5LYJB

Tubulin-combretastatin a4 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cis- and trans-combretastatin binding to tubulin
doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lyjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lyjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lyjB01
4LNUB 3UT5A 2Q1XA 3VOAA 4IHJA 4IIJA 3UT5B 4O4IA 5M7EA 5LA6B 4IIJB 1TUBB 2XKBA 4ZHQB 3RYCA 4WBNB 5EYPA 1TUBA 5J2UA 2RHJA 3RYCB 3HKCB 4KWEA 4O4LA 5BMVB 4O2AB 3HKDA 4F6RB 4IHJB 4O4LB 5BMVA 5JQGB 4F6RA 1W5EA 4YJ3A 2R751 3VO8A 1FFXB 4FFBB 4ZHQA 3WGNA 5EIBD 5CA0A 3VPAA 3HKBB 3JAKA 5EYPB 3RYIB 2R6R1 3JALA 4B46A 2VAMA 1FFXA 4FFBA 3ZIDA 1SA0B 5ITZA 5JCOA 4X20B 3E22B 3WGMA 5LP6A 5CA0B 5IYZB 3E22A 1FSZA 3JAWB 3V3TA 4HNAA 5KX5A 4TV8A 3VO9A 5KMGA 5CA1B 4E6EA 3N2KB 3N2GB 4O4HA 2XKAA 5MN6A 4ZOLB 3WGLA 4I4TA 3HKEB 4I55B 4X1IB 5GONB 5C8YA 4TUYA 1JFFA 5LP6C 2Q1YA 5FNVB 4O2BA 4O4JA 2VAWA 5LYJA 3C8LA 5JVDB 5LYJB 2BTQB 5JCOC 4X1YA 4ZI7A 4TUYB 4M8IA 5LA6A 3CB2A 4O4IB 1RQ2A 5IJ9B 3JARA 5JVDA 1Z5VA 5JH7B 5IJ9A 1W5AA 2RHOA 4I50B 2RHHA 5LOVB 3M8KA 1W5FA 5EZYA 4EB6B 5LOVA 4EI7A 3WGKA 5CB4A 4EI9A 3JATB 3RYFA 5J2TA 5LXTA 5CB4B 2VAPA 3RYFB 2GVIA 4X1YB 4ZI7B 3RB8A 4YJ2A 4I50A 3RYHB 4DRXB 3RYHA 4DRXA 3JARB 3M89A 3RYIA 3HKBA 3JAKB 5JH7A 3ZBQA 3HKDB 3JATA 4O4HB 3R4VA 5LXTB 4HNAB 5KX5B 4XCQA 1TVKB 4TV9B 1RQ7A 5ITZB 2BTOA 3JASB 4YJ2B 1OFUA 1RLUA 4TV9A 1TVKA 5MN5A 5J2TB 3ZBPA 4U3JA 4X1KA 5JQGA 3HKEA 3JAWA 4I55A 4X20A 4EI8A 4U3JB 4X1KB 5IYZA 5LP6B 1JFFB 3JALB 5KMGB 3JASA 3WGJA 1Z5WA 5GONA 1W59A 3VOBA 2VXYA 5IJ0A 5EIBC 3N2KA 1SA0A 4ZOLA 2BTQA 5FNVA 4X1IA 4U39A 4TV8B 4WBNA 5MN4A 1W581 2RHLA 3HKCA 4DXDA 5IJ0B 4O4JB 4O2BB 4O2AA 1W5BA 4I4TB 5CA1A 5J2UB 4LNUA 5EZYB 4EB6A 5C8YB 3N2GA 4YJ3B 4B45A
chains in the Genus database with same CATH superfamily
2DYKA 1O89A 1N5OX 5KQRA 5DGHA 1IY9A 4NX2A 4KIGA 1HKUA 4GPD1 2UYOA 2A78A 3WHPA 2WSSD 3LSSA 1E1YA 3L7AA 1W34A 4NBWA 4OL0A 1I3OA 3EVKA 1CJVC 1KJNA 3IAAA 3SY8A 3ZDBA 4COOA 2WHPA 1I01A 5A5DA 5BSHA 1OIVA 3FIUA 2GEVA 3SOZA 2W6ZA 2WHPB 4WV3A 3KBBA 2FK7A 2ZANA 2IOFK 3PEFA 4KGDA 4BFSA 1O77A 5AW9A 3MQWA 2AE2A 2IGBA 4ZT2A 1I2CA 4QFCA 1FCJA 2EZ9A 1LH0A 2V6BA 5JDIA 1RSZA 3AVTA 3TUJC 3WKDA 4ZHWA 2OBMA 2PMKA 3HKBB 3CZCA 2WUFA 3DCYA 2GARA 5BOSB 2FUEA 4IRXA 2Y6VA 2OYQA 4KMMA 1YVDA 4R3WA 4BMYA 4EGQA 3AEYA 3EXG2 1G7RA 1BHQ1 3MTDA 3OZGA 1U3GA 1PR3A 2FG5A 4NMMA 2OZVA 2EIKB 3DTVA 2G7MC 4Y6QA 3CCMF 5B4TA 2FMIA 3L07A 1G1XB 1KQFA 1H2BA 1YJ9F 2ZRCA 1ENOA 1QHEA 1ZEMA 1ZJZA 4YY3O 2PGOA 3KLMX 1HT0A 4GI2A 4HFJA 4DJTA 1FNJA 1V4NA 4CQNA 4LZLA 2C7OA 2RDCA 2FGYA 4AILC 4PSKA 4WFAV 1SPXA 4R54A 3AL3A 3AK1A 5D6NA 1M8GA 5HE9A 3TVTA 3IAYA 3CVVA 5JROA 1OPRA 2XMSA 3EX7C 2QX6A 1R6AA 4Y67A 2C2GA 3ER8A 4FLVA 3P8ZA 5TJHA 2Q6LA 1V4BA 1VIAA 3BULA 3FTQA 4FYJA 3I0NA 3K2IA 1I1HA 1NZFA 5KYWB 2HVYD 3WB0A 2OORA 2PWAA 1T0AA 3ESYA 3HDHA 4HH1A 2Y69C 1Y4SA 4RTLA 2X0JA 5KAMA 3UB3A 3GP3A 3CCSF 3ETDA 1VP7A 1JHPA 2QSYA 3AQ4A 5B66Z 3OBYA 3SR4A 1DTOA 3OR6C 2FZ5A 3VISA 3JRNA 5KSPA 4O1MA 1IZ7A 2I3GA 3QKTA 4JLVA 4XD7D 1G41A 4C0HA 4F9GA 3ONWA 4AF6A 1ZVMA 4HUQA 4AO6A 4YT5A 3D0QA 2BUBA 3T54A 3VV2A 5AG2A 1OI3A 2X1MA 4IRUB 1P0IA 2C3PA 2WT8A 3KO8A 1KFBB 4R31A 3ONVA 1G64A 3ZMVA 2GVIA 1B8UA 2IZ6A 4XGNA 4Y9RA 3SG0A 2ZXWB 1BCRB 2FKAA 4K9LA 1G3IA 3WSVA 5DYGA 4YIPA 3FWZA 3S2SA 1YJWF 2I6TA 4QELA 3GFQA 3VOUA 4DA7A 1OFTA 4QPPA 3WIOA 1ZN8A 1C9EA 1VMEA 1L5LA 3SU8A 1HQKA 4HADA 2EIKC 2IHKA 2C00A 3ZXUB 1UQUA 1CEYA 4LPKA 4U3JA 3UKMA 3ZHRA 3U6BA 3AERA 3LUFA 3EZGA 4MIKA 4BKMA 3ABQB 4P3YA 1FVXA 4LMBA 4F3YA 4OXRA 2X6TA 2ZJAA 2WF8A 3SPIA 5CT6A 4J07A 5EHGA 2P75A 5IE9A 3WRVA 2PJRA 1ECGA 3NQ41 1W59A 3FOWA 2E4YA 4HWSA 1CDOA 3GR6A 4Q9AA 3L49A 4OV6B 3F9IA 3TL6A 2B37A 4MYUA 1E9FA 5ESXA 3TSYA 4QECA 3VM6A 1URFA 1SKYB 4ZQFA 3B6NA 3AY7A 4QTXA 1A9QA 1TJ3A 4N0MA 1Y89A 5ALFA 3T7SA 1LTHR 3PC8A 3AL2A 1UFIA 4OXQA 1GSAA 1A32A 3BSSA 1DRUA 4J2HA 3WMEA 1ZKMA 2FTKE 3OQNA 3S0YA 5C18A 5HS6A 2VP4A 4LQLA 2ZM6B 1YFZA 3R41A 4LDAA 5AW5A 3RS3A 6LDHA 5J4HA 1E4EB 2WNIA 4P36A 2TMKA 3EG9A 4MZDA 3QQPA 2GK6A 3NHZA 4X95A 3W2TA 5JAHA 4TT8A 1KBOA 1CK4A 4RZ2A 4JTAB 1OHHD 5EWJB 3U3RA 2FWNA 2FUKA 5DCUA 4LMAA 2CHVA 3LA8A 1W4RA 1DCMA 2ZLBA 1NI4A 5EXEA 2W2LA 4RL6A 4Q9HA 2ZXWC 3PT9A 2EQ5A 4FFDA 1YQQA 1GU0A 2R8EA 5KI6A 4BV8A 4F3CA 5KQLA 2FPIA 1ADJA 2X6CA 2PAAA 4Z1OA 1R8XA 3ICCA 2UYGA 2CC2A 1XZEA 2E4XA 1SO8A 3AHCA 1C7RA 5H9WA 2JLXA 3UUFA 3URMA 4L0MA 4KQWA 4W1SA 5KHJA 3AEZA 3ZIDA 3HWUA 4X24A 1U8FO 4JJGA 2QV7A 5ALJA 1MOZA 3RUDA 3T9DA 5L6LB 4L0CA 1G7CA 2DLNA 4MHSA 1QPZA 3HBAA 1YITV 1U0JA 1K3FA 4INZA 4Q4JB 5AKEA 4C14A 2HJFC 4FE3A 3CCCA 4UVGA 1MO5A 2RD2A 1EEHA 3X1JA 4Y1FA 4F2WA 3EY4A 1MOSA 1BU8A 3OUSA 5CNIA 4CKYA 5FLKA 2JAWA 4IYHA 1L8XA 1DQZA 5FF9A 3RROA 5K09A 2WFLB 1YCGA 1Z0KA 3BJEA 1WU8A 4D3SA 1I7NA 1WR8A 1O6CA 1FK8A 3E58A 3KDSE 1QOPB 1MA0A 2FK8A 2J5RA 1T9DA 5C93A 5CXXA 3SJUA 5IARA 3QBDA 3SHTA 5AUPB 1Z5NA 1YHQV 2OORC 4NCKA 3V80A 4UTXA 1MG0A 3HWRA 2ERYA 4JUDX 4LDZA 5BMVF 1R0YA 2IW5A 5FBQB 4R84A 2PQ0A 4WFBV 1LC3A 3A28A 4URUR 2P9ZA 4EJ0A 3OQPA 