5LYJB

Tubulin-combretastatin a4 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of cis- and trans-combretastatin binding to tubulin
doi rcsb
source organism Rattus norvegicus
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lyjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lyjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lyjB01
1Z5VA 5C8YB 4LNUA 5JQGA 2GVIA 5IJ0A 3E22A 4X20A 5LA6A 5LYJA 3RYCA 4E6EA 2XKBA 4LNUB 5IJ0B 3E22B 4X20B 5LA6B 5ITZA 4F6RA 5LYJB 3RYCB 4M8IA 2BTQA 5BMVA 5ITZB 4B46A 4EI7A 4TV9A 4F6RB 2BTQB 3WGJA 4I4TA 4TV9B 3WGKA 4IHJA 4I4TB 4IHJB 5CB4A 3VOAA 3RYHB 4I50A 5MN6A 5CB4B 3CB2A 3JATA 4O4JB 4ZI7A 4U39A 5IYZA 5IJ9A 3JATB 4ZI7B 5IYZB 5IJ9B 5KX5A 3JASA 3V3TA 4U3JA 1OFUA 5KX5B 1W5FA 1W5EA 2VAMA 3JASB 5LP6C 4U3JB 1TVKA 4HNAA 5GONA 5CA1A 1TVKB 3HKEA 1Z5WA 4HNAB 5GONB 5CA1B 2VXYA 3HKEB 2RHLA 3R4VA 3RYIA 5M7EA 3UT5A 3RYIB 3HKDA 5J2TA 3VPAA 3UT5B 4X1IA 3HKDB 4O2AA 5J2TB 3JARA 4X1IB 4O2AB 3RYHA 2RHHA 4DXDA 3ZBPA 3JARB 5LP6A 3VOBA 4FFBA 3VO9A 4O4JA 1W581 5LP6B 4FFBB 5CA0A 4WBNA 5CA0B 5MN4A 3HKBB 4YJ3A 4WBNB 5FNVA 4YJ3B 5J2UA 5EZYA 5FNVB 5J2UB 5EZYB 4EI8A 3JALA 5MN5A 4EI9A 1SA0A 4XCQA 3JALB 3HKCA 2XKAA 1SA0B 3HKCB 3ZBQA 1RQ7A 1W5BA 4TV8A 2Q1XA 4TV8B 4O4LA 5JVDA 4O4HB 4EB6A 3VO8A 4O4LB 4YJ2A 5JVDB 1RQ2A 4EB6B 5JCOC 4YJ2B 1FFXA 3WGMA 3M8KA 3M89A 1FFXB 3N2GA 5EIBC 5KMGA 3HKBA 3N2GB 2R6R1 5KMGB 5JH7A 4O4IA 5JH7B 4I55A 5JQGB 4O4IB 4ZHQA 5LXTA 3RB8A 4I55B 2VAPA 5EIBD 4ZOLA 3N2KA 5LXTB 4ZHQB 2RHOA 4IIJA 3ZIDA 3WGLA 4ZOLB 2BTOA 3N2KB 5BMVB 4IIJB 5JCOA 2RHJA 2R751 3WGNA 4TUYA 4O2BA 1W5AA 5EYPA 4TUYB 4O2BB 4X1YA 1JFFA 5EYPB 1W59A 3C8LA 4O4HA 4X1YB 3RYFA 1JFFB 4DRXA 4I50B 3RYFB 1TUBA 4DRXB 1RLUA 4X1KA 2Q1YA 3JAKA 2VAWA 1TUBB 4X1KB 5LOVA 3JAKB 3JAWA 5LOVB 4B45A 1FSZA 3JAWB 5C8YA 4KWEA
chains in the Genus database with same CATH superfamily
4P92A 1QSGA 3VTZA 2QD3A 1ZCFA 2K9PA 4QOIA 2DMXA 3Q7RA 1N6IA 5JRDS 3MYRA 1Y8AA 1RC8A 1NKTA 1YMUA 1RC1A 1USUA 5K4GA 1U6IA 3C15C 3FOFC 5B1BB 2DP4E 3BDAA 4LJKA 3TLBA 3LM8A 1U9IC 4WFFA 4R40B 3IMEA 4Q34A 2ZTUA 1XRNA 2J6BA 1GO0A 1XHLA 4CF3A 3KOWA 3TKLA 1XJCA 4UE2A 5ELMA 3M4XA 2G9QA 3P0FA 1X74A 4DE5A 3PQ2A 4AP6A 1DXOA 2F3UA 3O6VA 4QBGB 2LKCA 1QQAA 2VLIA 5FFNA 3VYVA 1XVVA 1GO3F 1PEKE 1R4AA 1FP7A 4NF2A 4RA6A 1GK9A 4BEWA 4I6EA 3IURA 3H9BA 4OGLA 5FO1A 3ZE0B 2D5BA 5BSVA 3AEYA 3G0HA 2LV8A 4RQFA 2OXEA 5KQRA 3E7PA 4WKBA 1T3TA 4HKTA 1H2GA 4FZVA 2V6FA 2AFRA 3IBTA 5M5BA 5EUMA 2XQVA 3ZD7A 3ZOZA 5CG2A 3WB2A 2GEFA 3B9RA 3B70A 1A82A 2QUAA 3V3TA 3KJQA 2O5EA 1HY3A 4D7SA 1MB2A 1V16B 2G08A 5D01A 3KLBA 2NUTA 1ZNQO 2H5JA 1QZZA 4XH9B 2CE4A 4J80A 1FY2A 2IHJA 2J45A 1YCIA 2O2IA 3TB6A 1DNPA 3CJHA 4DV2O 1QGUB 3ELUA 3CR7A 3H0CA 4EUSA 4IPTA 3MS4A 1B2RA 1KY3A 4K0KB 4HATA 4P5EA 4G41A 5IABA 1U8XX 1NN0A 1FPOA 2ZIAA 2GD1O 3V42A 3HYNA 5ALQA 1A32A 1XYVA 4FPXA 1UK6A 5CDFA 4BP3A 4Y6SA 3OECA 2C5FA 3G6KA 2QB5A 1EFRA 4HX2A 1C3OA 2WWGA 4OFZA 2NADA 3IQGX 4I6GA 1NF9A 3R5TA 3E9DA 1I4TD 5E9JA 2EIKB 1QONA 4ZMSA 4OUDA 2C3MA 2JFQA 4OHKA 5EIAA 2B9ZA 3I55V 1DGSA 5IDVA 1ZESA 3HKDB 1XTTA 4MVCA 5DGDA 4REQB 1NP6A 4DV1B 2EX0A 4LJSA 5TQVA 3SBXA 2QM0A 3IBSA 4DV4O 4LZWA 5AESA 4O4LB 1SOMA 3TSAA 4NQ3A 3MPUA 2AG1A 4PYJA 1K7FB 5JPIA 1PR3A 4DQUA 1C9MA 3NO4A 3WRVA 3MRXA 2DQ0A 2HRQA 3KE1A 1HDYA 5F5LA 2ZR9A 1R9JA 3FOWA 3V1TC 4BW5A 4GOND 2IXEA 2JJ1G 5EWMB 1Z8HA 4DR5O 4UBMA 3LL4A 3ASOC 2ACEA 1H2EA 4A2QA 3L6OO 2PBLA 2EF1A 3BB1A 2R9AA 2FDCA 1Y0BA 3OT5A 4XAQA 1GUBA 3GUZA 4PYMA 1JFTA 3QX8A 2PZSA 2VH1A 2WT4A 4NCAA 3SF8A 1M2GA 4N9QA 1FLAA 3WBKA 2PQ6A 2XX3A 3W3AA 2EJ7A 3FSJX 2CD9A 1X1SA 3CUUA 5B12A 1RW4A 4YUYA 3X0DA 1G4YB 4LZLA 5SYMA 4EGJA 4L6AA 2OBBA 4P5PA 4DSZA 3PJSK 3MBIA 4PGFA 3QNWA 4FGWA 1L3CA 1B14A 2XYQA 2JFGA 2GF9A 1ZG3A 2PUHA 1BH2A 4B4VA 1ZH4A 5EYPB 2C9CA 4IIHA 2PMEA 1ZUNB 4D6PA 1XP8A 1ZD2P 2ZAGA 4LYGA 4F85A 1EZVH 4GNRA 1Z29A 1FBNA 2FEMA 1RA4A 2C3UA 5TMPA 3FYHA 1QP7A 2INGX 4P30A 5BQ5A 3O8LA 3DBLB 4AO7A 1ORVA 1DAMA 1TO1E 1YI2V 5LU9A 1BX0A 5GIPC 4GLLA 2WVHA 1X80B 1L5LA 5EJ2A 3AYZB 1JQKA 1MJ5A 2FSFA 5KC8A 2BEWB 4DJEC 3EXFB 3U3JA 2R11A 5IBRA 2W2PA 4Q4AB 4KPUB 4XFDA 4B7KA 2CSLA 2EIHA 3S06A 3O9OA 1X1QA 3MXTA 2XQGA 3I9OA 4N18A 3CZAA 1JXMA 2WIFA 3ND8A 1SG9A 