2HS4 A;  3TD3 A;  2ZAU A;  3RYH B;  3CC4 F;  3RYC A;  2KTV A;  3IKF A;  5HY4 A;  3WJP A;  3LWP C;  3M1X A;  1XRG A;  3HAX D;  1SA0 B;  1RQ2 A;  2UYN B;  4O4J A;  5JQG B;  3D01 A;  2H8C A;  5LXT A;  2Q1X A;  3BYQ A;  4BVR A;  3AGK A;  2CHS A;  4ZHW A;  4G88 A;  1X52 A;  2QA4 F;  1CK2 A;  2CSL A;  5JH7 A;  5CB4 B;  1Z5V A;  4DXD A;  1XBI A;  1KD1 H;  1ZWZ A;  1IPA A;  3JAT A;  2FGY A;  3HKE A;  3VI6 A;  1T0A A;  5HP7 A;  2KG4 A;  1R1M A;  5JVD A;  5GIO C;  4U3J A;  3JAL B;  5GAN K;  1FSZ A;  1KNJ A;  2UYJ A;  1COM A;  4I55 B;  4BT6 A;  2AMT A;  3QUW A;  4YJ3 B; 
#chains in the Genus database with same CATH homology
 2LBW A;  4EI8 A;  3CMA F;  3CD6 F;  2JNB A;  3J81 M;  5GIP C;  1VQK F;  1W40 A;  1RLG A;  3E20 B;  1QVF F;  3GYQ A;  3I55 F;  1X7P A;  1RA4 A;  3I56 F;  4EI7 A;  4LCK A;  1PXW A;  3IR9 A;  4BVT A;  1M90 H;  1Q82 H;  2OHW A;  1YJN F;  4NQ3 A;  1X7O A;  3N4Z A;  1W3E X;  3NVK E;  5HXU A;  3OW2 F;  4EI9 A;  1Q7Y H;  1VQ5 F;  1VQ4 F;  4X3L A;  1GO1 A;  3NVI B;  3CCV F;  2VGN A;  1NMU B;  1VQL F;  3LWV C;  5G4V C;  1Q86 H;  5HY0 A;  1K73 H;  2BO1 A;  3RA6 A;  5HXZ A;  5G4U C;  3D00 A;  1M1K H;  1KQS F;  3FFM A;  2QEX F;  1GO0 A;  3CCJ F;  1S72 F;  1K8A H;  3NK7 A;  3PAF A;  3CPQ A;  1DT9 A;  4BVS A;  1VQ7 F;  5FLX M;  2OTL F;  1KC8 H;  5IT9 M;  1W41 A;  1VQ6 F;  5DCV A;  3OBY A;  5FJ4 C;  3NMU C;  3LWR C;  1K9M H;  3CCR F;  3SIU A;  3V7Q A;  3CCU F;  3CC7 F;  2FC3 A;  1VQO F;  3V7E A;  2OTJ F;  5HWE A;  4NUT A;  4BW0 B;  3LWQ C;  4X3M A;  3G71 F;  2LBX A;  1SDS A;  4C4W C;  5GAP K;  1E7K A;  1YHQ F;  1QVG F;  3G4S F;  2ALE A;  3OBW A;  2KTU A;  3LFO A;  3LWO C;  1VQN F;  1YIT F;  2QI2 A;  1VQ8 F;  3SIV A;  2F9Z C;  4BY9 D;  2HVY D;  1VQ9 F;  1Q81 H;  3CCE F;  5HY1 A;  3NK6 A;  3CXC F;  1VQP F;  3CME F;  3G6E F;  3CC4 F;  1W42 A;  5GIN C;  2KTV A;  1CN7 A;  5HY4 A;  3JAM M;  3CCL F;  3LWP C;  3ON1 A;  3N4Y A;  1YJ9 F;  3HAX D;  4XCQ A;  5A2Q M;  3JCM M;  3PLA C;  1W2B F;  1NJI H;  4TZZ A;  2AIF A;  2WAL A;  1YJW F;  1N8R H;  2VGM A;  5EO3 A;  4BVR A;  3J80 M;  3AGK A;  3WXM B;  5HY2 A;  1GZ0 A;  1JJ2 F;  3E1Y A;  1X52 A;  2QA4 F;  1CK2 A;  1T0K B;  1YI2 F;  1H7M A;  1XBI A;  3CG6 A;  3CCM F;  1KD1 H;  2OZB A;  2CZW A;  1ZWZ A;  1IPA A;  3CCS F;  2FGY A;  3VI6 A;  1YIJ F;  2KG4 A;  4BVQ A;  2I6D A;  5GIO C;  2GLZ A;  3O85 A;  5GAN K;  3J7A R;  5EWR A;  3CC2 F;  3CPW F;  1VQM F;  3RA5 A;  3VMF B;  3HJW C;  3V3T A;  3MCA B;  3CCQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...