4YRBA 5JQGF 3GTZA 4BX8A 1Z5VA 5HJEA 4XJTA 5H68A 4NK5A 5E7QA 4UQLA 4F4UA 3QWBA 3T3OA 2E82A 5AR1A 3WGKA 3WQRA 2QT1A 3BHPA 1SKQA 5KLVH 2AN4A 3D8UA 3ZD9A 1MG1A 2HBQA 2VQSA 3AKCA 3KXPA 4P5DA 5A3QA 3HA2A 4UUAA 1N2CE 1VHTA 3CMCO 1U8CB 4G5OA 3O4VA 4FOLA 3GLIE 1F51E 5LQMA 3I30X 5HP7A 2UVQA 3PENA 2YHAA 1H65A 2GFIA 3CCSV 3W3AH 3W4KA 3GJ0A 3GWOA 1L8QA 1N75A 3KAKA 4CR8A 4JBGA 1UBMS 1QJ4A 3DEZA 3GELA 4J6FA 5CT5A 1KP2A 2OKCA 3ETEA 1JI3A 2W6IG 3WMRA 3B1XA 5KYYA 1VA4A 2EIMC 2YC2C 4WFJA 4DWVA 3CPWU 1WD5A 4HPXB 3T3IA 5IY5B 3OT1B 3S2FA 3TLCA 3ZDYB 3RAJA 2GBGA 3U4GA 5JRJA 1TM2A 3HFJA 4XDJA 4K6CA 1SXGA 3HADA 1XCPA 1VLMA 2GK4A 2R6FA 3ICWA 5JBQA 1PR6A 2BF4A 2ZUSA 2H0AA 4KQGA 4JS0A 4H6VA 5HE8A 4BVQA 1L5OA 2JLYA 4HXGA 4JI8O 3W79A 4RUKA 1QQ7A 3NRCA 5AW3A 4KVGA 5EJEA 1XKTA 3PPWA 5EBWC 5JPDA 3VO1A 1I4DD 4RPCA 2D3WA 3F8WA 1ZJWA 3G2KA 3R5KA 4MWDA 1QVFF 5DM2A 4EY6A 4QTYA 5JJIA 2PGLA 3K1ZA 1Q91A 4MHOA 2C7GA 4YIKA 3E53A 2P06A 1AHIA 2HYDA 1XQ8A 4Y3UA 5FYQA 4YP6A 3THRA 1MJHA 1PBTA 3H2SA 4RDIA 4A9AA 4EFLA 1RACA 1RWBA 2A92A 3NFYA 2BZ1A 3G8CA 3ROFA 4DMHA 5BPFA 4FT4A 4IIJF 1JH9A 1V6CA 1D2CA 2FQYA 4HFRA 3OJCA 1B14A 2XKJE 3VYTC 1KOFA 4U00A 1HLPA 4LXYA 4V2IA 2JIOA 3OPNA 1S72F 1Z2AA 5C81A 1B8VA 1SG0A 1NOJA 1NBMG 4PZZA 1V48A 1KJZA 1Y37A 3E2IA 2C83A 4YRQA 4DIUA 3JQ9A 4XWKA 3WLIA 1WAZA 5JT1A 2AH5A 3EF1A 3G2PA 4DB4A 5MHTA 3QNEA 2A9HA 2EFDB 1XKLA 1NNSA 2F48A 2JH9A 2VWQA 2WA1A 1RFGE 5LP6A 4LRYA 5CLLA 3QF4B 4IYRA 2IA5A 4R2XA 1L1RA 4YDHB 5ECYA 2JFHA 1JIIA 1AT1A 2VUHB 2WAYA 5IT9N 2C8LA 3VPGA 3ZX5A 2XD4A 4TTSA 2JHPA 3A1EA 4Q9IA 1XELA 4OMFG 1BE6A 5FV4A 5KYUB 1JTEA 3D4BA 3ZC3A 2FDCA 3PQ6A 3GAAA 4ABYA 4KR3A 2XADA 4KBFA 4R51A 1H2SB 1CUWA 1UKEA 3M6VA 1VK3A 4EJSA 4ASUG 4XFDA 4ZYYA 5LQJA 2CNWA 2OCDA 3KBOA 3GZJA 2D1RA 4IX9A 1SVIA 4RNCA 3EVFA 3EGCA 2CHEA 1UKZA 1DBVO 1UWKA 2IXBA 3IJRA 1YC5A 3OCUA 1GG9A 3FMVA 4W9NC 4FK5C 1RPTA 1VQLV 3MCQA 2DN9A 1K73W 1O96B 2B4QA 2C78A 3KTOA 3I34X 4MXDA 4Q6BA 2BFOA 5D6OA 5FXMA 4HNRA 4PD4F 1WHSA 3VIUA 4D0GA 3HDYA 5BNWA 1A96A 4CETA 3VQYA 3HN7A 2WF7A 3I2GA 3DFUA 1V43A 4JT8A 6REQB 1Y6QA 3FFTA 2RK6A 4EABA 4N6OA 3GLVA 4EHLA 8ATCA 5HVNA 1KWGA 2JASA 3VDRA 1N6PA 2F9LA 1U1DA 1YIDA 2ID8A 4EKWA 1OU4A 4ZREA 3T9FA 3WNVA 3ZJ5A 5HKBA 3QG5A 4RWEA 1UAAA 4P5PA 5HFMA 1JNYA 1AKQA 4JT2A 4QICA 2Z3VA 4AMUA 3BTSA 4ZAVA 1YR9A 5D3MA 3AG4C 2YWCA 4CDMA 3RANA 4B81A 4FN5A 4Q3EA 2WJZB 1RYYA 4NPAA 3MG9A 1U3CA 2YZMA 5AJUA 4YH1A 5H6QA 4MI1A 3OCCA 3CMAF 4JJ4A 5D2CA 4DWOA 2IHTA 4Z99A 5FR1A 5HW0A 3V7WA 1T8SA 2X1LA 3QEBZ 4FJCC 3DLBA 4NNJA 4TLBA 3IBCA 3PXGA 3B5EA 5EIEA 1SCAA 1RM1B 2WKRA 5FRDA 1IN8A 1BRTA 3IOYA 1QGAA 4BZQA 1FRVA 1BN7A 2VBGA 2GA9A 3JR7A 1NKTA 4HTAA 4I5SA 1MN6A 2RGNC 4Q3OA 4F4FA 4TVSA 4JI3B 5AIBA 3NP9A 3L4BA 3HMQA 2LJ2A 4OYHA 1P3Y1 4NICA 2R7AA 4KR6A 4RANA 1QU7A 3CH6A 1Y8RB 2V1UA 2IJGX 2VJMB 4DSNA 3GRCA 3AONB 1N33B 1UJ6A 1DU4A 4R0NA 2FTKA 2PMCA 1CXZB 1JU3A 1UDRA 3FOCA 4JSTA 1IM5A 3OTGA 4CQLB 4ZMRA 3FSJX 1U9IC 1Y33E 5KNLA 1P18A 2QW0X 5KJEA 3IKEA 1SD2A 3I92A 1VJGA 1JV2B 2AW3A 3OJOA 2ZE6A 4UOZA 1C8BA 2O2HA 3G6WA 1O5IA 4OQFA 4E08A 4UUJC 2VXOA 1XBLA 3EEYA 3N3BC 3GNLA 4H0LB 2G1AA 3DE3X 4P82A 1EXWA 5FA6A 4R68A 4LRQA 3EUEA 3RYCB 1FSFA 1MZFA 1B15A 2FLWA 3LZ6A 1FDTA 4QTUB 4J41A 1TZKA 4BIZA 1NW3A 1Y3DE 2ZWOA 3EC2A 4IR7A 4ME6A 1HNWB 3IEWA 3GPDG 4RCYA 4YV2A 2GD2A 2GVDC 2IHBA 2W6NA 2HU8A 2WU8A 4MRPA 1U28A 5KJ1A 4QASA 4X8OA 1P5HA 4CEIB 5IW8A 4YCSA 3AYZB 4E4EA 3BPZA 3OTOB 3E20B 1DK1A 1OFVA 3C45A 3BQMB 4ZHVA 4MW8A 3PWSA 1J0EA 5AVZA 2DEUA 1QVRA 1Q82H 1XRJA 1P6XA 1USWA 2P9TA 4AY5A 1H8EG 5K0LA 1LC0A 3UMBA 1J06A 2YICA 2MYPA 3D7SA 1UPFA 1RPRA 3SQLA 5HXAA 1XLWA 3U7IA 1KQPA 3C3PA 4EGCB 4ZT6A 3K73O 4V1CI 1TEHA 3ABZA 1ADBA 1UM9B 2D5IA 4U7NA 2F1HA 1GJRA 2OXEA 2ZIAA 1CULC 2ZJBA 3G0DA 1L5HB 3MWDA 4JGIA 4O2BF 2F4NA 4YYZA 5KYYB 1A4XA 1PS0A 3QVUA 1NMQA 4CW7A 3VQXA 4D0NA 1BGYH 1G63A 3H4MA 2H4YA 1BMFA 3L0DA 1T2NA 1XA0A 3FBTA 4B9AA 5F4ZA 5I9LA 3L0OA 5HQTA 3S99A 1VH8A 2YV4A 2W2KA 3IGAC 4NYJR 3VR3A 5DEIA 3T06B 4LYJA 4J10A 2FW1A 4TSFA 3SIUA 4C6RA 1QDLB 2ZJ3A 2DR2A 3TSAA 3UGTA 4Y2YA 2ZZMA 2GYUA 5ARCA 1IOZA 1CVRA 4IQFA 2CLSA 1CUUA 5BVHA 1HTTA 2PH5A 1CYDA 2O2GA 3VUEA 2XNJA 4EZEA 1Y67A 1E3EA 1M5UA 2J9GA 3MGGA 3J80A 2PNJA 4YRMA 4KSBA 3ZTWA 1KI8A 2QVYX 4ZCSA 3PC8C 1A9XA 1HDGO 3ELWA 4OHPA 3PI7A 4DDHA 2JI4A 2P2DA 4DW0A 3B12A 1EHCA 3JQAA 1A5AB 5GWXA 1P7CA 3KQTA 3EEFA 3K9SA 3QE4A 4UAGA 1GK9A 2P3QA 1D6SA 1EE2A 4MULA 4TXMA 2GK7A 3VZBA 3W7TA 4D8TA 1TTTA 1ID8A 1NIJA 1ZAKA 3A2FA 3RYHB 1TM3E 1W5TA 3SAJA 1XRRA 2IJKA 3HSSA 4TMKA 2H59A 3M89A 2V6JA 3HJCA 3JAKB 1E2FA 3PVSA 4MGKR 3EXEA 2I91A 1AVTA 2HMSA 4O4HB 4CTOA 2NVUA 2D2IA 5C2JB 2G1JA 3JQBA 3P0FA 1YQ9A 1GLGA 3ZV3A 2BHLA 4MUJA 3ZHTA 3E2MA 1PS8A 2ZI3A 5BUSA 1A27A 5KO2A 1NXVA 4EG3A 1GILA 3GJ6A 4CT4B 3QF4A 3CO0S 4AN0A 4KGVA 4DR2O 3QYJA 4EA7A 1FRFS 4BO0A 4ENWA 1P2GA 5ALMA 3LUHA 1CJSA 1QH8A 2OLEA 1SGWA 1FYJA 4W99A 1BJTA 1ZDMA 4CIDA 1X2BA 1HPLA 1YQWA 4MVOA 3V4OA 3B48A 2A3NA 3OHSX 2XODA 2JW5A 3DNPA 3NVAA 4RY9A 3EC7A 3OCYA 1R5OA 3SEZA 4J9VA 4OGLA 2PRYA 1N2SA 5ED0A 3RNOA 3GDGA 