1MAAA 3N2KB 1EUQA 3DBHB 2CYCA 1Z5ZA 2ZIOA 2QTWB 2NMUA 4K87A 3RSZA 2E0IA 3DV2A 3AG1C 5EUCA 4NAUA 3C3TA 3HXMA 2YINC 5IT5A 3DOFA 3F49S 3KLOA 3KQNA 1UCFA 2WU4A 1UP6A 3SM3A 3SY8A 1GDDA 1CXZB 4ZP1A 1AQ6A 2NXJA 1ACLA 3A4TA 5H3LA 1T2VA 5HHTA 5FUWA 1FS0G 2Q3CA 2FZWA 5AVYA 4IVQA 3CT6A 4YA6A 4NNPA 2NO6A 1N2HA 3ABLB 5COBA 1RXCA 3GFTA 1JE0A 3ML1A 3TCXB 1JKJB 1MA0A 2I6SA 3NYQA 4J9ZB 4M9ZA 1M33A 4Y0AA 2AXEA 2Z5LA 5CJJA 4QVIA 3WC4A 5BMVB 1R0LA 5BNTA 3WJRA 4CLHA 2ZIXA 3LKBA 3KQVA 2JB9A 6NULA 1UADA 3IDSA 4F9GA 3K06A 5D3QA 2RB4A 1B42A 4RFSA 1B8UA 4KXRA 4PHTA 1Q0TA 4LCKA 1HRDA 4LECA 4DV6O 2VHTA 1EAYA 4HTFB 3ZWOA 1KJIA 4R8RA 3IBCA 3OD4A 2QA4F 2BDEA 1ZVQA 4AL4A 1VCMA 1LBEA 1X2BA 2VTEA 4DZTA 1GN6A 2C5SA 2CVZA 5L3BA 1QHSA 3I7TA 5E1BA 1GFZA 2GTAA 2BI4A 2ZUUA 4NVPA 5K0GA 5CEEA 3KV1A 1PG5A 2TMYA 4QPJC 1C0LA 3MLBA 1JBKA 3GZ4A 2IIVA 4GMKA 4UOQA 2F66C 3ORSA 3TQSA 1J33A 3HN2A 3ZHVA 1WZ2A 1TCVA 3WL3A 3WGQA 1ZK1A 5KVSA 3PLNA 1AXEA 5LKRA 4UTNA 2I1WA 2C88A 1GKLA 4B85A 2DJVA 2VCYA 1M34E 1X9HA 6PFKA 5JCOA 1KAOA 3EQZA 3KQYA 2QEXF 4UPDA 1KY4A 1KQSF 4D92A 1S89A 5HJEA 1HURA 3L07A 4P9PA 5KOHA 3N2YA 1UMDB 3C2QA 5MN6A 3BA8A 3U44A 3HK2A 3U7QB 2GHIA 3FF4A 5KTTA 1G5PA 4UVAA 1CZRA 2LCAA 3FFXA 2QF7A 3PF8A 2BE7A 4CNBA 3UPUA 1ONIA 4HY3A 3RH0A 4DB2A 3PS9A 3WFZA 4WPGA 4PNPA 5KNCA 3CC2F 1ESDA 1WW8A 2H1SA 2ETNA 5JLAA 2W6JA 3DF7A 4OLHA 3RD5A 2NGRA 2WAYA 3TLJA 1EWTA 1K8AH 2WE8A 2F55A 5JCJD 4C78A 5G0UA 3HJTA 1XK6A 3L40A 4TZZA 1XLTC 4YY3B 3IH5A 1KYXA 1XREA 1FP2A 4IRMA 4JGGA 1Y4MA 1W59A 4FLEA 1UF9A 1O95D 1RMYA 4IZIA 3KR2A 4ZTUB 2BTUA 2ONZA 4IYIA 3QVXA 2A0WA 3CWCA 3NVKI 4U7NA 1KJ9A 2P4VA 1OBFO 3FAZA 3R9KA 1O8BA 4D0LB 2RJOA 1J0DA 4GR9A 2ZJAA 2CXPA 3SC6A 4IMJB 1L5QA 3L9XA 1RHUA 2ZAYA 4RGQA 5EUQB 1YHQV 1AS3A 1G21B 4BNDA 4TYYA 2ZU6A 5EKXA 2IYOA 1SQQH 4JI5B 2PUTA 3CCJV 3LQ4A 4FFBB 1F12A 1VJGA 4UTOA 1CPYA 2XT6A 5EOVA 1XAHA 4CYMA 1KHTA 2VWQA 3A0RB 3AEUA 3RK0A 4HC4A 2QLNA 2OCYC 2X6AA 4P38A 2BV3A 2LCQA 4RVOA 5HP4A 1RAAA 3JQFC 2GBCA 1E79A 2DOSA 4ZARA 3DBVO 5K1PA 3OX4A 3HLTA 4LPSA 1ZX1A 2RAFA 3UWSA 8MHTA 5LDDC 4MZXA 1E7MA 3T61A 4R2MA 1U0SY 1P45A 1RJEA 3CRNA 3FVWA 2RONA 3KQSA 1ZD9A 2FOIA 2V7TA 2JBWA 4L3WA 4TLBA 4IR7A 9GPBA 4H2DA 2OKCA 4ARAA 5K6RA 4U4AA 4KIGA 1A0OA 2VNIA 3GELA 4E7PA 2W83A 3D6UA 3W8DA 1WXWA 1YJ9V 3C0KA 4G5GA 1S8FA 5C31A 2C03A 4R40A 1U0OC 3GLFE 4FYXA 2FN9A 4UVCA 5AOVA 3KETA 4B4UA 5GIOE 3WV4A 1MMMA 2VL7A 4LCUC 2JZOA 3GG2A 2LP4Y 1X7DA 2WZBA 3Q1KA 3G9UA 2H4XA 1AJQA 4C6HA 2CT8A 5EHGA 1B0PA 2WU3A 3P9YA 3A28A 1CB7A 1VB5A 4II7A 1SC9A 1LVGA 4CH5A 1V5FA 4U8GA 3P9XA 2FXVA 1WVGA 3D01A 1IUKA 3KALA 4ZVMA 4I1VA 4UXJA 1ENPA 4LVUA 2QRUA 4C0KA 3KKKA 4MRPA 2A33A 3D3WB 1Q84A 1W0CA 4AY3A 4Y6RA 3PXCX 1K8ZB 3ZU2A 3MM4A 1XLWA 2R8OA 4TQUS 4PAMA 5CITA 4KGDA 2E74B 1E6EA 3H9JA 3LLCA 1RM3A 1DO0A 1V16A 2WJZB 2JLZA 2PLWA 2ONYA 1JJAA 1AY0A 4R7TA 4H77A 3KU1A 4HXEB 3VUEA 1XU9A 1BYIA 4RIFA 1Y9DA 4RANA 1GZ7A 3GQBB 4M87A 2YJZA 4TWZA 1PHRA 2ZUDA 2NOAA 1NBMD 3LT5A 1V39A 3KEOA 2A9QA 1GSHA 3IR9A 1KYVA 2B1RA 1ZA2A 3I56V 2WPDG 2Y1XA 2ZYVX 1QGUA 4ALNA 4YP9A 1NVVR 1VIDA 2IUEA 3M8KA 3JR3A 3ODPA 3MCAB 2IAFA 1LSSA 1Z62A 2GAFA 1FS5A 4MS1A 5D6OA 1FYXA 1Z5UA 5KSOA 3M9WA 3CEIA 4ZVSA 1FYWA 4KXLA 2Q5IA 2QMEA 4ARZB 1BE6A 3WSVA 3EASA 3GJ8A 3K14A 2QP4A 2VYQA 2GOYA 2QR4A 3N76A 4CR8A 1RXSA 1H66A 4KQ6A 4WCVA 1UWKA 1F7YA 1T0IA 1IBKB 4GEGA 1UXJA 5AK4A 1VL0A 5AVVA 4OGKA 1NQOA 1KP2A 3HKDA 2CEAA 1NR1A 3AOGA 2J5KA 4AJ1A 4P4SB 4Q82A 2AG6A 2ECFA 4GVXA 4REQA 1UC5B 5AK6A 2ZDGA 2P3OA 4BR6A 4DHWA 3I0ZA 4LFBB 3JTMA 1NNUA 1QHEA 3B4SA 1H93A 2GM3A 1VA5A 4M9QA 3OJXA 4K40A 4O4LA 4QAQA 1ODKA 5DMXA 2PTHA 2ET6A 4GP9A 3QV2A 4IILA 5CTAA 1U2GC 3QOFA 4PU0A 3RADC 1EK6A 4RW0A 3VZSA 1O97C 4NUTA 1XLVA 1PL4A 4ZOCA 2VF5X 3KOOA 4BRSA 4K9RA 3SIPA 5K01A 4X66B 4BT3A 1PNMA 2ZSIA 4AW9A 4JUBA 4JELA 4J6FA 5EWMA 4I8IA 4HZGA 5IXJA 2MSWA 3GROA 4FSHA 2D2XA 3JQFA 2QV0A 5AFSA 3NFRA 4KDCA 1UXHA 4BE9A 2OORC 1P1IA 1LUAA 1E9VA 3ZXUB 3VMMA 3OHSX 5TQ0B 1N0UA 3IEWA 3M9XA 3QWBA 3ASUA 3D36C 4LBYA 4F45A 2FPSA 1E77A 1RI3A 2O52A 2DT8A 5AUQA 4U7HA 5DNDA 1M93A 3F6RA 1MB4A 3VPBA 1H3NA 2EW2A 2CHGA 1XDGA 4G0VA 5LFAA 1M2OB 4URHA 1Q17A 2IE8A 2OYCA 2WSLA 4EHDA 4QE9A 1AZWA 3F3YA 5AW4A 1WB7A 1QDLB 5BRJA 