2HA4A 1GTRA 5CYPA 1RAEA 1I9CA 2VIIA 2CFRA 2ZTVA 4KRYA 1NNI1 5HP4A 4BN5A 1Q90D 2I7CA 1JH8A 1ZRSA 1ULHA 3MWDB 4N7MA 3ETJA 3JVVA 1L5HA 1C9JA 2IX9A 1LJLA 5MGNA 4G63A 4RS4A 3G4SV 3LMEA 2DPGA 4BFTA 3QTYA 2C29D 4ND6A 5AK3A 1K4DC 4Y2RA 2EXXA 4Z4GA 1PJQA 3VNBA 3H8JA 1HEIA 1E63A 1L4EA 4FCVA 2NT3A 2VZ9A 3FVVA 3MW8A 2F6RA 4BUZA 2IYEA 4K1XA 3S29A 2AMYA 3Q7TA 1X7PA 4LXXA 4YRRA 4MWGA 3ZBUA 2RGBA 3H5NA 1TL7C 2C2YA 5CXSA 4FEGA 3MWJA 1ISHA 5K3FB 2WQ7A 3HPLC 1E1MA 3WK8A 3P9SA 2XAQA 3HJGA 2JVKA 2CK3A 4IJQA 4CT0A 2GAFA 1XVLA 1UXHA 5H5JA 3ZOKA 1YDEA 1ZK2A 4CDRA 2HPVA 1DAKA 4H3KB 2QW8A 2XHZA 1E62A 1KAQA 4MVJG 4BVFA 3K04A 1IEQA 3BEOA 3LSTA 2P69A 3DC7A 4GGPA 4A36A 4JOQA 4RVGA 5KPDA 5ADVA 1QX3A 1P5JA 4NG4A 1U1FA 4OKIA 4BP3A 1B0UA 4KRXA 1J07A 4JC5A 4BZWA 1E66A 1W46A 3DXRB 1TF5A 4NWIA 2CTQA 4KPFC 2Q4OA 1B43A 5AVWA 2XBMA 2XNKA 1ISRA 3D4IA 4WX2B 1Y1RA 4O4HA 4S2EA 4B7AA 2JGAA 4LJRA 3CZAA 1VGQA 5CDHA 3P0IA 2XZDA 3HXTA 4G07A 2EG5A 3ETCA 1T8RA 4FILA 5IH7A 2PUDA 1DJPA 1MQSA 2POQX 2CTPA 1N2IA 4TRJA 3VI4B 3I6IA 4UUMA 4A26A 4CCSA 3QVVA 3CRVA 3CEHA 1D1QA 3IUEA 4HAVA 4FW8A 4GP9A 3LJKA 4OQZA 1M6WA 3F8SA 3JQ9C 5B3KA 4GR5A 2P7TC 3WZ2A 4EQ6B 4X1YA 3RTBA 4KNYA 2ZIMA 1A8IA 2GBIA 3LSQA 1CUBA 4KODA 4QGHA 1VQ6V 3G02A 5EXXA 1KEEB 2Q21A 3F6PA 2R25B 4WNCA 2I80A 1V7ZA 2C5HA 4FHGA 4BYGA 1YKSA 3O1LA 4B34A 1E3SA 1UXGA 2ZRAA 4XRGA 3NHFA 4BVGA 3VBEA 2JIZD 5LGTA 1BCRA 2ZR9A 3ECSA 2JJ2G 1M2OA 2BN4A 2TMDA 4KQFA 4WZZA 1P1RA 4KHPO 4L8VA 5ALWA 3UM7A 1ZI9A 3TZHA 4DSUA 4EGSA 2XNSA 5HY4A 3E4DA 3KZKA 3WG7C 1E6WA 2JJQA 1A1SA 3D8CA 1HXHA 2Q5EA 2XAAA 3CUEF 2KSQA 3FMIA 3TDMA 3WLJA 1NWCA 4QODA 4GUNA 2HRUA 1HT3A 1C50A 3RBXA 2XZLA 5IVHA 2ZI9A 3I7TA 3QTTA 2GVZC 4Q24A 1VFNA 4UZFA 1VCOA 1JBQA 3IAS1 4XM2A 1BYUA 3S3TA 3ELCA 4AW9A 1H5UA 2VYNA 3AG6A 4BVEA 1LPNA 1QYDA 3IB3A 1SRYA 2WLIB 5CJPA 1EGAA 1W52X 1JVBA 2PZFA 3U44A 1Z36A 3DDWA 4L7VA 4N5HX 2AOUA 4AX8A 1GKKA 4V0LA 5IT4A 3MRXA 3PDJA 3UJPA 3AVQA 1DKNA 4YGXB 2HSDA 3QVKA 5LZ9A 5B1AB 3QMPA 5H3LA 3H9VA 2I76A 3OW2F 4ATNA 1W0CA 1LK0A 4LW8A 3RIHA 3OJEA 2RHLA 4O2RA 1P74A 4OI4A 2FH5B 5AD1A 4G0VA 3DXRA 3S3WA 1EDZA 1GN8A 2QT0A 2XYHA 4NULA 3RT9A 2X8BA 5FLXM 1OIXA 3I3SR 4UCSA 3OFKA 3P26A 2G8LA 2XECA 4OQEA 1TUEB 1U8EA 4PLCA 5GZ1A 1G20B 2OCGA 3F0FA 1WXEA 1X1CA 2J4CA 2X9GA 3ANYB 3HWWA 3I9V1 4MMXB 4BN4A 2ECFA 1GZHB 2LCAA 1K4YA 1UFRA 3H9CA 2X1VA 3IEXA 1H4VB 5J2UA 4FGUA 4I5DA 3N4ZA 3KSMA 5D84A 5JXJA 3GUHA 1KYQA 3IEMA 2BKVA 3P2IA 5FPHA 4F6RB 1NJ8A 4MB0A 5HZKA 4KR0A 3T5GA 4QRDA 3NAZA 4F6RA 3HXMA 2G77B 3JU3A 2JJ1G 2QNIA 4GWLA 3RK4A 1CN7A 3G5TA 3NVKE 2GNPA 4LWQA 5KYXB 3HE3A 3KKMA 3R0PA 2RGWA 2DW4A 1P44A 2GBCA 4N01A 1AK9A 4QDTA 1Z4MA 5BZBA 3E1SA 3NDPA 2SHKA 1W1UA 3GUVA 4R0VA 1GNSA 1F4PA 4ZC8A 1OLXA 1JU9A 5KVSA 5B1YA 4OREX 1K8AW 1D0VA 2SECE 1MA3A 3G85A 1JG4A 4D7AA 1N2HA 3NI2A 1Z7EA 2NQ2C 1O6BA 3AXSA 5ALNA 1SHZA 1R27A 2OXCA 2NM0A 3TDKA 3IUNA 3QNWA 3PFNA 1WBBA 3JXEA 3ZY5A 1UP4A 1VKHA 3LH5A 2VTKA 5FP0A 1GSIA 5IYCO 1C14A 5T6MA 4Q01A 3WYBA 4M8NE 2QGFA 1JBKA 3PPVA 4BVLA 1YONA 2NYVA 3FOFC 4KWTA 2ZWIA 3B6KA 4YRFA 2AOVA 5K8JB 1T9AA 2Z1EA 3MRTA 1RZRD 1PSZA 1XZLA 1H3NA 1P0MA 1XEWY 1JDZA 2OFPA 3I23A 5G4KA 1WX1A 4CUJA 1NRJB 1QB8A 2FSGA 3G6EF 3LPNA 3QPDA 4TZKA 5DBFA 4ZDKA 5C3MA 3U19A 1AR5A 1T0PA 2GEJA 3AF1A 5ALOA 2GN6A 4BLUA 1XT6A 5D8DA 3ZWMA 1X59A 3JY6A 3E3OA 4YHHB 1RM5A 4JI0B 1WP7A 1DT5A 3FPCA 1N2BA 2FSUA 4H31A 4KCGA 3ILSA 4JL8A 4ALIA 3SYQA 1DWPA 2O48X 3KZCA 2BGKA 4U0KA 1QG6A 2DX7A 5I4KA 1A4IA 2QTFA 3WGIA 3H1EA 3TXXA 3ZE0B 1O96A 3JQGA 4YO7A 1X7XB 2ZSDA 2JS7A 5TPZA 4X91A 3Q4HB 4AKGA 4CKEB 5F2KA 1B6TA 1GAJA 4CQMD 1W2BF 3H5RA 4FE4A 1VF6A 4ILEA 4MR8B 4PLPA 4K9PA 2NSLA 3IERA 1X87A 1PT5A 4J0JA 4RDXA 3QE0A 1QP0A 1RYDA 4M2LA 5HF5A 3FB1A 1AB6A 4ZAZA 1C7JA 4F9EA 4NR0A 1IN5A 3DJYA 3KT8A 1FJHA 2JFBA 2YWRA 4H9GA 1E1QA 1SBYA 4Q18A 4CEHA 4Z0PA 1YUNA 2WLKA 3FYTA 3MJRA 4KFSA 4J3NA 1U80A 3PDHA 5JANA 3M4XA 4J11A 3D7NA 1OLXB 4JROA 1EIZA 1USIA 5C1PA 2JFYA 3VI6A 1L3BA 3ZRWB 2HK7A 3WWEA 3ZDXB 4NFSA 5KYNA 3OM3B 4QNHB 3MJEA 2HLDG 1IAVA 4CFSA 3H1GA 1IEXA 4Y2JA 1R50A 3H0EA 2E4VA 4IMJB 3F47A 1C7EA 2E4UA 1Y1QA 3NONA 1N0IA 1W29A 3LKZA 3SNKA 5B2FA 3F5SA 4POOA 2Z9BA 2Z8ZA 1GZ3A 1Z0FA 4D1YA 2ONCA 3NNSA 2Q3JA 3EMVA 3SSNA 3HBMA 3VJMA 4WFGA 1P4JA 2P0YA 4BO8A 3HGMA 2VTDA 4FUTA 2IYAA 2PYIA 2A5FA 4O4JB 3CXRA 3LM8A 5CDSA 4EPVA 2PRSA 4XVRA 2ZJ5A 5JZMA 1HTBA 4OOEA 4K9SA 3PLNA 4RAIA 2OFOA 2B9ZA 3BWBA 1Z2CA 3FPSA 3KXIA 4GAEA 4E2FA 5JZVA 1O57A 3NUGA 4FC7A 4J3JA 4CKWA 2O20A 3PSHA 1VHLA 4WADA 4B3RB 2OP0A 2GBFA 4YLGA 3WP0A 1JXQA 1E9RA 5IS2A 1LBEA 1YK0A 1UZAA 4GWKA 4ZALA 4CZ2A 4PYOA 3V4ZA 5JLAA 5LQRA 1T2FA 1BKSB 4IO0A 3MCTA 2KGWA 2V5AA 4S1VA 1OI7A 4M1QA 3VOTA 2FRDA 4CBVA 5A0TA 4HRXA 4DPKA 2VNJA 2Q5CA 1KR2A 1HSZA 4LJ7A 1H8EA 3O3MB 3HYLA 4EL5A 2IX3A 1G2QA 2ZIFA 1VL6A 2EJRA 1XL6A 5GVRA 5I45A 3I05A 1JVMA 2ZIEA 3SDLA 3OH8A 4FD2A 1L4FA 4J4BA 2BSXA 3K94A 3RVYA 2COUA 4ZO9A 5BW4A 3C7DB 4LR3A 5DLEA 1HGXA 1X70A 5KU7A 3G8DA 4PYRA 3CT4A 3U61B 1BFDA 4I3GA 1HWYA 3L01A 3WLMA 3LE8A 3V3KA 3FUCA 4G1MB 2MQEA 1M0TA 4DXHA 3C16C 4KR2A 3A9VA 1L1QA 2MSWA 4FVTA 5M29A 1NLUA 3OFSA 4OFBA 4CQMA 2RGAA 2VTEA 1BWPA 3IBGA 4PHZA 1NUQA 4LCJA 2QA4V 4G4GA 1X7ZA 2APJA 1ORRA 4PG7A 2YHIA 1N6OA 1N5JA 5K3DA 2Z6UA 3ZWPA 1L1EA 1MIHA 4CI9A 4WRRA 2OV6A 3SYKA 4XFKA 1YRAA 5HRCA 4G9GA 1TAUA 4IXWA 2ZCEA 4DO2A 1QGZA 3WL5A 1IBCA 5ADUS 2FMUA 3OFND 4LXTA 3B6IA 3VMFB 2G3YA 4RD4A 2OG1A 4EOGA 4XZ3A 4CH5A 1A76A 2WIDA 2FZKA 4WBXC 3UVEA 5DGCA 4CGZA 2VPIA 4EJ2A 4ZK7A 4DR3O 3RVLA 4EKNB 3RCBA 2QLLA 3CUYA 4OLBA 4RVSA 4DANA 2XNHA 2VP2A 5G3YA 2QQFA 3PQFA 4WFFA 2P41A 3VR1A 3AG2C 3F7VC 4ER7A 4DHWA 5LHIA 1OU0A 3ACDA 3LHSA 1CEXA 1KEVA 1SB8A 3MD9A 4X6XA 2KW5A 4GKKB 2HNBA 3U5ZB 3JARB 1PTKA 2IEGA 3W7XA 1DC8A 4OQQA 2ZTSA 3E9MA 3L70H 2Y48A 4FLTA 2CXQA 2GGSA 4RQOA 3Q6IA 3R4VA 3IKVA 4HSEA 4YROA 5B4VA 2O8DA 4JJ6A 1KZ1A 3ZJYA 3QXCA 2F3RA 1V41E 4YB8A 4J94A 3ZQJA 1Q8RA 2AI3A 4Q1VA 2XLCA 4ARCA 4AKHA 4URWR 4OMCA 3JAWA 2UYPA 2CWJA 2VLBA 4D98A 4G4ZA 4DS3A 3DL0A 4A4DA 5DM60 5IULC 3MTJA 4I1UA 3FOBA 1MNGA 3V48A 3MQ4A 3R5TA 1E64A 3BA8A 2WYHA 5KNBH 1INLA 2CJYA 4AP9A 3A1WA 4MJLA 3KR0A 1EKXA 1TQ6A 3P96A 2B3DA 4O4HF 4W9NA 5SY9A 4BFZA 1QRUA 1NC3A 3MF4A 4OQPA 4PPNA 1HQDA 4JL5A 4A8TA 1VYUA 3HQ4O 1F6BA 1U0EA 1OKKD 3TNLA 1OBHA 2GXQA 4FD3A 1TAEA 2ZAOA 4OGGA 2R9RB 3S03A 1I3CA 1TVMA 2BJWA 2BMJA 4YK7A 2FXVA 5BYKA 4XPIB 1T8TA 1OAPA 1WF3A 2EJWA 2V3CC 1KIFA 2C9DA 3DOEA 4XX0B 4Q9JA 2GTPA 3B78A 2FZCA 5FOVA 3ZI4A 3K8QA 3LNNA 1VE6A 2I29A 3LDEA 1FTGA 3A2LA 4MS3A 1A82A 2VYQA 1G5QA 4BO7A 2FSPA 2W43A 4W63A 1IHXA 2IUTA 2NXEA 3ZE2B 1Q1AA 2HB6A 1K86A 2O5VA 3LCRA 5JQGB 1EXNA 3PHHA 4ZAYA 1H0SA 1TJ4A 3PXUA 2EKPA 3RFXA 5AUOB 1JCHA 1HZZC 3UG6A 1QZUA 2V74B 2C9CA 3DO8A 4BTLA 1ZW6A 4ITRC 4UTRA 4HNVA 4Z1MG 1E3IA 5JS8A 4AMVA 1SIBE 1ZRMA 3ZWNA 3A6PC 3O2QB 3K1TA 1CF9A 1VL1A 4ROTA 3RJMA 2ZETA 2GJAA 4MMZB 4RE5A 1C8VB 1RCUA 5J9FA 3KE8A 3WNDA 4E7PA 3HNOA 1I3NA 1YC2A 2NNLD 3CEJA 5H3HA 3HR7A 1H8HG 1S0UA 2VZ0A 4JDPA 5J58A 1RR6A 5C8VA 4H0CA 1RP1A 4IIEA 4UW9A 2VZEA 4JYAO 1BT8A 1S4MA 1JOYA 2VPYA 4MGIR 4S2UA 4G0XA 4J7CA 3WK6A 3C8DA 1C41A 1GPDG 4QXOA 4FZ0A 2JPDA 5L9AA 1XK7A 2JLWA 1NQTA 5G41A 3G0GA 4BX9A 3E9ZA 1Y9ZA 5KYGA 2OECA 1TZBA 4GYJA 4HGNA 4M89A 4FYHA 4KQ9A 2RHTA 2PPLA 3DV9A 3EFOA 1DARA 1YMUA 4Y2XA 1XVIA 2F67A 3O47A 1GU1A 4IDAA 3RIXA 2A0XA 4GI3A 3ZV6A 1RKQA 5IRCD 2R9VA 2QTWB 1KI9A 3KEMA 1EP3B 3NVDA 3BXXA 1ACMA 3NHAA 4D7TA 4ZHQF 1W2GA 2LGQA 2C4VA 3FVQA 4CMKA 4OIMA 3KDAA 3S68A 4AKIA 2HA2A 3CLRC 3VYRB 2HX1A 3KQYA 4YMUA 5JS7A 1UXKA 1PBNA 2ZAMA 1JG2A 1K7YA 5AVTA 2DWPA 2QRLA 3OCWA 2NPOA 3QVXA 5TS2A 2R68A 3FTCA 2W6IA 1BTOA 2EW1A 4D81A 3HR8A 2IHZA 1DINA 3ODPA 2I8AA 4L4UA 4AZ0B 3JR3A 1G4YB 5I5GA 4X7PA 5IKPA 3ZHUA 4AZ0A 4BW9A 1K8QA 2H07A 3S4YA 1NXTA 1KH3A 4R9UC 2OVBA 4MARA 1AMNA 5IDWA 2Z1DA 5A3JA 2IYOA 3Q8MA 1Q82W 2HWKA 2F17A 2PIDA 1VQOF 4TV9B 3GBSA 5LOVF 3F6BX 5JS1A 3ITKA 2ODBA 3NFRA 1WA8B 5ICSA 3ANTA 3DV2A 1J8MF 1AKNA 1XQ9A 3LKVA 1CZRA 4G8CA 4H4CA 2FR8A 3RSOA 5DX0A 4A8JA 3ED1A 2E5WA 3M3DA 4LOHA 4D97A 2RB5A 4WVFA 2Z8YM 3WWYA 1LTQA 1T36A 3EQ9A 3FA2A 2AFHB 4R4JA 1WCIA 3TIXB 4PZAA 1XKQA 5AJYA 1RYNA 1WXHA 5C1OA 1ABBA 1BQ4A 1YI1A 1E2EA 3FNHA 2QUBA 4KDEA 4YJDA 3AB8A 3CC8A 2N47A 1S6YA 2E89A 4WBNA 4ETNA 2E1PA 3PUZA 4L07A 1CERA 4WCDA 5G4KB 4IQ8A 2I9KA 4PZEA 1V8FA 3IC9A 1RI3A 3TLEA 3O85A 2RAUA 2IELA 2Z2ZA 4ZZ2A 1UBNA 4LH6A 4F6CA 2PLNA 3NDRA 5G0SA 3GLHA 5LWQA 3NK7A 4QJFB 1NTOA 2BGJA 2M6KA 4LJ5A 2JKYA 2A67A 5JW6A 1ZD3A 3C15C 3MVEA 4B4VA 1UIRA 2Q6OA 4Z2AA 1XL0A 1X7DA 1CUHA 2WWRA 3EEIA 3R4CA 2KB0A 2YQZA 1MPTA 4XTCS 1Z63A 1YS6A 3WLHA 4DXAA 4EKIA 2YMLA 3MTAA 2K87A 3GEPA 2RFLA 3HG7A 3IDQA 4ZCRA 4RF2A 4JVSB 2BFEA 4NYJQ 3IBYA 1WD7A 3EXIA 3D3IA 3PHBE 3W0LB 3CNQS 1RSOB 4BLOA 3O8CA 4KPUA 4MW6A 4KQIA 2L6LA 4FQ5A 3W7SA 3MYRA 1DRVA 1KNQA 1WULS 2FWAA 2ECPA 3R9XB 1CZHA 1SEPA 1CUGA 1NXXA 1X80B 4HDSB 2X9VA 2ZR8A 5BR4A 5AJVB 1K5PA 3SJAA 5T8KA 5BP7A 1U0SY 3E18A 3AJRA 4CKZA 2MR6A 3IQHX 3ISTA 2B7CA 4K87A 1CFJA 4MQ4A 2PS9A 1UPGA 2Z83A 4H77A 4DGSA 1PGNA 1F17A 1JLSA 1HMPA 4FFSA 2M6YA 4ZICA 3VCZA 2BD0A 1MZVA 1AB3A 3VR5A 4KAJA 4ZCQA 4DILA 2C98A 1AQIA 1CR2A 3K8YA 2OQ2A 4OYRA 2PUHA 3ND7A 3SBDA 4FZRA 2WSBA 3T12A 3INGA 1T5SA 2ZJFA 3KKQA 5HKKA 4E94A 2G08A 3WA6A 4CMBA 1XZAA 2J85A 2RNBA 1C1YA 3C8LA 2QQ5A 3V34A 5BN5A 1M2JA 1TFUA 3UMFA 4K8XA 3WHLA 4GLFA 4PO8A 1KHTA 4MTXA 5CCBA 4H16A 4BNLA 4HBNA 3ZY3A 3WDLA 3DR3A 5F9FA 1N0WA 1R6XA 2BCJQ 3ZS8A 4R05A 3W2GA 4CLDA 4LRUA 3NDJA 2WSMA 3PGLA 1QGUB 4D92A 1SVNA 2UXDO 1YXMA 2W58A 2Y9MB 2RGDA 2IF2A 2BJVA 2UDPA 3G2OA 3RRZA 3LWZA 4KLAA 1RLMA 3A37A 5CRIA 2YUTA 3R0IA 1R4MA 3WJAA 4U7OA 2ZJ0A 3Q9NA 4EGFA 5EVJA 1IJEA 3T5PA 1R4MB 1L5QA 3Q7QA 3WG9A 3CD6F 3GD7A 3TE6A 1WBDA 3L05A 2YS6A 3M1LA 2XVAA 1JR4A 1FS0G 3ON1A 2FQQA 1XWFA 4N9WA 4XCQA 1QTNA 5DO9A 2DE0X 2VHUA 4JOBA 4K9KA 1NUTA 3AP3A 5THKA 3GJTA 4JJKA 4QE7A 1JJOA 3LNTA 3NEAA 3PKIA 4HZUA 5AO9A 1VECA 1YZBA 1VQ7V 3DULA 1A88A 4BVBA 1LUVA 1Z2NX 2BC9A 5HK9A 1RSOA 2ALEA 1LD3A 2N46A 2QAIA 3B7WA 5FH9A 1MQ8B 2GD6A 4V0OA 4D3ZA 2XAUA 2H1CA 2WJ6A 1ZNWA 3C6XA 3N3AC 2ZBPA 3GOHA 3CH7A 3BX1A 1JMVA 4OX9B 3F67A 2A9OA 2NZ2A 4YEDA 2PY5A 1KD1W 