4HZUB 1YFZA 5HMLA 3LLVA 3VH1A 3ORHA 3O8NA 3CX3A 4H0CA 4JHXA 1XAJA 3VC7A 5EYPA 4B09A 3C3BA 2OCPA 3UC9A 2P6JA 1ZUNA 3GNSA 1AK9A 4PWTA 4O8CA 4A8TA 1E6MA 1H6AA 1YZQA 3THXB 3KQWA 3B48A 2I4NA 2GHRA 2Q3LA 3TJZA 4WOPA 2UYPA 3V97A 3GN2A 4EGAA 3GYGA 3M6IA 5I9IA 2BI8A 1JWAB 3A4LA 1IVYA 2YDYA 3KUUA 1TX4B 5P8WA 1X80A 4JI2O 2WKWA 4FLMA 2BEWA 2IYXA 4F84A 1RACA 3EXFA 2XUJA 4CF4A 2Z30A 3ZP4A 2QTSA 4Q4AA 4KPUA 2XCSB 3PNSA 3VNRA 1NJIH 3W5SA 3VA7A 1A9TA 4GX5A 2GEUA 2JEOA 1CUXA 2BFPA 5HFMA 4YAFA 5KHKA 3WGVA 3ANNA 1MDFA 2PANA 4KTTE 1PV4A 2QP9X 5BSMA 1VQ5V 3N2KA 3KXIA 4F2HA 3DBHA 3VR2D 1AKWA 2CTWA 1CY7A 2V1UA 1J49A 1MAHA 3IJPA 3WNVA 3WTCA 5C37A 5L7TA 4ATNA 3E83A 4F91B 1GL6A 2YUIA 5EZSA 4YAKA 1ZWIC 3QUWA 3ZR4B 1Q21A 5DN6G 3RT7A 3N7UA 3I28A 1K27A 2C2WA 4IM7A 4EYQA 3ACBA 2I3ZA 4LHEA 5LJLA 2PT6A 2Q4PA 3IGAC 5IF9A 3T5BA 4EO4A 1CXZA 1H9CA 5CVJA 4NEGA 2Q0QA 3AOEC 4JQZA 1JG2A 4ZO4A 2WHXA 4LFBO 4JCCA 1YI1A 1YNSA 1ZPDA 5J2UB 2EARA 3L1KA 4RWEA 2SECE 1Z7GA 4B73A 2VK1A 3BMCB 3ZWYA 3GJRA 1KY5A 4DR4B 1JKJA 3RK4A 1GZDA 3HKBA 1V48A 3NGMA 4LX8A 3ZCVA 1JBQA 3T9EA 1IN5A 3SC2B 1XOUA 2RHOA 1ZMOA 2J46A 3AVOA 3B6EA 4F3YA 3OTFA 2BD0A 2DPLA 4Y0VA 3WL6A 4E2FA 1ONNA 1JQ3A 3PYXA 2ZWPA 3FZQA 1GM9A 1NQAO 5CEFA 3NAQA 1Y67A 2P2DA 1J39A 1XEQA 4HTFA 3ETGA 4H6PA 4RPJA 1R8XA 2QYTA 1LLUA 3IKMB 3WAJA 2CVHA 5L4SA 3LPCA 3CB2A 3FLMA 2IYWA 3PCRB 2XAFA 1U4OA 2F43G 3RWBA 4DA4A 3NHKA 2OL4A 1R0CA 1IG0A 3VR6D 3IT0A 4EL0A 3VV3A 3QJ5A 2QTAA 5PGMA 3DMRA 3FB5C 3QJYA 3ZDBA 1UXGA 2VYND 16PKA 3S2ZA 1I5OA 3C4JA 2OZKA 4TPKA 1ZCBA 1D1QA 2OORA 3KU4A 3ECCA 2Z4TA 4WFJA 3Q4HB 4U8HA 1NQVA 4C6RA 2AJTA 1PR9A 3HV0A 3NXKA 1K5QA 1BDHA 4TWAA 3VR3D 3GFSA 4TYPA 4MP6A 2F1RA 2B94A 4UJ5A 2YFYA 2PR7A 4PZEA 4G01B 4J0EA 3OEHG 4DJFC 2DYSB 3C7KA 4DG5A 3DV9A 4WCFB 1A7KA 2DETA 1TJNA 1QAMA 1PJ4A 2CMFA 4DBLC 3Q11A 4L8JA 4MS3B 1F6WA 2JS5A 4ZQGA 3LFTA 1R6UA 4BPBA 3ZDXB 2ZIZA 3U7QA 2JVIA 4UBIA 5DYNA 2QN2A 3NHZA 3WLAA 3X1XA 3DR5A 3HCEA 5F2NA 1CV2A 1A2QA 3NR2A 3FROA 1NGSA 4L3OA 1OXUA 3B7WA 1FDUA 4KQIA 2E6UX 5CUQA 1Q81H 3M6XA 1SA0B 2VOEA 1XZCA 1WF3A 3QA9A 1K6IA 2GESA 3M84A 3EH1A 3N0XA 3OJFA 1KI7A 4MDYA 4A0HA 4MWEA 1CUFA 3F90A 4DDMA 1MV8A 4QPPA 5I01A 4CI9A 1WX1A 2V1XA 2EWMA 4TKUB 3D3EA 2XDAA 2QYOA 1TQ8A 3I1IA 4ZQBA 1BHQ1 4GLJA 2GAIA 1B04A 4ZO6A 4AZ0B 1AO0A 5TS2A 3LCUA 1AHNA 3CCUV 2C2AA 4KUGA 3RNLA 1PK7A 3RHSA 4RPGA 5FUQA 1G21A 3ONEA 3UM7A 3O4GA 4YCJA 2E3CA 5DTJA 1VE1A 1KK2A 4KRFA 1QRRA 4G26A 4FFBA 1WA8B 2IZ6A 2P5YA 3ILYA 4M0FA 3LSQA 2AW3A 4YJHB 5EQJB 3WP0A 3A0RA 4DR4O 2DUMA 2E4WA 2CXRA 4MR8B 4MV7A 4OB6A 1DKLA 2QSYA 5TEVA 1XF1A 1X14A 3MK31 1G63A 2GBFA 2AOTB 2W0FC 4S0ZA 2RQ6A 5FPSA 4TXJA 3D2AA 1CIPA 4CMEC 5I4CA 4M76B 1U31A 3OCVA 4MARA 3TSYA 1N6NA 4K86A 3G5TA 2JD0A 4I2NA 1O0CA 2QAJA 2D8MA 1IUNA 5I7AA 4X71A 2ZJ2A 3MNFA 4GLXA 4M1SA 3HFSA 3OZDA 2A0KA 1ZC4A 4ASUG 5CM2Z 3PKIA 2PLAA 4U63A 4CMKA 2LZ0A 4E12A 1T5IA 5F7JA 3X1YA 4HGRA 1S2OA 4MRRA 3KYDB 3PPVA 1YONA 3JYPA 2EZ8A 2ID4A 1EA7A 3WBFA 2QD4A 2GD2A 4R1QA 4TTAA 3RE1A 4DABA 2IZOA 4UPVA 1Y1RA 2ZYDA 2Q41A 1X8KA 3QG5A 3V48A 1IATA 1Y7LA 3QUCA 4FDMA 2IY8A 4MYHA 4PBTA 1XUOA 2EX1A 5D5HA 3R9XA 1JEQB 1MHTA 3LV8A 3KZMA 1N1GA 4GAEA 4B2LA 2NU8B 1AT1A 1VA4A 1P1RA 3B09A 3D3WA 2H59A 2AEJA 1BE8A 3TMKA 1COWA 1SVKA 2PU7A 2YIJA 4I1UA 2ILMA 3TOZA 1UKZA 3MDOA 2V5VA 2Q8PA 4AJNA 4J29A 3PYMA 2JARA 3RTDA 2FPPB 1H2KA 3UBMA 2Z2ZA 3T7AA 2EKBA 1F8UA 3L41A 1PE0A 3M3DA 5TE9A 1JDNA 3GQBA 3A1DA 3M99B 3SJBC 1II8B 2R97A 1HO3A 4P82A 4UTVA 2BFAA 3FPJA 1Z08A 2X7XA 2J0SA 3E1KA 2WAOA 3VNSA 2F48A 2DWUA 1HDXA 3VAYA 2IA5A 4JLVA 5BN4B 4DM7A 3MCAA 1VQKV 2EP5A 1LWNA 3CSDA 3FPHA 1XTJA 2GNOA 3AZOA 1TJ4A 3K8ZA 1US6A 4MKXA 1NJ8A 2ZRCA 1RT9A 2JGUA 5AXBA 2IH2A 1QB7A 1OX5A 2DKNA 1KZ6A 1F0KA 5KWVA 3FUUA 3N2IA 4ARZA 4AG6A 1K86A 5DLDA 3SOPA 4DXAA 4UW9A 2FUG6 1ZM4A 3I4FA 4YUVA 2QU7A 4WKNA 1Q5OA 5EJFA 1F6DA 3FOEC 3LXXA 4PO3X 4CE6A 2GYYA 4QOHA 1ZC3A 1DRWA 3ABUA 1SZTA 2VWPA 1J07A 4AK9A 1X2EA 2X15A 1L5FA 4BNWA 3JYOA 4P4SA 1Z4JA 2ZKOA 4JOSA 3R5FA 4NY1A 1U5AA 1BXKA 2X0LA 1R0XA 2PX2A 3FFBA 2F64A 4Q05A 2FN4A 2XJ4A 4WJLA 3CLTD 1S8OA 4O59O 3L7CA 5MFZA 1LH0A 4A8PA 3TDMA 1BS9A 4YACA 2GVZC 3F4LA 3ZCSA 1RHJA 4BXOB 3R0PA 3E81A 4AD8A 1M7HA 1MVNA 4INJA 4EEXA 5K8UA 