2KYRA 3C1UA 1GKFA 3B09A 4IH4A 2WQ6A 1JS1X 4PQRA 1G8YA 2F3TA 1HK7A 2RGXA 1PF7E 4P2GA 4PAGA 4RY0A 3EWSA 3D43A 4L75A 1T5BA 2KKWA 2H65A 4WN3A 1ZBDA 2GBLC 2QUKA 1XTRA 2KS6A 3EXFA 5H2FZ 2ENUA 4AJ1A 3PA8A 1XL4A 1X7WA 4KRFA 1B0PA 3K72B 2YUAA 2H0RA 1U31A 4ERNA 1JA9A 1U8AA 1MRSA 1U8TA 5CH8A 4BGDA 3LT4A 4Q1DA 1E7QA 1RW4A 1C81A 3DTTA 1J95A 1D5AA 1EUDA 2A1UB 4HLNA 4JLDA 4R3NA 2JIQA 3SEFA 2R5NA 4K03A 1P80A 2CUTA 1NL3A 4HMQA 2I66A 4RY8A 1RPOA 5BNFA 4PDRA 1IURA 1Y9AA 1YGPA 1O8BA 2HCTA 2X1HA 4PYKA 4TLMB 3RBAA 1J25A 1BL8A 4FYMA 3E9CA 5K0BA 2O9JA 4JKYA 2GCIA 1JJFA 4FCWA 3V1MA 4HB3A 3HFSA 2XNDD 2ZVDA 4E15A 2CFSA 1R15A 3QG1A 3ZMTA 1JHRA 3L7JA 3U4QA 2QLFA 3GCXA 4DRYA 2V03A 3VTFA 4C07A 1LXCA 4RABA 1VDZA 3ZCSA 1EVJA 3LW7A 3AIKA 1ZITA 2WLJA 1QZ3A 2EFGA 3BB1A 1R10A 3GRAA 1JQ0A 3H1HH 4DLUA 5KMGA 5CA1B 4JAVC 1KP9A 1U2SA 3AR6A 4ENQA 5HUQA 2LFRA 3CFYA 3EFHA 2CMKA 4FZVA 4CM3A 4CMGA 2Z0AA 4YP7A 4DXWA 4JCOA 3TTYA 1SIOA 1PWXA 2Q2OA 4WLEA 2NXCA 3TZ6A 2OAP1 3LFHA 3CWCA 5KNCH 4JYBA 2JLZA 2PHZA 2H9AA 4IGFA 1KMHB 1U0OC 2IU4A 2HKIA 1ZD5A 2A5DA 3ZHOA 4WKCA 1B8PA 4XYBA 1UADA 1TZJA 1YRQA 4L28A 3BXFA 5E6SB 1MX5A 5KA6A 1CR4A 1AGYA 2BUAA 4EY5A 2F1RA 4M7OA 4F4CA 5JH7F 2AG5A 2FSHA 2EINB 1SOUA 2PV0A 1G3RA 2P67A 4MCIA 4WT7A 4X61A 3UUGA 2RHHA 1LX7A 1OYWA 2WJGA 4IL5A 4ALJA 1EXVA 3W3AA 4Z7NB 4QWWA 1D4OA 2X0IA 3K0BA 3N5KA 3OMLA 4EI9A 1Y6JA 3LDFA 2PVSA 2QTNA 5DOZA 4BX2A 3B8MA 4NYKA 2RH4A 2IS4A 1XRMA 3DZGA 1QK4A 1J0AA 2CCGA 2YZGA 4Z6KA 3ZDAA 1S2DA 1JLKA 1TQ8A 4U7PB 1ESNA 4YAUA 5L4SA 1L7EA 3NDIA 2DUWA 2COEA 3BQ9A 3E8XA 3GK3A 5TQVA 2QTVB 1G1AA 3T3PB 4Y2TA 1JL3A 5K45A 3G80A 3QUWA 4GKBA 2EDCA 5LGUA 4QLOA 1J39A 4FLYA 2QI9F 2Z3WA 1TMOA 2AZ4A 3ENNA 2ZF8A 4DBLE 5FPSA 3VHLB 4B7CA 2FU5C 4KUGA 4YCJA 5CD9A 3TF5A 3T1VA 1F14A 1LZLA 1TIPA 3KOWA 2JRLA 2GO1A 5LZ7A 2HPAA 2ZCVA 1SPBS 2RI6A 2AJ8A 2WHRA 2G80A 2N9UA 1BKDR 1KBQA 3G9ZA 5K8CA 1VQ8F 2EU8A 5BUQA 5GW7A 5GIOE 3K8ZA 2ONJA 2I1LA 4BGIA 5FNVF 1UWLA 3V8BA 1YZGA 4YAOA 1P1JA 2IE0A 3P0ZA 3B3JA 3DD5A 4ZJYA 3HHEA 1MW8X 4JYAB 3FCCA 4C4SA 1Y8CA 3ORSA 4RNDB 3BL5A 4HG2A 5EMKA 2XWJI 2QT9A 3QOFA 3FVWA 3FWKA 4RHUA 5CA1A 1JR9A 4G5YA 4XBFA 2Y8EA 4D9FA 3MB5A 3KDPA 4J0IA 5T7BA 4CDNA 5HKOA 2YVKA 2QR5A 4BT6A 1JYFA 1U0FA 4XB6B 1GNQA 3FMPB 2F3PA 3CW2A 4HVCA 2ZROA 2ZAIA 3RF7A 1SVSA 4XDHA 5CM8B 4YP1A 2WIGA 2YXHA 1EP1B 4RJLA 5I01A 2VYND 3ZI0A 3ILYA 5L3RA 4J0EA 3FTEA 1LI4A 2GZHA 3ISJA 1KZ6A 5B3SB 3B1VA 2BEJA 3ESJA 4K88A 3I1YA 4BB6A 2NO5A 3D7MA 4G23A 4I4NA 4C2AA 4D57A 1X25A 1LSJA 1TKAA 4DA0A 2QUAA 2AXNA 5JVDF 4ZZ3A 1FMCA 3UF0A 4ZPXA 5JNVA 1OTHA 1N33O 1W85A 4BDSA 1OXTA 2PQ2A 1QQAA 1ZA1A 3VGJA 2DETA 2UUCB 1KZYC 3I6QA 2MW2B 5E4FA 3K0HA 4PN7A 3H5IA 2BUCA 3G5AA 4JP3A 3ND9A 3TEFA 3W6NA 1G98A 1WWKA 2VJDA 3EHEA 3HZZA 1IDOA 2Y4NA 3GL9A 2RC5A 5FFNA 1PXWA 2DERA 5IHPA 1PR5A 3JCUZ 3EK2A 4B4DA 2ORVA 4WK2B 5CYOA 4F45A 1Y8QA 5G40A 3KV1A 3V4VB 2C82A 5A06A 3NDBB 3MWYW 2V3VA 3QFRA 2Q0AA 1JJ2U 2PRIA 5B1SA 4E6PA 2WWHA 3A4NA 4F9FA 1CETA 4P35A 3ZCXA 4ENSA 1NVAA 1LBQA 2BGIA 5CBGA 3BXOA 1L7OA 4EM6A 1JFFA 1E3DA 4OHXA 3GFTA 2GAOA 4C4XA 2BVNA 3L1IA 1DX4A 2XR1A 4R1OA 3EEBA 4HQRA 4RKQA 3OE7G 3O21A 1U8XX 3AHDA 3EZ7A 1ZR4A 5PNTA 2J7PA 5KJCA 1OH8A 2GHYA 3L8DA 4BNKA 3L8MA 4C43A 3T3MB 4ZVQA 4LFAB 1NG1A 2HSWA 4IUCS 4L87A 4XM1A 4CTKA 3SEQA 3IUYA 1JDJA 2JGLA 3W8RA 4E31A 5FT9A 3R74A 2RHOA 5A9SA 3G13A 2JDIA 4XLZA 1SXJC 1FXWA 2Q3CA 3B40A 3ORFA 1EJ0A 4YFYA 1JN1A 3JAMN 4D96A 3KB6A 4GYWA 3SZUA 4OM7A 5F33A 3L6DA 3GVPA 2CZWA 1W2WB 2ZB3A 4N0DA 4JZ2A 2REXB 3HFGA 4OKSA 4CI0B 2D7DA 5EPOA 4ZV9A 4IMIB 4X64B 2H8GA 5GADl 1QV9A 1SUWA 4K0RA 3N8GA 5BWBA 1EWTA 1DKPA 5EEGA 3U39A 2ORED 5EC1C 3BXHA 2QLBA 3UM9A 4GOOD 3ZTYA 1JECA 2PBZA 3B60A 1ZSVA 1RI2A 1U3DA 2Y2VA 1DZIA 3H01A 1IWOA 4FDLA 1LQ2A 3WNBA 5ITZB 1CR1A 3N7UA 2GDJA 5L3FA 1P4HA 3NHSA 4KYVA 4ZEOA 3V2HA 3UN1A 4L5AA 3DUFA 5SZKB 1M0WA 3E2PA 5I7SA 4AULA 5HF9A 1AU9A 3OKAA 5JNLA 4ZAXA 5AESA 5BWNA 4HQNA 3KXDA 1TYEB 4G8JA 2GYVA 4CLOB 1XF9A 4XUCA 3UXHA 1OZHA 4KIFA 5EUBA 5B2EA 1C3EA 3A1NA 4UOEA 4TN1A 3BWEA 1VBMA 1H2YA 1W76A 3ICEA 5AIAA 3NASA 3IRUA 4XSGA 2CL6X 4K3VA 3LO8A 2Z1MA 1BZYA 1UJMA 3IVRA 4Y2VA 2IQIA 1WNTA 2IDZA 3STZC 1RMYA 5H80A 3WL3A 4B3MB 1D0IA 2AXEA 3BBPA 3ZVLA 5F98A 4QJBA 4EB6A 1USKA 2L2QA 5LD2C 2VT6A 4YVFA 2OXIA 5JMTA 1ATZA 1SC1A 4LJLA 3ZTTA 1ESEA 4M49A 5CMUA 4G2TA 4ZYTA 1HNXO 3JD4A 1R12A 1V6AA 4FMDF 1SU4A 4P4TA 4R71A 3CUSA 1YV9A 3LX6A 3CPHA 4BUCA 2ADPA 4C7XA 4EPYA 1TUBA 3A0RA 1UMDA 5A3RA 2NSYA 1Z13A 4L6CA 1RDFA 4OP3A 2O2CA 3SDBA 4TLCA 3OEED 3A32A 1YIAA 3PXXA 1HV8A 1D5CA 3ODGA 4P3KA 2H31A 4U9IS 5BMVA 1UP6A 3W6ZA 1JI0A 2ZJ2A 1JEQB 2YV1A 3N59A 3WJRA 5FI3A 1YIJV 3U4AA 1IIBA 3GXOA 1K0UA 3SJAC 4CLEA 4BT7A 5BW8A 3K14A 1WMFA 4D8WA 4I7EA 4FKMA 5BN3B 1AC5A 1QHHA 2NTNA 5FUQA 1NOKA 3HABA 2XY4A 4CR7A 1RZRA 1G2PA 3SYRA 4G0WA 2ZJZA 2ZRLA 1XJ5A 1CY1A 4W1RA 1G5IA 2ACWA 2N3ZA 4MWCA 4GKVA 4RYLA 5A6SA 5EJ8A 4ZXPA 3WFJA 4UMVA 4WOJA 3CNEA 1JIJA 2X8JB 4DGQA 2GB4A 4S0ZA 2O0MA 5A9RA 2P6RA 3K5NA 1QP4A 3I09A 4FWBA 1PYGA 4IOMA 4OX9Y 1I24A 4LV8B 3JZDA 3M3PA 4KIUA 2JFNA 4IOLA 1X15A 