5GTHZ 1IVNA 2IYQA 5AO9A 1GQRA 1BRTA 5EP4A 2DYRC 4RPHA 1VMGA 3T41A 4EKDA 3BJMA 1DC3A 2K2WA 5A0VA 1GUZA 1ZSNA 3I8OA 4BCBA 2WLNA 3D43A 3C48A 2GN4A 3N8KA 5TQ0A 5KX5B 1FDIA 4IGGA 4OHVA 2VNKA 1D8TA 2QENA 5DK4A 2G77B 4ZCPA 1N2SA 3PBKA 3I58A 3LS2A 4RJKA 2BFCA 3NMUF 1XZ8A 4H7IA 4IQ4A 2XGSA 1Z3CA 1M2OA 1XROA 1J1IA 2C54A 5JD4A 1XRGA 3LMKA 1BVYF 4WCFC 3VR4A 3R65A 1U9JA 1LW6E 4QU9A 5K8CA 1PJBA 3UKMA 1Q3HA 4HZUA 4J0QA 3OZVA 4ZXFA 2P6NA 1G18A 3CSUA 2WUWE 4NBRA 2G1AA 1KJQA 4W5OA 4N3GA 1Z0KA 3AR7A 3A6KA 1FJHA 4KN9S 4UCQA 1ISGA 4DUZO 1YJWF 4EWLA 1RYYA 4LCBA 1U1IA 3PUHA 3THXA 3UW1A 3OE7A 1K2VN 1QVRA 1KL7A 3Q8HA 3KQTA 1TC2A 3WA6A 1RC0A 2HIGA 3AQIA 2VPZA 2QHXA 2IWRA 1V47A 1ZJ6A 4CLXA 1BYUA 4PRZA 2G71A 2QTVB 1RWNA 3Q98A 2P77A 1O6GA 2DZDA 3GVCA 2Q3JA 1GKYA 1SCDA 2R7LA 3L43A 3N3AC 3VOTA 5FL7G 3CXCU 1Y4ZA 3BAFA 3PQ6A 3PR2B 4J1QA 1U96A 1QLHA 2FW9A 4D96A 1CUEA 4L0MA 4JWKA 2HO5A 4R7CA 4MS4B 3U16A 1GA6A 1FW8A 2C9BA 4YXFA 4CKYA 3B5EA 2GM5A 2ISCA 4C0QC 3R9IA 4R0VA 4FMTA 2H07A 3PPWA 1NI5A 2EJCA 1QK5A 5EB0A 5BVHB 2BLLA 4O4IB 2QTCA 5EQTA 5EIBD 2Y27A 4EYEA 2H1HA 1CN7A 3SJBA 1VIMA 2G07A 1U2EA 3BGDA 4EGCB 2B5OA 1P8AA 4C06A 4EF6A 1H2HA 1WW3A 5E9WA 1IH8A 1RFGE 3GFFA 1VP9A 1XA0A 3DFFA 1ISFA 3IBGA 2Y9PB 4FGLA 4MQUA 4NI5A 4HS9A 3K3WA 1B3BA 3CX7A 3OZRA 5BWOA 3W9BA 1QGOA 2G76A 2P9TA 4DARA 3QHAA 1J0CA 1Z0FA 1HR0O 5CDFE 1B74A 1P2UA 3AKCA 2HLPA 1EXMA 3MWJA 5J2UA 1CRQA 4CI0B 5F76A 3BMCA 1KOJA 1EP9A 3C7CB 1BSVA 1DL5A 3OMXA 4BDSA 3OPVA 4C07A 2EF0A 2F6RA 3UXEA 2JHAA 1Q91A 4NICA 4GOXA 1HFEL 1W93A 5BOVA 3TDKA 3HU5A 3SC2A 3R7FA 1M73E 4O4LF 2ATXA 3ESCA 4LZPA 4J7CA 1T5LA 4YHBA 3B6NA 3UG7A 4D4JA 3AH8A 1UZUA 3RFCA 3C3SA 3TZQA 1BMFA 4HEA6 4EUFA 2FC3A 5KNLA 4HB4A 1CETA 2YWFA 4QGHA 4GSKA 4B8ZA 2JFOA 4WFKA 5A7HA 3G7NA 3NH6A 2XBUA 3IAAA 3PLRA 3ASOB 3QHQA 3KJJA 2JCGA 3RWRD 2HKOA 4BOYA 1ABFA 1Z45A 2B6NA 3MQ2A 2Q3EA 1HDIA 4B83A 4U7OA 1CR2A 5MN4A 1ZJ5A 2Q2OA 1MPXA 4O1HA 1KBZA 1BD4A 2VJNA 3U7JA 5AKJA 3Q4HA 3W3ZB 5B2EA 3B3JA 3ME5A 4TXNA 2XMSA 5H82A 3NZEA 5I9SA 1X13A 1UOQA 1CU1A 3EC1A 3F0EA 1WP4A 2PCJA 2MIIA 5CLIA 3EPLA 3M1AA 3KYBA 1J42A 1G0NA 3FGNA 2ZYAA 3JD4A 4ZCIA 3ESYA 2BGJA 2IKSA 4PO9A 1EE1A 4N21A 2DPGA 4WCFA 4UMVA 4MV1A 2H2DA 1CZLA 1TM3E 1NQXA 1ZXBA 3T5AA 1YA4A 1D09A 1P2GA 4RTLA 5L3CA 4CH4A 3M0EA 1BXRB 3LCRA 4TOIA 1ZL8B 4ZPJA 2FR8C 2GTHA 2X0JA 1HDRA 2H1FA 3K0EA 2VBCA 2IV7A 4RD3A 2NWQA 5AM0A 3EXAA 2XYRA 5H80A 1TM2A 2NSDA 2V7GA 3KCYA 2NNWB 5GAJA 1SA0A 3HJCA 2R5WA 2P6YA 4IQGA 4KE9A 4BLQA 2I33A 1JHAA 3IR5A 4QDOA 3AO0B 4IO0A 3NUZA 1PWZA 3MGAA 4QUDA 1UODA 2XYVA 2P5SA 2DMRA 4JENA 1I9GA 3BAZA 5B2FA 4PPYA 4DDWA 1IBMB 4H3SA 4GPIB 3CISA 2UVQA 1JFFB 2VQEB 4TKUA 2C83A 4OUKX 5FIUA 3WNCA 3C24A 1K3TA 2W48A 3K1ZA 2YS6A 3GH1A 3MTAA 5AHOA 3CRW1 4JB3A 2GPYA 3ESQA 2R6AA 4AZ0A 1E7WA 1P6QA 1QLJA 2FOXA 2DCMA 1GL9B 5E6UB 2FEPA 3W3AH 1SKMA 1YOBA 2DR3A 4QRHA 4V2IA 5DNAA 3GU3A 3LF1A 4Z4HA 4ZC1A 5L3GA 5GW7A 2ZBDA 1V8ZA 1WA8A 1T15A 3ABKC 3DCNA 1H3EA 3RUAA 4LWPA 4HLNA 4G1CA 1E6WA 5THQA 4OQMA 2BH9A 1K8RA 4MR8A 2CBXA 4CFYA 2G1KA 1QVGF 1RQ2A 5B3AA 4CIVA 4R5HA 4KWIA 3V4SA 1CCWA 2WZCA 5AHKA 1QKIA 2H5IA 2FFJA 5EHNA 3JQGB 1OSNA 4BGIA 4TSFA 1E98A 4GR4A 4B35A 2XCRB 3K9SA 1DKPA 1N7IA 2XNHA 3BYZA 5BMVF 2QJWA 4EHNA 3DL0A 2RK4A 4DV0B 3UFXB 1GSIA 3ESRA 3G1WA 3QG1A 3ASYA 3LBFA 1H0SA 3BBLA 3E7XA 1E5QA 3ABIA 1JZTA 4EVRA 3DTVB 2YFQA 4YH1A 3OLXA 3U62A 4ZAFA 1S6YA 3LO8A 1LZKA 1I5YA 3L6DA 2IDKA 5F98A 1YZTA 1XFDA 2OBFA 3C39A 3BL8A 3PGJA 4PA4A 3HYRA 1PD0A 1M2NA 3RDPA 4LFCO 3ASZA 2W8BC 3OF2A 3KYDA 1RSZA 5IN4A 4HT3B 3G71V 5J2TB 3KZVA 2BEKA 3EE6A 1A9RA 1I4OA 3G1UA 4GYKA 2VA8A 3TGLA 2E5LB 3BF7A 1IRIA 4QDZA 4B74A 4YREA 5B4UA 2R00A 2FE1A 3JSLA 1FCJA 1KVRA 1XO1A 5K7SA 4LYJA 3SBOA 4PYOA 2PUWA 4BFYA 2YH2A 4AJIA 4QFCA 2YRFA 2W7TA 2PAFA 4KAJA 4IVRA 1M66A 3VTIC 4ZHVA 5GGXA 2GM4A 1JEQA 3EH2A 2FU5C 1PV0A 2UYQA 1Q8IA 3IUNA 2FJUA 1EQAA 1P0IA 5BQOA 4AZVA 2NU8A 3ZRXA 2J48A 3IAXA 4I5DA 2YXPX 1GRCA 4A6XA 4CDNA 1BEZA 2AJCA 3CWZA 3RF7A 3K31A 3ESBA 4BBZA 3SIRA 2FF7A 4TQFA 4P3OA 2QXUA 2ZRHA 3PWTA 4ZJPA 4DZRA 3QI2A 1SG0A 1N9GB 3IPCA 3TI9A 3ZYCA 3H2IA 5T4HA 2RE8A 4KLAA 4BO0A 3CKKA 3OCXA 5A7GA 1QBGA 2FPPA 5FJJA 4Y9RA 2ZSEA 1PP4A 3CTMA 3TKAA 4PA3A 1E3QA 3EN0A 2D1TA 2FMLA 2BR5A 3VO9A 1II8A 3TO5A 4YV2A 3TNYA 1XXHB 5JJEB 3R76A 4QPDA 2Q5HA 4MS1B 3W1EA 4DUYB 4FDVA 2OQIA 3KSZO 3DD5A 4I9QA 5EERA 3DFIA 1CYEA 5BN4A 2B61A 5AVKA 4BWGA 3KLMX 4J7UA 1HE1C 5DN6D 2F9FA 4NYIR 3MGKA 5KJ6A 3WMEA 1SBTA 2VQEO 1GN8A 4QUAA 1T2DA 3P4YA 1J20A 1E94E 2EDCA 1U7TA 1YZFA 1QR9A 2PIAA 2PKEA 3KSRA 4M0KA 5FFFA 1HQKA 3GLGB 3WS7A 4I5IA 2TSYB 4R6ZA 4JQSA 2FW1A 1HPLA 1SHKA 1N3BA 5HZMA 3I6MA 2IZ5A 4CMJA 5IARA 4ENVA 3KWJA 3JZMA 4C6SA 4B4OA 3QELB 5IJZA 2PMFA 3NIGB 4CIWA 3N8GA 3TSZA 2VXYA 3I5XA 3MHHC 3CURA 3ETQA 5LQMA 4UBNA 1MTOA 2FKAA 3PUIA 1DEHA 1HX7A 4FYIA 4BEJA 4JUAA 3CPWF 2XRZA 3WLTA 3TZHA 1Y7HA 1KDTA 3K9QO 4Y1GA 4LG1A 5FUMA 1TLFA 4QXAA 3AK1A 4L6IA 4Z5XA 1JEAA 5LLSA 4Q7JB 4BXOA 4E5PA 3NHPA 2B4YA 1WMBA 1E8DA 2QT0A 4YQFA 1Z4OA 1NVDA 1ADBA 2EFGA 2X58A 4BQNA 2PIDA 4UMDA 1C8VB 1UZLA 2XCTB 3UUEA 5H2FZ 2QMHA 5E0KB 3C6MA 4R83A 4LHVA 4MW3A 4DV0O 3MVEA 4R8VA 3GA7A 3JQ9A 4GM1A 4JEHA 2H1WA 1VP7A 2FLVA 1P9OA 2QX9A 1NI4B 1UAAA 1WUHS 3GJXC 4ML3A 1UT8A 5HS4A 1NLFA 1X92A 4LV6A 5KX5A 2AMTA 3OW2F 2H63A 4X8OA 2CLDX 1NNI1 4INZA 4HJXA 4H59A 2Q6KA 4EH1A 5A5VA 4N7BA 4P4GA 4OI0A 3SR4A 1U9IA 1ULZA 2YS7A 3FUVA 2BOBC 4IAOA 3FUXA 3PFHA 3MCQA 5AW3A 4RH1A 1P9NA 4W8HA 3CR8A 1E1RG 3HYTA 4Q1EA 4QOFA 4JC5A 2EZ4A 3OZUA 1HDGO 2GFIA 3TW6A 1NYQA 4GVLA 4HNGA 1KC1A 4IIUA 3L8HA 4G37A 5CXUA 1R64A 2CNLA 2PJZA 1CZOA 1PR0A 4RZUA 1DWQA 1CQWA 2G9NA 4KACA 3QBVA 2F1MA 5FPRA 1U5CA 4I50A 3P8ZA 1J4AA 1YTLA 5HIJA 1S72V 2OTLV 4B6EA 2QTVA 3L4EA 3IUQA 5E2IA 1WSAA 1D4AA 1ND5A 2MR6A 1K5HA 2WTNA 3PE3A 4QUEA 1MHPA 4HDCA 1GN3A 2HHCA 4X8HA 3HEAA 3PK0A 4DUYO 4K0KO 3NYRA 1TM1E 2RNBA 5IWCA 3LHFA 3H9CA 4P4UA 4FTWA 2Z5VA 1SB8A 1RVV1 3H04A 3ZOPA 1YE5A 5KOJB 2GPBA 3PQ8A 4MS4A 1MVLA 1T8PA 3CCFA 4F3TA 3ILVA 2VIIA 4JVOA 1ZD8A 1KI8A 1Q2XA 3HSKA 4LNHA 3M1XA 4L5CA 2Q5JA 3WKEA 3B20A 5BVHA 4O4IA 1C41A 1O58A 1PI3A 4RM3A 1LI7A 3DEYX 3ZS8C 1XWIA 4HZ3A 1MZFA 5CYOA 2P35A 2QQFA 4DV1O 3I52A 5CFNA 4MA0A 1WAMA 4XXHA 5SZIA 3MTDA 3ZQKA 1LBHA 2XOKG 1XYYA 1EQUA 5KSPA 5D87A 3LXMA 2ZIEA 3J7AU 4NE7A 4P2BA 1SK9A 2A4MA 1DXQA 4BFWA 4E3WA 1Q83A 3U4GA 3ORFA 3D8NA 4OQDA 2FG7C 2Y1CA 2Y6VA 4DDHA 1SHLA 4C6TB 5LDHA 3HKBB 2BF4A 4TRRA 2VQ6A 1CLUA 2G9RA 5JZVA 1T3LA 3VDNB 1GDHA 3LIIA 1VGRA 1H65A 3GLGE 2GASA 4NP6A 2NTJA 4EABA 2BCGY 4LSMA 1MO4A 3QPAA 1SUIA 4DV5B 1R0BA 4A4DA 1KQFA 5AJUA 3BF8A 3VU1A 1ZY2A 2XASA 2ZRMA 2X0EA 2SICE 1HNNA 2YWEA 5DN9A 2I8AA 4ILEA 4ASUD 3DLBA 3P0RA 3D0QA 1MZEA 2AZXA 1BMTA 1IIBA 1VRWA 3TPFA 1A8UA 4AY4A 1ELOA 4GMGA 1YACA 1GARA 4EA9A 3DDHA 3CCEF 1FUEA 1QE3A 4OHOA 2XMPA 4EITA 1HM5A 3U4AA 2YDEA 5KVAA 5H5NA 2HQ1A 4MMXB 4DMFA 2W22A 3G68A 3SYAA 5B3SC 3EGOA 1ZO8A 5B1HA 3PZBA 3GRCA 3NANA 4X1IB 4PLWA 3P3NA 3F4KA 3LUFA 3LUKA 4UD2A 1QPGA 3CZ4A 4R9RA 4W1RA 1ST2A 4F86A 1P1JA 3R7WB 3WLHA 4UTPA 3A1WA 1B1CA 3LDFA 2IXFA 1YIJV 2DOKA 2OHFA 2DBRA 2IG8A 3LRXA 4ZYUA 1GA4A 3COYA 1FFXB 3GNLA 2IW1A 3KSMA 1FQWA 2OKGA 4GDMA 4AG5A 5JAMA 3SXJA 1WEKA 2IPNA 2EFEB 3T5CA 4FHCA 5JEDA 2DSTA 3MAAC 4PV7A 1YJAA 3ER8A 3PUJA 3U09A 2J32A 1WUJS 1YL6A 1KJ8A 1UEIA 2JF0A 4DA8A 4IUBS 1G9XA 4YT4A 2EZ9A 4C2UA 3IULA 1Y6GA 3S2GA 3B82A 2M6SA 4FLTA 3P10A 1U0JA 1VYVA 3D5QA 4RENA 3LT2A 2OHVA 4LOKA 1BXRA 4PG5A 3MQ4A 4CIBA 1ZL8A 1Q44A 4B2YA 3MWFA 3X1MA 1P84F 3FPIA 2J07A 3JWGA 3WO0A 2A7WA 4EZEA 3MTIA 3OZEA 1EFRG 1SU7A 2O19A 2WTBA 3VMFB 4QT4A 4Z4FA 1S3GA 2A35A 3NJRA 3FHLA 5IBPA 2L42A 2O2EA 1M6EX 2HFKA 3IHWA 2WLKA 1JFRA 2Q8NA 1T2CA 2WZDA 2A94A 2JGRA 4LF6B 4MGZR 3WHLA 1JFFA 1K8AW 4PWZA 3A0UA 3B3FA 4P81A 1P1CA 3S8MA 1EH5A 1UBKS 1L1QA 4FFDA 1YI8A 4HFMA 2GK7A 4E2LA 1NLYA 5E6UA 4WXRA 2AEFA 2W2OA 4Y2JA 4H7EA 5AVMA 2VQSA 3G3EA 2KPOA 1G20B 2ZTHA 3HP7A 3OZAA 4YRFA 3R4CA 4ESVA 1K0FA 4RS4A 2QYHA 2I4IA 3MZ0A 1BQ4A 3HDVA 3ZIUA 1P6XA 2FYTA 1VQ4V 4D1YA 3FUTA 4TTRA 4G28B 3FXAA 4MUYA 3WDKA 2Q3DA 1PWXA 2H54A 1BKDR 4DV5O 2GQ0A 4WK2B 5CCDA 3JZFA 3JVIA 1M5RA 5J2UF 3IMPA 1KR2A 4EHLA 5IBCA 4NZPA 2ZCUA 1DF5A 4RVCA 3SZUA 3JQGA 2BP7B 4UHEA 2KLBA 2OZEA 3VPSA 2XGOA 1ZNXA 3AJ8A 3G7SA 1W4AA 5DX0A 1RXUA 2V7WA 1QHTA 4DSTA 5GV7A 2PRZA 1WMDA 1WL8A 2QRKA 3UFXA 4DTCA 3EMBA 4A0GA 1Y89A 1R0SA 4YRPA 1Y9ZA 1MORA 1H2MA 3TFOA 4JC8A 1B6GA 5J4YA 3K12A 4MVZA 2PR2A 3HBNA 3DTVA 3HDJA 4L8LA 4XVRA 1OPRA 4H7FA 