4F1JA 3PGA1 2ZIOA 3KHSA 3ZQKA 3HRKA 3IEKA 3VA7A 4L3OA 1F23A 1LW6E 3H5AA 1RHUA 2GHQA 4BZPA 2FJUA 2V98A 4P86A 1V2GA 1NVFA 4BIMA 2HTFA 1SCUA 2P77A 3B52X 3KLNA 3OMWA 3L92A 3UATA 3OQ6A 4H44B 1RXWA 1ATIA 2R00A 5EFOA 3B6EA 1E7SA 1HE4A 2WU1A 1W0JD 2R8BA 3FNEA 5DMHA 5JEDA 1OBFO 2CYCA 5ALHA 1AVMA 2BEWA 4DQDA 5FOSA 4AXBA 4E70A 2EULA 2R2GA 2RJ3A 5JAUA 4KAFA 2RMKB 4O6VA 5C8XA 5BSGA 1BC5A 4HDKB 3B2NA 4PZ9A 2AD5A 2VHVA 4K3AA 1EH5A 2AA3A 1JHMA 2XEDA 4KN8A 4UUNA 3TB4A 3OEHA 1IHDA 2X22A 1WDLA 2VP6A 4ND2A 4PZYA 1H2GA 1KJWA 1E1RD 3GF4A 3ZX4A 4LE2A 3CSDA 4B3JA 5ALSA 1EK5A 1QV6A 1N8SA 3L0SA 1MX9A 1PJLA 3AG3B 2PXHA 4UXJA 1NUSA 3ZWVA 1J49A 3G2QA 4MYSA 2VC2B 4ZARA 1KQSU 1H2HA 5LXTB 1E2MA 1T0UA 2Z9DA 3D2LA 3GRZA 3I01A 2PJUA 2IY7A 3JASB 4MQEA 3K05A 3QH4A 2B30A 2O3TA 4O0LA 4RSHA 4RX1A 1AGRA 2W37A 3H87A 1P81A 4YUXA 3QBTA 1P7WA 2OZEA 1JIQA 1UPBA 1I7FA 2NYRA 3FH0A 5JR3A 5JO0A 2HF7A 2Z2IA 5K3SA 2WP0A 3JALB 1L5NA 1OJLA 1TLTA 2Q6KA 2HA0A 4G5RA 1JBEA 3HV2A 3FLMA 3T8YA 3UKOA 4Q4AB 3CC4V 5MGBA 5CPBA 3EH2A 4CV0A 1Y5LA 4O02B 1MMFB 4MVSA 2K7FA 2BWJA 2ZWMA 3KTFA 1WDMA 4JT9A 3TQFA 3BPSA 5L4NA 2YJGA 2VF7A 2DC1A 2G8NA 2WUEA 1ZQ9A 2MJLA 1Z08A 3HEBA 3LI2A 3N6RA 3GQBB 4RH1A 4K35A 1FNDA 4J0CA 2VXCA 2ISQA 3RV4A 2FE1A 2O19A 1TQ2A 1P7BA 2DHCA 4I19A 3J80M 1C7ZA 3TZQA 2VA9A 3G8YA 4DTIA 1JSZA 4PCAA 3J7AR 1VKJA 1N6KA 3HK2A 2CJWA 2IP4A 1E61A 3I9KA 2XUZA 5BRNA 4UCTA 3HUFA 3OAAA 1QLHA 1VL0A 4TXHA 5IAOA 1BD3A 3MMNA 3N74A 5A5EA 3N0WA 3OTFA 2PZJA 4Y9DA 4BVTA 4ZYUA 1UT6A 1RRKA 3UO8B 4S0XA 3JSNA 2PGGA 4HP8A 5LYYA 3TX2A 2QM4A 4XX1A 1UBCA 2Y3IA 1MTZA 4ZHQA 2I1QA 4KXRA 2IHJA 3W06A 1ISIA 4FOSA 2GX6A 1GVNB 4BRZA 2BIFA 3FPLA 4H1HA 3LCMA 3PNLA 2JI9A 4L51A 3JD2A 2J67A 2V5UA 2VYFA 4FDAA 4WJKB 5HIAA 1YHNA 4QBKA 1SOVA 4Z9FA 5IHXA 3SIPA 4JF3A 4LF7O 4NL4H 1WSWA 4C4AA 4P32A 3HU3A 3LKBA 2JCBA 1SK9A 4D8UA 2IYYA 3KWFA 4ZOBA 2NYUA 2ZRIA 1PJTA 3SI7A 5IC6A 5DYYA 2I7VA 1MB2A 2VPQA 3WSTA 3TGLA 4G5HA 1GO3F 1P17A 1ML3A 4F93B 3AVXA 2I71A 2LO1A 9LDBA 1WLEA 2OFXA 1DG3A 1BVRA 4AG6A 3LG2A 3W05A 5EBLC 4Q4AA 1MC5A 2EIHA 1XNQO 2J7KA 1QBKC 3KL4A 5EMJA 4Q19A 2D2XA 5DTJA 2LTAA 3AETB 1MAWA 1HG0A 2YFQA 2Q1YA 5FNVB 1A5ZA 1KVTA 3K0AB 4NNPA 3FCSB 5AVRA 3RKSA 5CM9C 2Z8YA 1JF8A 2B1QA 2X58A 2X5NA 4FSXA 8GPBA 1PV2A 4ABTA 3ZD7A 2CL0X 2IEDA 4PYMA 1NF9A 2XB9A 2POCA 1VIBA 1ADCA 1XP8A 2C1ZA 4UNPA 3PNYA 1KP3A 3FCYA 3P3NA 1F8UA 3EYAA 3OOEA 3RTGA 4GZMA 1N92A 5AVUA 3RVBA 1XDSA 4BZZA 3F6EX 3GRRA 3AVOA 5CBHA 2A84A 2GF9A 3AJEA 2CJXA 1QPGA 1MKYA 4O08A 1QFMA 4PINA 5EMNA 3WFVA 3U4CA 3PNPA 4OQXA 1I2ZA 1N57A 2OSVA 3AM3A 2YEVB 2DSTA 4IINA 1L5MA 1VLHA 1F48A 4NMWA 1T4BA 3GYQA 3HXLA 2RBKA 5E2BA 1KE2A 5LIPA 2O8FA 4N8SA 4N3BA 4XM0A 1Y42X 3CCQF 1KQOA 2CMHA 3B1ZA 3NOQA 4RZHA 5DYTA 4AP6A 3PUXA 4JOSA 1VSQA 1BMQA 4HPJB 3WKAA 2C2KA 4HLUC 1OFUA 1XZGA 2CXXA 4OJMX 4B75A 4JSRA 2QXYA 3NC0C 2XQGA 4N54A 1N3IA 2QZJA 1P9WA 4C82A 2G82A 2EJ7A 3LSYA 2EZTA 2H92A 3LFUA 1YIJF 2FEWB 4KDCA 4ENVA 5C8ZA 4CKCB 1URPA 2X23A 2YIDA 1XZ8A 2OM2A 1ECLA 8OHMA 3CCLF 1WDWB 4JB3A 1YB7A 1YJAA 1N6NA 1NH2B 2P9GA 2QR4A 3KG2A 2DYSC 1KMIY 1YE8A 5JFOA 1MUUA 2ZT6A 1EI9A 5COAA 3PNVA 4X64O 3AETA 4TTIA 1GWNA 2HRBA 4QOEA 1P45A 3DDZX 2Z4RA 3BOSA 3LK7A 3VTAA 1S8NA 2FPGB 4KPGA 1DMRA 3F5WC 1Q16A 3DM5A 4BV2A 4TTTS 3L7BA 2I6XA 1WXQA 1X8LA 1Z7YA 5E4YA 4PF1A 1QG2A 1X7WB 3F78A 1TIBA 2PHNA 2IXAA 3UHPA 1HI9A 4B3SB 1NMUB 3H5LA 3HJNA 2GQ0A 3I6MA 2H2AA 4ZEXA 4QUEA 3NV9A 2GLTA 3QU9A 1DO2A 5K99A 4WBNB 1MCZA 1VCNA 2R8RA 5TJ9A 4LFAO 3TLKA 4B6RA 4YXFA 3MJDA 3HO1A 3IAS6 1DIAA 2K2QB 3KYJB 1SC3A 4CODB 1FY2A 1FYVA 1GQ2A 1I51A 2FPUA 2IUSA 3BIXA 1MABG 3DCNA 4H1VA 2Y0CA 3FTPA 3ZIAA 5GAPK 4YIOA 1Z0DA 2G0AA 1S3IA 4ZVOA 2NGRA 3H9BA 4H60A 3TLJA 3C6YA 3TSZA 2PBLA 3FNBA 3OTWA 4WESB 3NORA 3L8EA 3OPMA 4CS3A 1K2VN 1BX1A 1PR4A 2ZRGA 3I58A 4GVPA 1S0VA 2IHNA 3UH0A 5KQGA 2XUFA 4EQZA 3GYBA 2PX8A 4KWCA 3A4MA 4PLYA 4NZPA 4JUFA 5KNBD 4OH7A 3ZWAA 4AUMA 4BNHA 4RV9A 2HS0A 3SJCA 3A1SA 3V97A 2WTNA 5K51A 2BEVA 2XQVA 3KYBA 2W2LD 2HGSA 3IT0A 2CXTA 2UXCO 5BT9A 4PFJA 1P73A 2NU8B 4FIDA 3BMOB 3W5SA 3A04A 3EULA 4FQ8A 3ZGLA 4KXWA 5GINE 4JC8A 3HKEB 3ZHVA 4QDOA 1R8JA 1CLUA 2VQEB 4DLVA 3H65A 5CURA 2CFCA 1PEDA 2F3QA 4XEUA 3RUAA 5MDHA 3HEMA 2YWJA 4XOIA 1Z45A 4AG5A 1AKTA 2WYUA 3BCHA 1PL8A 3WLRA 5IBQA 5JOQA 3FLEA 3RA5A 1KWKA 4WZAA 1IUPA 3C3DA 4D4KA 1OHHG 4BEVA 4MVJA 1JKFA 2FPOA 2C3YA 1KSGA 3Q3CA 2I33A 1E1DA 1RQGA 1K27A 4TKVA 1OAKA 1DF4A 4Q20A 1ZH6A 2BEUA 1CUVA 2DBQA 5TARA 3UAWA 1NQOA 4PICA 3QBEA 4WECA 5JD4A 1G21E 1KO5A 2AN3A 1YZNA 1PDOA 5KVQA 1OC2A 2PUTA 1K73H 3K96A 5IXYA 4KFUA 1M2HA 4IXTA 4MUIA 4L9SA 1MG5A 1P0PA 3D6AA 4C6TA 2QAGB 4JI6O 1RBQA 2ZYVX 1KMMA 1QS0B 3CX7A 2CNOA 1Z56C 1H05A 1DC4A 2FWPA 3L1UA 4JY7A 4YBZA 3KXKA 5AJXA 1IQRA 5DRYA 2C0CA 1E5LA 3A9CA 4CMJA 1FJGB 4W5OA 1UZNA 1RYZA 1AUOA 1E0SA 1KAMA 1RRGA 3FMGA 4RXTA 3BREA 5EHNA 5C80A 2O3RA 4CIYA 4Y98A 4ECEA 1JDBB 4G41A 5K8LA 1N9ZA 3JVIA 3RSSA 1XPOA 4F86A 2J5XA 4KACA 3QU5A 4BJ1A 4OXYA 3D02A 2Q3HA 4MR7A 1JLLB 2H4JA 4NZZA 4ZOCA 3ZCPA 1OSNA 3AVYA 1EJ2A 2WJYA 3G7SA 4MJ7A 5K3CA 1FKAO 3CRRA 1LPBB 5E1MA 5LU9A 3KKNA 3BGDA 2H08A 1Q22A 3E1GA 2G5TA 4N5LA 2R6AA 3WZLA 2Z6QA 2VOEA 3P4UA 1PQYA 2II6A 4L0QA 5F4BA 5BVGA 4I0WB 3U09A 1EUCB 3CG4A 3RH0A 4GLXA 2VQEO 1GG5A 2QUZA 2DFKB 3C3SA 3GH3A 1MMMA 4Q1FA 4Q3DA 1ID1A 4GR9A 3R6WA 2G70A 4DWWA 5AKXA 2NW6A 1VCIA 2VDNB 3T1QA 1EAMA 3BTUA 1RS0A 1VQOV 3CSSA 2YIJA 3FGOA 5JSUA 1D3AA 3WIVA 3AEXA 1M1KW 3ECAA 2FI1A 4UHEA 1QG4A 1TDJA 3OF5A 1XQWA 2ZWPA 4FDMA 1H85A 2VCYA 4F4LA 3HVHA 5EQJB 1Z6TA 5K3FA 3PZRA 4ZVRA 1EVIA 1H2FA 5LCXA 4G0ZA 2WY2D 2P8SA 1N2EA 2EIJC 4IL6Z 2V8BA 3PNOA 4UMEA 1AX9A 2VDOB 3GZTB 1T4CA 4GPZA 3DTYA 1NJFA 4Y9TA 4ZCTA 4B2PA 2F8TA 1R6TA 1P1FA 1T4CB 3A9WA 3PC2A 5F64A 4AI8A 3Q8KA 2RC6A 4Z0NA 2HU2A 4LF4O 4NJEB 1WXDA 2YMPA 3K7EA 5KZMB 1OJ7A 1MJGM 2C2AA 1PSWA 4LVOA 4NHOA 3EMDA 3FR8A 4PA6A 5DSZA 3WGUA 2WKPA 3PRYA 2A0UA 4M22A 4HMOA 4KN9S 3T9BA 3Q3JB 1YL5A 4YPOA 2A9QA 1U5AA 2FV8A 3D8RA 4FXOA 1OXMA 3OPVA 1MX3A 1XF1A 1AKYA 2B99A 5KHKA 1IJKA 2FQXA 2ZI4A 4FNGA 1EWRA 4Q9LA 2Q6VA 3DOCA 4RVDA 3UAYA 4PRLA 3TG8A 2FN4A 3RVZA 2IOQA 1YRBA 5AI0A 2BTEA 1PPJH 3EVEA 1OZFA 2HKOA 2VPXA 2QKCA 2HR1A 2R8YA 5K3BA 3QV1A 4XWTA 3S55A 2P22C 2BW0A 2F3SA 2Q3FA 2WAOA 1QKJA 4LCKA 2ZXFA 3PDUA 1SM4A 1R9NA 1YS2X 3QVOA 3V7EA 1WVIA 2A59A 4JLKA 3CV3A 3QBJA 1MB4A 3QUCA 2B7BA 3KX2A 4I8IA 3W2HA 1JLMA 4C4WC 1ADGA 4IKEA 3OOYA 2QG9A 1JA1A 5NULA 3O03A 3OC6A 4EVQA 1CQIA 1JKIA 1VMGA 3EIWA 4GBMA 3DWFA 3CB4A 4LYHA 5DFAA 5KKCA 3FWYA 1NURA 1F6WA 5IAEA 1VQ4V 5ARBA 3V2IA 4PC1A 1JHXA 4UM9D 5JJBA 1QGED 2IUEA 1NW9B 3KD3A 2A0LA 3VR2D 2UZ4A 2DUUA 4ZTZB 1NBMD 4XR4A 4W5TA 2C97A 1FNBA 5CK4A 1S02A 4ZDWA 4LK2A 4GH5A 1ZP6A 3RK0A 2WT4A 4PSVA 3D3JA 3QVGA 4ZV7A 1RBMA 1TFRA 2OCXA 1SUIA 2A0FA 4LZAA 3SKXA 1GCOA 1S76D 1V3UA 2Q3EA 1IXBA 3ACBA 3PITA 3BDVA 4L5IA 1UDBA 4UDYX 1VQKV 2QJWA 4R1MA 3ZW8A 4FFKA 4E4TA 5JZOA 1SXJB 2NP7A 1QOQB 4J7XA 4H33A 1EM8A 2NT4A 4LYYA 3A6EA 5TY0A 2PMEA 2Q8VA 4QOSA 2I3DA 5ABPA 3PPXA 4ASUD 2QEXF 4N5NA 1UF9A 3H9JA 4LXHA 1U43A 4URHA 3CF2A 3AESA 4X41A 3GWKC 5A4DA 3ZW7A 3NPAA 3R7AA 2KJQA 5LBTA 4CHTA 2W2KB 1TQDA 4DDMA 3JASA 3MRVA 1V8DA 1ZOSA 3NM5A 4Q02A 1GPKA 1ULAA 1QO9A 3PEUA 1ZZEA 2ZDIC 2ZAYA 2G04A 5EIBC 2XVZA 1J8FA 1K7SN 1XQ1A 4GPBA 1CFZA 3FPIA 2AR7A 1Z2PX 3O8BA 2PX2A 4YJGB 3OWOA 4A0QA 4JDUA 3CX5F 2QUIA 2R1VA 1I14A 3ICPA 3L84A 4DV5B 3PF8A 4G3XA 2HQSC 4GMHA 4KQMA 3OMNB 1XHZA 3AEIA 1HO3A 1Z5PA 2WZCA 4LHVA 2VTBB 5AQ1A 1G3QA 1CVLA 2E1RA 2GASA 2P9BA 1ZUNA 2YJNA 5J2UB 3MINA 1V8PA 4EHFA 3GT0A 3K5PA 3QPCA 2RGUA 3IOCA 4RIGA 3REQB 2FMFA 5DVZA 2EOAA 4FM0A 2Q62A 2XNDA 3C3WA 4E14A 4UCXA 4F97A 2C58A 2ZUFA 1A9RA 2FHSA 5BV8A 3KUDA 3O95A 2VUIB 3M99B 1P84F 1JDUA 3NTQA 1K3EA 5HFAA 1U0GA 5BMVB 5J4KA 3DMGA 2FLVA 4X3MA 4HH4A 1H1LA 2GRAA 5TC4A 3KPYA 3PD7A 3SN6A 1ZICA 3THSA 2XASA 2EKQA 2WD8A 2YX1A 1U0BB 4GPAA 2J5QA 1PM9A 1E6EA 1R00A 3L77A 1N3BA 4JBIA 4PHTA 1FUUA 2CV0A 5EQFA 4B46A 1S8FA 2ODNA 4EVSA 4B48A 2HMYB 2XUAA 3C3JA 3U6KA 3MMSA 3X2QB 4UE2A 1IZYA 3DQPA 3S0HA 1KPHA 3K0EA 1BAPA 1DHRA 1XZKA 4B08A 1H0KA 1W85B 1W4CA 2XYVA 3O1HB 4KSYA 3SX0A 3ESAA 4MPPA 2IH5A 2J3HA 1GEGA 1FFAA 1X1RA 4Z0HO 2ODPA 1DUIA 2ZTLA 3VKUA 5EY5B 5AXDA 3UUEA 4ENRA 1LKZA 3D8BA 3GFOA 4WASA 1QLNA 1VLJA 3ANNA 3IR6A 4XJVA 1XDWA 4XPZA 2FX5A 1MC8A 3KTAA 1O08A 2A0YA 1SQ5A 2O8EB 3OX3A 3I5UA 1AI7A 5B1OA 2HIMA 2R11A 2B69A 3KS9A 4G0QA 2AFIA 3H8WA 4HRYA 4UCQA 4CKBB 5KNDA 1IEVA 5EB0A 4DLAA 5CFOA 1F2VA 5COQA 3T5MA 3ZNNA 1VLVA 5IZCC 2LIPA 2BAGA 1Z68A 3UKDA 3OE7A 3UK6A 4MP8A 3OQBA 4RACA 3NJ4A 1SVOA 2JB9A 4I4CA 2B1GA 4DV6O 4EB6B 2L19A 2QVBA 3IDSA 3R2JA 3K79A 2HF9A 3P9ZA 4PYNA 4PCVA 4MRSA 4RKEA 2VNKA 3DAYA 4RK0A 2H11A 2ZYRA 1QZTA 3L02A 1SHTX 1ZGZA 2J0UB 2W2PA 1F06A 2WC1A 3N7TA 3AFGA 1SBZA 4KK3A 5AKIA 3ZLBA 4A8HA 1NQ5A 2CV2A 3L18A 1NC1A 2HA5A 1QVFU 1HE8B 3W4IA 1KYYA 4OLHA 4F4JA 4CS4A 1N0UA 2B4YA 2XV1A 4ZVKA 4CUKA 1DX6A 4U6SA 4EX7A 1K8XB 2YBEA 1L7BA 3PWTA 5EG5A 2PEYA 1GKUB 3STVA 4YJ2B 5DH9A 1YNOA 1SQVH 2ZYWX 3M2PA 4XUGB 3RU7A 2WHYA 1K5DA 3HB9A 4D4IA 1TB4A 2C42A 2ZWAA 1VQNV 1EMDA 1EX1A 2FW7A 5TGDA 5LZ8A 1KL7A 1CR6A 4J1NA 4JENA 5E1OA 1G8AA 1L5WA 3OEHD 4Q4JA 4DOMA 1KI7A 5AW1A 2P4EA 3PV0A 4C3ZA 4WY2A 4YP9A 1BQ3A 3H4TA 3OO0A 4M7PA 1KYVA 1J7KA 4HZ3A 2O06A 3A11A 1EK0A 1JDSA 2XZPA 4NYIR 4KGXA 1X1QA 1E9EA 2R6CA 5FLYA 4RD1A 1HDJA 4PLTA 5ALGA 1Z5GA 3GJQA 3D4OA 4QPKA 2D3TA 3KTAB 1Q0HA 5JMOA 1B6SA 2AN1A 1GGMA 2IY8A 2JLBA 4EUHA 2WT9A 2CZGA 3CWZA 2CNLA 4RD2A 1NNLA 1NQXA 3VNQA 4OQMA 1L7MA 2DCUA 3WWDA 4B6SA 4YALA 2ZDHA 2VWGA 3U3XA 1EE1A 2AFHE 2EG9A 1UKVY 2PZMA 3TZEA 3VAAA 3W2FA 1PL7A 2CEKA 4PHHA 4GOXA 4MUXA 4PS0A 5GGXA 2XKBA 3I9NA 3IPYA 3R5SA 3U40A 2O8EA 2BSKB 5LQKA 1CRWG 1SKAA 2BMEA 2CVQA 1PT9A 2QXTA 1YUMA 4E5DA 4Q21A 4FI3C 3DPSA 2WHQA 3T5DA 3D2CA 3OIWA 4Y2SA 821PA 1UBFA 1H2LA 1KQ3A 3I64A 3PXAA 1ISPA 1GAEO 2F90A 1QC5A 4QDXA 4GP7A 2W2MA 3RTDA 3CRCA 1EG7A 4FQ7A 4X6UA 2Q73A 4JASA 2J0EA 2P5TB 5I3CA 2GNOA 4YRTA 2QWQB 3SIWA 5K0GA 1BQZA 3CRQA 1U1CA 1KARA 2H1WA 3ZHZA 4A82A 1B1CA 2HU7A 3ESXA 1YB4A 4TL6A 1R88A 2JVJA 3TINA 4DY6A 1VPWA 3LCVB 3WLLA 2XMRA 4I1RA 4TYMA 4B7XA 3O8RA 3CJQA 2PX4A 1A69A 3P9KA 1GA6A 2GLUA 