3DZFA 3N0VA 5C9ZA 1E3IA 4I1SA 5I5EA 1AV6A 3JY6A 2JGMA 1XZKA 3HNPA 3GT4A 5DXJA 4L9RA 4TVKA 5J2TA 2W2TA 1NF8A 5I7WA 1Y6ZA 5IC4A 1CRPA 4JI0B 1CDZA 8ADHA 1QVFF 4TMTA 4R4JA 2XF8A 4PF1A 1RCFA 4KREA 4EI8A 3ZCPA 3FZEA 4PG4A 3R9XB 2OAGA 2DT4A 1D03A 1QYCA 5LQSA 4L0DA 4QPJA 3LUCA 3V8RA 5BWCA 2ZVDA 2XWJI 3FPGA 1RRGA 3OM1A 2JLAA 2DQSA 4MHSA 2IYSA 1LDNA 2PGOA 2GERA 2D2CB 5HXAA 5JYEA 1QV6A 1EM8A 4K6FA 1T13A 5IJ0B 4HNTA 2IUSA 4ICGA 3CUTA 1H7MA 1A9ZA 1QHYA 2C3PA 3D6MA 1N9GA 5FL7D 2X4DA 4HGYA 2Z95A 4C20A 2OHIA 1TUGA 2DB3A 1TTQB 4WLVA 3K92A 5K3AA 3A26A 3EVAA 3PHHA 1Z13A 5ILOA 4JYMA 1ECPA 5JISA 1XXHA 4YY3O 2UZHA 2EZUA 3U3MA 2BBTA 2OHHA 3DYBA 2BGUA 4NQZA 1IDSA 5H68A 1DCMA 4WMLA 2Z98A 3ABQB 4I0WB 3DLCA 3FIJA 1Y5IA 3LSTA 4AMGA 1GYRA 5DBOA 1VHQA 1ZNWA 2VEDA 4KEAA 1MB0A 2CY0A 3ZV7A 2WW8A 3S70A 1FFTB 3G8AA 2JEUA 3SJCC 3GLGA 4RKQA 2VAWA 4XW2A 5E9AA 1XLTA 4KWEA 1VMAA 4FQ7A 4JI5O 1M6VB 1CVLA 4L4UA 2ACWA 2VUIB 1JE1A 2VJMB 2IHYA 3QELA 3TNJA 1NDQA 4F3NA 2JLXA 2HA5A 4ZKIA 4C3ZA 3FWHA 5DI3B 2ASVA 2FFRA 2XTNA 2F1HA 3TRHA 2A86A 3R40A 3A9UA 4EPWA 1R0RE 2KKWA 3U7FB 3VFDA 2O06A 2ZIFA 5KINB 4DKXA 2H1IA 1GU7A 1XALA 2Y1WA 1PFQA 3K4QA 3BWCA 3P27A 4QXQA 4B2IA 2HGSA 1JDVA 1EQ2A 2WYIA 3K0BA 4RJ2A 4XR4A 1JB9A 1G21E 4OAQA 3LZDA 2CL5A 2QI9F 2BUCA 2PSJA 5TT0A 2HIAA 3RUPA 3ZNOA 1KP3A 3F3MA 3WKCA 2C2GA 5EMNA 4JR2A 4KIFA 1NI4A 1P72A 3R3ZA 2P2ZA 3QLEA 2QAGC 5JAPA 2QQ5A 4EI7A 2H7YA 2Q7EA 1IN8A 3T1QA 4EJMA 1CP2A 1WJZA 1KI4A 5TLSA 3ZP7A 4B34A 1OFUX 2BFCB 3AIIA 2JRLA 4WVFA 3CW9A 4OX9Y 3RU3A 2YBEA 1QORA 3F7MA 3LLSA 1L5VA 4AF8A 1FSPA 3OSUA 4RUEA 4JI0O 4UU7A 1G2PA 4YAWA 3U9SA 3LY9A 2C2OA 4AUEA 1S9DA 4DBZA 4ZZ2A 4ECAA 5HF9A 4C3OB 5BWMA 2EX3A 2ZUTA 1Z5GA 2QUBA 4S1OA 2R48A 4RQUA 3YASA 3FOZA 1U63A 1CDDA 3KZKA 4ZK6A 1R37A 5AVRA 2B33A 4C43A 5BYAA 3GLUA 3MHSC 3WK5A 3R2JA 4JEIA 1N5RA 1T9BA 1MSWD 3MWDB 4EB0A 1TKBA 1BU5A 2G5GX 4ZWNA 5G40A 1IOVA 5HUQA 4RK7A 4A26A 4RVUA 4GYYA 4CUZA 2YCLA 2IUYA 4OMFG 3X2SA 3BWMA 1PP9H 2UU9B 4L6CA 4BMPB 1WBJB 3Q4GA 1ZEJA 1HT3A 1C3EA 2BCCH 1D5CA 5MGBA 4OHZA 5KIAA 1JJ2F 2HWYA 4C7OB 3W2IA 4D43A 2DWOA 3MJHA 3GY0A 2V59A 5KOJA 1MNQA 4RVNA 2JANA 4UCRA 4NV0A 9MHTA 4WVLA 3PEEA 3LUGA 2F3TA 5FJIA 5AUOB 3DMPA 2C59A 5REQB 5TF0A 1NJIW 2XGJA 2J9XB 1YB1A 1UFVA 5HA5A 3W4KA 1C4WA 2H94A 3VYWA 1H8ED 3Q2KA 1X1RA 4RA9B 4XZ3A 2Q46A 2ZLBA 4RZIA 2ZRPA 3JQAD 2JDID 2DHEA 2AXNA 2JGIA 3AY0A 4JX9A 4PG7A 1IBKO 3CX4A 1WE2A 4IFIA 4HB2A 3ZPXA 5FBVB 1FSZA 4JKYA 5GOTA 1YA6A 2WQ7A 2BM0A 3WXMB 3WK6A 3HVRA 3JCMM 1LUWA 3KQOA 3OU6A 4QE3A 3UY4A 1E79G 2JLQA 2KBEA 1NQ5A 2QX4A 4JXXA 1V5IA 4HQ0A 2CNWD 3U3OA 4JROA 3U7GA 1DE0A 3DMYA 4R81A 1VPDA 1E3SA 1AUOA 1L4MA 1DC7A 3K4HA 5KSYA 3K2QA 4UKDA 2QVGA 1AROP 1NSYA 1VQPV 2L2QA 4FUTA 4C6TA 4G09A 1J97A 4W63A 1GVNB 1PNRA 2E4AA 2XDQB 4MV4A 4X66O 5CYFA 3ISJA 5IVHA 2KGWA 2OPHA 1WKBA 4E5VA 3NT5A 1A9PA 3AP1A 3LYUA 4WERA 1D2MA 3IUSA 5J43A 2GZSA 2MU1A 3DLHA 4G5YA 1LX6A 3HADA 2COUA 1BQEA 2ZB4A 5EKDA 2AUTA 1GPMA 5HIAA 4OI4A 1AB3A 2NZ8A 3L74H 2HCJB 1Q22A 1U2GA 2R6JA 3IOEA 5GTIZ 1Z2GA 2G0AA 4XBFA 2OCIA 1WXXA 3TOSA 3SFVA 1X9IA 5A0FA 3HU3A 4PYQA 1U28C 3CMMA 4P80A 3TCKA 5DV9A 3GD7A 1XI1A 2XQFA 2DYRB 1FE8A 3T3GA 1QRTA 3IAM6 2C92A 1Z5OA 5B1OA 3SSOA 1Y5NA 2QROA 2JKZA 3A3NA 3VV2A 1X70A 3RJ5A 4KXVA 3ZVRA 3MRVA 4X1IA 1KDOA 3NW9A 1FB5A 1XSEA 3LC7O 1A7UA 3ZBTA 5CAEB 3DYIA 1A88A 3R7WA 3D36A 4CODB 1HEUA 5SYAA 3CN7A 1P74A 1P5ZB 4F11A 2AMVA 3T4PA 1FFXA 5J40A 2QGFA 2OT3B 4Z0PA 4PIMA 2JK1A 3W78A 4KVFA 1DTSA 5IUJC 1JLHA 3OC0A 5KHLB 5I51A 2JC3A 4O4HA 1JN1A 4L87A 2CW4A 5ADWA 4ARUA 2HG5C 1EM6A 2OG2A 4OO3A 4IJWA 1NW5A 3NHMA 1OOEA 2ZTSA 4L76A 5ALDA 3NOOA 2UU9O 1PGOA 4Q1CA 3FSGD 3RU2A 4XSHA 1KYZA 5H3HA 2OBMA 2P4UA 4TS3A 3OMWA 3QJGA 4NRDA 5CEJA 1EI9A 3P45A 2XEXA 2Q6IA 4YRSA 2P22C 4G0QA 4WHMA 3D8RA 2P67A 2DWCA 3PJEA 1IJFA 3Q3JB 4DNXA 3T38A 3KQPA 4NDAA 2H29A 4WXYB 3AB7A 3OQ1A 4GL4A 3VMFA 5U1PA 3SJZA 3GRVA 1JVMA 4DLYA 4JI3B 1CQZA 1CBUA 1B6SA 5L3VA 4NABA 1NG1A 3DEIA 1GGKA 4NBNA 1OF1A 1Q81W 1BOOA 2WYHA 4MGEA 3NTRA 3PITA 3ONFA 5FULA 4JAVC 4IH1A 5FLKA 3C6YA 5JXWA 3AB8A 3HDHA 1IK4A 3R8FA 4O4IF 3D8UA 1RKUA 1JYEA 3RS5A 4KQ9A 3MB8A 3ZDRA 2AZ4A 2QTNA 1K3FA 3UGTA 3DDCA 4LUCA 3CEPB 3RTGA 1MNGA 4JEMA 1G20A 3HNRA 1C1DB 