1G59A 2MSNA 1KBZA 5I7OA 3P9PA 2DWDC 5IKEA 4I2VA 5KAFZ 1KMIZ 1BVUA 2QRVB 4Y6PA 3W7AA 4IM7A 3SE7A 1NUPA 2YCLA 3SQWA 3JTMA 1SKBA 3P19A 3O8QB 1RWVA 1J5PA 3P20A 2PGXA 1J20A 1U9ZA 2WVAA 1C8LA 1VXRA 2AHOA 1UEIA 2CHTA 1PD1A 3HNRA 4PPGA 3V7UA 1R1DA 1QR6A 2H3EA 3W78A 4LGVA 2XAGA 2GSWA 3FE2A 4MQLA 5FUYA 5FJIA 3HTXA 1P91A 5LYJB 1ZINA 3KJXA 3OZAA 4X3CA 5FFMA 3SQMA 3T34A 3T35A 2BTQB 3EHDA 4R7GA 1ZUNB 4UDXX 4TVOA 2VSNA 5IFKA 3NAGA 4V39A 1TX4B 2QTHA 1K8YB 2AJBA 3TQQA 1GNVA 1GNTA 1GOTA 3MELA 1CDZA 3PFIA 4WLUA 3FFXA 3UWMA 2Y0IA 5CVUA 4GZRB 2Y4UA 4IJ6A 4LVUA 4QTTB 1EZJA 5BY1A 1DIHA 2E49A 2F43G 1GYRA 3IGFA 3IQZA 3ORYA 1NXPA 3M6IA 4HH3C 4MVJD 4DJJA 1IWPB 2Z2YA 2UVDA 1KO8A 1XD2B 4X89A 4WMLA 4F11A 1XDGA 3B6ZA 4DR4B 4DJAA 1PZXA 1Q92A 3JD0A 1K63A 2DWOA 4OL9A 3K6SB 1JNXX 2QV0A 1X7HA 1L5FA 4FGSA 5GP1A 1Z7BA 2G0NA 2GPWA 4RY2A 4BJ3A 3X3HA 5C5IA 1Q1NA 4U8HA 1Z0JA 3E3AA 5L3BA 3KT6A 4FFLA 4M6WB 4OFZA 3Q3IA 3C8MA 3IJ5A 5IT9A 3G71F 3ZCVA 3N8DA 1DKRA 1WVMA 2YR0A 1JIVA 3JZAA 3FPGA 5F1PA 5HXUA 3BE4A 4ZVMA 4YMHA 3ZK8A 5JNTA 1DAEA 3LPLA 4KFCA 3PFFA 3J7AC 1EFUA 2VA8A 2Q3DA 2SNIE 4RPKA 3RADC 1JEYA 2I4LA 2XOKD 1KC8W 2BH2A 4BKPA 3DXXA 3UT6A 2QMZA 5ESRA 2IYNA 3K1AA 3T2MA 4QVKA 2BJHA 1FFDA 4HAZA 3RC2A 1Q0LA 3GDFA 1F0PA 3LYLA 1GTSA 1VZ3A 2ETVA 3DQZA 5DGIA 3ZLUA 5M5BA 3R7NA 1HF3A 1XV2A 1SZCA 3MCUA 1Y4UA 2CHFA 4RGYA 1YZUA 4K05A 2QE7G 4NEQA 3AHHA 3SJBA 1X7XA 2JIZG 4I6EA 5DWDA 3AG4B 2OP1A 3MYYA 1ZGBA 4J9YB 3DWIA 4K8ZA 1M0SA 4MITA 3NALA 1G291 2O3QA 4J43A 1WZ2A 4ZEWA 5TQJA 1NTZH 5K0ZA 4MWSA 4B9EA 3HVIA 1K89A 2O7QA 3GI1A 3GQBA 5EYPA 1GM7A 1GSHA 4NZOA 4UNQA 4B40A 4K81B 5KWSA 5JJLA 1X13A 3PR1A 4W8OA 5JTTA 3WB2A 2W6OA 3R5JA 3GFBA 3O8NA 1PJ2A 1BNCA 4YQZA 3F0TA 4LY6A 4M99A 3PEWA 4TQ9A 2FMLA 1FSGA 1UFQA 1TZ2A 2E74B 3VQWA 3KQOA 4ZVSA 2ITCC 4NCXA 5FHQA 4EJSB 4PQFA 3R7WB 3G6BA 3MCWA 4R9RA 4F71A 3PXEA 3LY7A 3O91A 1QKKA 3K6SA 1SUPA 2FX2A 1TC1A 2HDHA 4E30A 4FMDB 4YA6A 3VR6D 5CXUA 1K3UB 1K2WA 2PMWB 3PNQA 2W90A 1ONSA 3R6GA 2BOVA 4DPLA 1HZJA 3HB0A 5IXSA 2HMUA 2ARHA 2WUWE 1QUEA 4HAOA 1PNTA 4U7FA 3LCUA 4GP6A 1OF1A 3ZZ1A 3LIIA 3JYQA 1DWUA 1S2LA 3U7JA 1W1WA 5HGXA 5K6AA 4NV3A 5EXPA 5GIPE 5JBIA 3WA7A 3V42A 4F5ZA 4RD0A 3A4YA 4BCBA 5B30A 4XVCA 4QX6A 1B41A 3PDCA 3QXXA 2PANA 4L50A 4EH1A 1TKBA 2MINA 3OBIA 3DKKA 2EW8A 3D3NA 4A6EA 3EW7A 3W8NA 3C98A 3H2ZA 2VH2A 1IZZA 1T9KA 1OOEA 3PHIA 4NOJA 4Q5IA 1SBNE 3D9QX 1RQRA 4V38A 1IV2A 1R74A 1E1CB 3N2LA 5AHRA 2NU6A 5GMOA 3M1XA 3O9ZA 1M56C 1G3UA 5LQDA 4YHBA 1IY1A 2CDCA 1CRPA 3TQRA 4DAEA 3QYPA 3JYLA 4RA9B 3ORQA 4KI0A 4BBAA 2YJ6A 2OWOA 1Y3BE 2FOLA 8ADHA 1BU5A 2E87A 3ORRA 2UYYA 3V2GA 1O0BA 3EFFK 3WYGA 5CB4A 2YIBD 4A15A 1UEXC 3CF0A 4LTDA 1COWG 3SP1A 3AEUA 4CL8A 4RUFA 1Q95A 3R24A 4G0YA 4FDVA 4KVAA 4RZQA 1BYIA 1XREA 4QAJA 3KUXA 2UZ3A 3BFKA 2X2PA 1U6IA 2H4XA 2QRHA 4G85A 4QQNA 4X00A 5C32A 4EHHA 5K3AA 4A8JB 2E4WA 3V55A 4AMZA 1VJTA 2FMHA 3K6RA 5FPKA 2CGEA 4IOJA 1G9SA 3TMKA 3AUJB 1SB9A 5U4XA 2XF8A 1IZ9A 3B2EA 3LBAA 2HJWA 3ZY4A 2C4HA 1AK1A 4DR6O 2QTMA 3LGSA 4PHCA 4UPEA 3BT7A 5T41A 1XRNA 4ER3A 3J7AU 3TSWA 4DV0B 1XBTA 2V1XA 1P61B 5B53A 2QOEA 5ALVA 1A72A 3M33A 4IW3B 1QF7A 3QKUA 4JEIA 4UDNA 2VQFO 4KFRA 4DW8A 2WIBA 1UM9A 1DBPA 4J7UA 3BICA 2XDWA 3FX2A 3THWB 5IZ4A 1BEEA 3NC1C 3L8FA 3OWXA 1JX9A 4Q1EA 1MZPA 2RJZA 5GPBA 2X6AA 1SULA 3H19A 3WNQA 2Q5OA 3L4EA 2DM6A 4L22A 4M53A 2HYIC 1JHVA 5D5QA 3DUWA 3SYPA 1E6CA 1Q0RA 3ITDA 1U8ZA 2DUJA 1E32A 1OX4B 2FR1A 3H9EO 4HAYA 4YFVA 4G4SP 3FFAA 5BR7A 1R64A 1I0HA 3GIWA 1X92A 1DEAA 1MC1A 4K6HA 1EA5A 4N18A 3R7BA 5C8YB 5SYMA 4DLRA 3GB7C 2PQ6A 2OPHA 1G9XA 3T1CA 1W19A 1Y8AA 2H1RA 2H8CA 2DU8A 3WK5A 3GLHE 2F43A 4IF6A 1RADA 4X88A 4C04A 3EW9A 5EUMA 3UB4A 3GLIA 4B3TO 3MAAC 3OMXA 2KX7A 4ND7A 1J1UA 2IIPA 2VBFA 1NVGA 1GFWA 2B83A 1PK8A 4YXWG 2R84A 4RM2A 3ABTA 5FTNA 5DLPA 3HR0A 2A06H 5CB4F 4G4YA 4H7JA 1JMKC 2VDWA 1A7KA 2Q2VA 4R16A 2Z5LA 4YLYA 3RKRA 1BFKA 1TZMA 4YAWA 3Q3HA 5LBQA 2HLDA 4WINA 5FJ4C 2J6IA 4GHWA 4CYMA 3QOYA 2I67A 3SEAA 1JE0A 3IVGA 2ZJ1A 3A1VA 1O2DA 3EVZA 3LWPC 3NBQA 4PQEA 5L95A 1C30A 2WV9A 2CCKA 5EXTA 1KS9A 3II6X 3EPJA 2X3UA 3JAKA 2AVDA 3KR9A 1ZHHA 3N87A 4QBIA 4YBRA 4F21A 4AU1A 5K4HA 1XTKA 4LBEC 3FD5A 1USVA 4E46A 1NJ5A 2YVUA 1FUEA 2EIJB 4E5VA 3KJHA 1PJBA 4MINA 4MMYB 3DD1A 4EEKA 4Z7JA 4MIOA 5ELXA 1DKUA 3PRKE 4AG3A 1G8PA 2ID9A 2XI4A 1JN0A 1GDTA 4ARZB 3F6CA 2HMTA 4Z9XA 2WTEA 4K9DA 5KYKA 2AK2A 2WMYA 3D36C 1QLEB 4RTRA 3QY9A 2XAHA 4FUQA 4EIWA 3WS7A 2L18A 5SZHB 1N32B 3FJOA 3O83A 4YCNA 1PIWA 4QAQA 4L8FA 4EKGA 2VP0A 3DAFA 3SYTA 4ZIBA 5DW3A 1OZAA 1RJWA 2WINI 3RJ9A 1A2BA 4CR6A 1M90W 2CD7A 3H6KA 5TQ0A 1H2NA 4IJKA 4C5AA 2ZW9A 1A97A 1G8FA 3N2YA 4QT0A 3QU2A 3ZK7A 4ANFA 2ZKLA 1PG2A 3GRVA 2C95A 5CTJA 1OX6A 2GFQA 2XUGA 1L7RA 2DYRB 2VPPA 1O54A 1BCSA 3GGJA 3HU5A 4N3AA 4EY4A 3LNMB 5CVTA 1CDDA 2ZYIA 4WOBA 3FYEB 1W5AA 1SG6A 4CM4A 1CVIA 3CEMA 4IILA 2IS6A 5H81A 2EATA 4DR6B 4GW3A 1A9SA 1WNSA 1F7UA 1H2KA 4RMNA 5DN6G 1EVEA 3GMSA 4FX2A 5EC8A 1LK7A 1U2EA 3QHDA 3HYTA 2GCOA 5FOUA 4ESVA 2N74A 3HLKA 2LIVA 3QSGA 4TKMA 4PV1B 1IN4A 3BAZA 3NEPX 5KSYA 1RKBA 5L3CA 2ADFA 2Z57A