4QQNA 1FC0A 3HA2A 1QF6A 4LZJA 4CH6A 5FUVA 3C85A 5IRCD 3EBPA 3IT1A 3AOEA 2JJ1D 1I4WA 3ZY2A 1YHYA 4HYOA 4YLGA 3RW9A 5LC1A 3N86A 2J9FB 2C95A 4F56A 2FY8A 3CMEV 3R0ZA 4M7OA 1KU0A 1QHIA 4Q93A 5FEUA 2Y0DA 4EG1A 2BP7A 1W75A 5TNXA 3ZY5A 5CD9A 1OI2A 2R2GA 2YW2A 1G2IA 4TLLB 3BM5A 2YQZA 1F20A 2B8TA 5KB3A 3NC0C 3VNQA 3CCVF 3S3XA 3G0OA 1H2SB 1TUBB 3AQ4A 4DCTA 4ERXA 3A6EA 1TK9A 3CFYA 2QE7G 3EHEA 5DNYB 2NNUA 1FLVA 3ZNQA 2HMUA 1QVVA 1HORA 2FXIA 4GX1A 2WM3A 1NJSA 3SYLA 3ZRWB 3DLTA 5K8VA 4B3HA 3PJGA 4EYGA 1N3IA 3SQDA 5C34B 4TN1A 3R5XA 3ZWNA 1B6QA 1RP7A 2EBFX 1MOFA 2AE1A 3AJ9A 3GJYA 3T4DA 1SAYA 3DP9A 3ZVKA 3PRJA 1T1GA 1L1RA 1GPUA 3KUXA 2WUDA 2FKXA 3HH8A 3HHPA 4D9MA 5AI5A 4XX1A 3UAVA 2VI5A 1IY0A 1RHQA 1TZCA 3HACA 1G55A 3DVQX 2CK3A 1RAGA 1NVKA 3DP7A 3TM5A 3G8DA 3F97A 4G24A 1R6VA 1PS8A 2W42A 1EB9A 1J2YA 3I6BA 2WJ3A 2P7TC 3ZE1B 4TS4A 1UPXA 5IJ0A 1GEEA 2LGQA 2I9PA 3BIJA 3UOWA 4Q20A 1DFIA 2O2JA 3RAFC 1CNEA 2WIGA 4I4NA 3W1VA 2EW1A 4NQRA 1CS0B 4QGSA 4JOCA 3DT9A 4F6CA 5H9WA 1Z8DA 4EAAA 5L3QB 2ONCA 5LZ9A 3ED1A 2WEKA 1WN7A 4OFWA 2IHZA 2DHDA 3FYTA 1VIAA 2ORWA 5KOYA 3H1TA 4D8VA 3KM0A 1DEXA 2BDUA 2IZ0A 4IY1A 4QX6A 5BT9A 3UAGA 2ZSAA 4LH6A 1JXAA 4PELA 2Z57A 1ZOLA 3QVUA 3OFNA 3ESDA 1JR3D 1R3UA 1R8QA 2UUCB 2ODTX 3T5DA 4CQNA 3K5MA 1VCHA 3ETJA 5ALWA 1L4GA 3WB1A 3WB9A 2GAAA 3V7UA 4CDRA 2V7QA 1M6VA 1ZRSA 1BWPA 4AECA 2Z9DA 4PQRA 2BMJA 2FWNA 2VJMA 3EPKA 1GGJA 4I5SA 1CLIA 2VC2B 1MZPA 3TEFA 3PD0A 5I7UA 1JPXA 3BD9A 4CETA 3EYWA 5ESDA 2IXAA 3KKQA 2P8SA 3EQ8A 3PX7A 5DI3A 2ZI6A 1VQVA 3C45A 3C16C 1G3QA 3SHVA 5JAIA 4B3DA 3RC9A 2DRIA 3T0IA 1JG6A 4UMFA 2EU8A 5HFJA 2Y77A 3O4HA 3LECA 2K7FA 2XAHA 3ABKB 2GPSA 2RGDA 3C3PA 3HGTA 4B4WA 4ZEMA 3IP9A 1BCSB 2P06A 4J1TC 2GZMA 3RHFA 1BG6A 4I19A 4PPNA 1MRZA 3QUBA 4V1CB 2WJGA 1K3UB 1IOZA 3VSCA 5FCDA 1G291 1E4OA 5CCBA 1S5PA 3GHZA 1NN3A 4JLBA 1LU9A 1NC1A 3NEAA 3NWBA 4KKXB 1J7JA 5B55A 3PR1A 2GN2A 3KXDA 4A23A 2JD2A 4CMEA 4WA7A 4C2BA 2IGBA 3ZZ1A 2KMLA 2Q7XA 4ZYWA 4PO1A 5I47A 5BPHA 2XODA 2Q5ZA 4DMCA 1XMIA 3BOSA 1Q7YH 4UHFA 5J47A 5CYGA 3BXGA 4ALIA 2BVNA 1Y3CE 1ZLZA 4XDHA 3EDOA 5K2OA 2HADA 2OFWA 4MUJA 3HAXD 3ZHYA 5ILQA 4FYHA 5CX1B 4NXNB 2W8BB 3NGLA 1YDGA 4LRWA 3WYEA 1XWFA 1KRHA 5J2TF 3GK3A 3OZSA 4KR2A 2P9EA 1LNZA 1KHHA 3I6YA 5BN1A 5HOEA 3VHLB 4JJAA 4DW8A 4G84A 1QRSA 1F8YA 4EB6B 3NHYA 1HXHA 3OMIB 3NK7A 3COSA 3NEJA 4E5MA 2PD3A 1B2LA 5AKKA 1CUDA 4LVCA 3GFGA 4EKYA 2G25A 3MWDA 2PSEA 2QPAA 4I50B 3DR3A 1GYQA 1BA3A 1CC1S 1YBMA 2IYFA 4C4SA 5FOUA 2CXTA 2OSBA 1OT5A 1AUQA 3KTOA 1ORQC 4DL9A 1GEGA 4DR3B 1E2UA 3DMGA 2VFAA 3TL3A 4B3BA 3C3XA 3PFWO 4L51A 1PUJA 1EIZA 3PUVA 2W8ZA 3ZH9B 2ERCA 3DHVA 3NFYA 2YY6A 2WUFA 4KLRA 4OXSA 3R1IA 2H3EA 3M1LA 4C7OA 4OX9B 5K4HA 4CMGA 1FYVA 1LUVA 5FBWB 3HE3A 1BROA 3SC4A 1QWSA 2AQHA 2C5AA 1M6WA 4DNOA 3ZCTA 1JLSA 4G0PA 2NUPB 5G53C 3ISTA 5REQA 2J9ZB 2B34A 3NHWA 4RA9A 2DKFA 4B33A 4F2PA 5HY2A 2AA3A 3G13A 1O77A 2IOFK 4E4TA 2G1PA 4J9UE 2XVAA 4G4IA 1BS1A 3LK6A 1E2LA 4QPNA 1TXGA 1PGJA 3NIDB 1THGA 4W6QA 1TQ4A 5LIPA 3I12A 4GI2A 3WXMA 2PZGA 2FMIA 4KBFA 3B3GA 5K1ZA 3FYSA 1I0ZA 3OE4A 1K6XA 3Q5GA 2I80A 3DLAA 4F6LA 3TZKA 3F0GA 4WRRA 2X8WA 5EJMA 3S1AB 1M2JA 5I7SA 1SUFA 4PPQA 4V02A 1VQ8V 2IJIA 1YJQA 4AJEA 5DCWA 3H65A 1N36B 1YUBA 1AO3A 5AHWA 3FMPB 3PHGA 3H2HA 4AJPA 2EULA 3FW1A 1HTWA 4RS3A 2I99A 2XDQA 2B3DA 2TRSB 4MI6A 3E5NA 1R6TA 5K3BA 1IWBB 3DL4A 1IE3A 2G83A 2C2HA 3B1ZA 3P32A 3JWHA 5KYKA 4GEKA 3DZCA 4IJKA 1ZNZA 4Z86A 4MRSA 3ZXIA 4IIGA 5JFOA 4XIYA 1ES9A 1WNSA 4B71A 2A5FA 1TF5A 3QWIA 4KE7A 5BORA 4DC0A 1P62B 2OGUA 5AHRA 4FIDA 1XXLA 3TNFA 1NAHA 2CLLB 3LX6A 3VDQA 3GL9A 3MJRA 2AQKA 3FCOA 1U2QA 1QZUA 3VOAA 3GAZA 3A1NA 1YF3A 4XIJA 3ZK7A 1VL2A 3I1FA 4JX8A 2WFZA 5CXXA 1SCIA 1H05A 1NMSA 1YRHA 4POAA 1UPAA 1PZGA 5JAQA 4L78A 1YUNA 1GCUA 1TRKA 1DIRA 3BA1A 4JPRA 4KGXA 3STZC 5CAEA 5AICA 1IXRC 1Q6ZA 3JQ8B 1FNDA 4KUHA 5AW1A 2WU0A 5J3JA 5B1EA 1BWQA 4H13B 3K5OA 3LA6A 3IJEB 2EILC 5HCNA 4MW9A 3V8PA 2HEIA 1Z6TA 3EODA 1IZ0A 1SOWA 4Z0TA 1W44A 3STWA 4JLWA 4X60A 3QTYA 1S8NA 2VPTA 3H5OA 5AVQA 4ITUA 1PK9A 1M1KH 4DR3O 1AA6A 4RQBA 1G5TA 2QT9A 4WEOA 4CLOB 1Q0RA 4BVFA 3VJMA 2WPDD 2AC4A 1SQVH 3EFEA 1LVHA 4OXKA 4F1KA 4IDBA 5IZCC 4MO2A 1A8PA 1GGFA 4OX9O 2I6XA 4TM8A 3C8DA 5ALTA 2H1OA 2AW5A 3HP4A 2JS3A 4HDAA 1FRFS 4D8YA 4OU4A 4JC0A 4LE0A 2NSHA 5LLDA 2PWZA 5DLPA 1UP7A 1P5RA 1MQAA 1C3XA 1IV1A 2XBLA 1T9KA 2CXHA 2BHLA 1THZA 3UKOA 3INNA 3WKBA 4Y2PA 2OVBA 1P29A 2WM9B 3UB3A 2PJDA 1Z0UA 4D6TH 4E11A 2VJKA 3LWQC 5EIHA 2JEXA 3QX9A 1C5KA 3O4RA 3X43A 2RFLA 3ZV6A 5CVUA 1SBZA 2ENUA 2HCTA 2P90A 2BGGA 2H4FA 2F90A 2ZPTX 1S4QA 3HJRA 4TQGA 4R71A 4HD8A 3GJZA 4LHSA 5KKAA 2QT1A 4MGIR 1OKKA 1U0BB 1BDBA 1C1DA 4KQWA 3GLSA 3PJDA 4FMPA 4EECA 4H6WA 2VP9A 3GFOA 5LQKA 2FSVC 1T24A 2D5IA 2GHQA 3E86A 3GLHA 3LWZA 2J9FA 5DM2A 3KHTA 3N4YA 4JBIA 3WJPA 5IDJA 2P8JA 1HFJA 4XD2A 3WWOA 3QVNA 2RHWA 4C8IA 2Q5CA 5JH7B 1WEHA 4Y30A 2VUHB 1P33A 2PRSA 5A4DA 4HL6A 2FWJA 1EIWA 3KVRA 5EY5B 4XB2A 1YR1A 2G06A 1WVMA 1TUBA 1P61B 4RLQA 3RBZA 1BQ0A 1ZMBA 2DHQA 4AULA 1ZTEA 4KC0A 4BO1A 4AZSA 5K05A 1HEIA 3DWGA 4BX3A 4L7QA 1AQUA 1LJUA 4YP5A 2ZB7A 4LJ6A 3RRFA 3EEOA 2WWIA 3QXHA 3NBUA 2FUCA 4XYGA 5L6MB 4OGFA 3VHQA 4OKIA 2EWWA 2M6KA 2HSZA 5A3VA 4FFVA 1SELA 2JW5A 1G7TA 1J2UA 2QYSA 5DTMA 3ZRWA 3A6DA 4JYYA 3QQPA 5LDGA 1JSZA 1TZJA 1ZS9A 3H9QA 2OZBA 4XQGA 3VYUC 4OJKA 2PMBA 3TRFA 3OE7G 3Q3IA 4Q3KA 1XOIA 4QBFA 1U0GA 5B3SB 2Z58A 4YIOA 5E9QA 3KX2A 4NOMA 1I5EA 3M2PA 4CLEA 4LCJA 3ND7A 4IIXA 3WQHA 1O2DA 5DULA 4D9GA 5FAXA 5JRZA 2PTMA 3FB1A 5BQXA 2PL9A 3AHHA 1EM8B 4KGVA 3CG6A 1QYVA 4IV8A 3I9NA 5E0OA 4PANA 5IUKC 4OAPA 4QSHA 1MFPA 2ZSKA 5M2QA 1TGOA 4BRUA 3E8SA 4EQZA 4B0PA 1OB5A 1OIWA 1C7QA 2RGWA 4FFSA 2WSYB 2WYWA 4W99A 5KQLA 1L1FA 3AL2A 4QEDA 4PN7A 1PX2A 1XD9A 3HU2A 2J85A 1L8AA 2V7VA 2EL9A 3KIPA 1FX0B 4Y67A 1ZHFA 1CS0A 3QTLA 1ISPA 4I9GA 5DRTA 1A4IA 3CG4A 2SNIE 3RTCA 5ABPA 2WNIA 1SUDA 5L3QA 2XSZD 4GVPA 2JJMA 1IBMO 1I3CA 4WGFA 2AIFA 2UDPA 5JI2E 4IMPA 5B3JC 2FR8A 4QUIA 4D3DA 2D2FA 1W29A 4K9PA 3GEBA 1XU4A 1RI1A 1SZJG 4QDKA 4I9UA 3ROPA 4WUTA 1F51A 1KK1A 1DTOA 5JU6A 2IPXA 2W2XA 3IV9A 3U4HA 1PX0A 3RVKA 2NMVA 3VHRA 3CNHA 4LAFA 2O57A 4U6NA 5DSTA 3WSWA 1XZFA 5GIPE 1Q8RA 2GBGA 3PQFA 1KKCA 1RZRD 3DFMA 3PPXA 1KOLA 2IZZA 2ZODA 4D9EA 3ETHA 5TEWA 2QWOB 1JIKA 1IPEA 2LFRA 4M1YA 3FPFA 4DT1B 5DEIA 2EKDA 3UJHA 3OQ6A 5EUBA 3VIUA 4X41A 1ISMA 3CPJB 3WIDA 5IJAA 2J7KA 3IEUA 3EAQA 3L3BA 5DBGA 1R10A 3I73A 4V0QA 5KS2A 3IAS6 2YQ4A 3DZDA 4KHPB 3CCCA 3FE2A 1OXMA 2QW0X 2ZIWB 1YUMA 2C4NA 3THSA 2QVZX 4NTZA 4MW5A 4B3XA 1C8KA 4BNUA 4TV8B 5T4BA 1DFHA 1BCSA 3RSHA 3KSAC 2YV2A 4V1CA 1DMRA 5DOVA 2FSVA 3G2OA 5CIYA 2RMKB 4ZAZA 4MW7A 2NM0A 2RB5A 2C0PA 1GG8A 2ZIVB 4AC9A 4CC6A 2YXHA 3LBAA 4IDFA 3HCPA 4R2HA 1EBOA 4GBED 5KHIA 5KNCH 4KFUA 1SOAA 4PJ0Z 2ZJYA 3ZI7A 2GLZA 2AMFA 2E5LO 2WV9A 3SIUA 2HREA 2GX6A 2N74A 2B4KA 2G80A 2YW9A 4UUAA 4ZI7B 2E6KA 2AZMA 4ZJYA 4IZ6A 3QX7A 3Q7EA 3FTDA 3VZBA 1KS9A 2VZ9A 5IYBO 1UKCA 3CLSD 4QHSA 1EMDA 5CX1A 3MN1A 2W8BA 1A4UA 3OEHD 4UE6A 5AKLA 3W5AA 2KYRA 2VBGA 4LOAA 1NX6A 1XRSB 1AIPA 4CV3A 3RA5A 2ATKC 1ZXLA 5I6DA 4UASA 4EB6A 4HVAA 4C9BA 4W5HA 3O1JC 4WXEA 1WTCA 1WDKA 1T1SA 5AJHA 3U9LA 1U2DC 1B76A 5F3DA 2XT0A 1H6DA 2PG3A 2M7WA 2GXSA 4NLLA 3KEGA 2FEXA 4FM0A 5AOAA 4DY4A 3LLUA 4ZBMA 2IDMA 5HXZA 3WQQA 4GWLA 3E27A 5AT1A 3NDJA 4MJ7A 3QX3A 2HAEA 4JOBA 4DV7B 4RV4A 1UPBA 1RYZA 3EGVA 4NYJR 4BFXA 4UVDA 4WK4B 5EZQA 4J4TA 2KSDA 4FZJA 2D1SA 4M0UA 1IRXA 2Z1DA 4PZYA 4K3UA 3TLZA 4OM8A 5BXQC 3NTXA 4KHZA 3UPTA 5D1NA 3VU8A 2BWJA 1Z25A 5LHHA 1VI5A 2NUPA 1FQOA 1JPNA 2Q7GA 4C0HA 2I91A 3IOMA 5D84A 3NTLA 2PUFA 5G3YA 1FTSA 1W2GA 1CIVA 2AL7A 5I7OA 1FEZA 1XXHE 1I33A 3FDXA 3DAFA 5B3JA 3H87A 4NHEA 2V74B 1RR6A 4UM9B 2Q8QA 4BN4A 2XY4A 3F73A 1OV9A 3Q85A 2DW4A 1JLRA 5BYBA 1GGNA 3HC7A 4QOEA 3S1AA 4AILC 1LS6A 1PM9A 1GTSA 1IZ3A 4TSFG 1H85A 2H2FA 3QIVA 2OFOA 3O2NA 1FMTA 3WOVA 2H4ZA 1B6RA 1F17A 1YE8A 2NPOA 2D8AA 4MTLA 1U2RA 4DIOA 3G2HA 3FPSA 2YZMA 2EJUA 4C3VA 5KYTA 1PCXA 2NSJA 1YZUA 3FCAA 4KRXA 4WDQA 4BC0A 2B0JA 3V4PB 4WY5A 1VXOA 4R9VA 4AJKA 4IRUB 2WE7A 4IEEA 2ZQ5A 3NHRA 1WP8A 1T6YA 4A36A 5J59A 4DCCA 3RVMA 1QG4A 5F4BA 1DOHA 3WL7A 2IY7A 4II3A 3OY2A 3OR6C 3FA2A 5HMMA 1G17A 4UDNA 1BDMA 1B15A 3OPMA 1CP9A 3FKSA 3O1IC 4L1KA 2N3ZA 2DBYA 2Q3MA 2ZJ3A 2MMGA 3WGJA 2XI4A 3N58A 2N75A 4JYZA 3FD6A 3NDPA 1O94C 1IC6A 2RHDA 3TLAA 2QAGB 3OLYA 3PEWA 4M4SA 4RD1A 1HA3A 4ZD6A 4X62B 2RGGA 1I0IA 4EATA 2QWPB 1IY8A 2YC2C 1M10A 1GUFA 1VQOF 1UBCA 4P98A 5JCZA 3JQ8A 1E58A 1LRJA 2FW7A 3SZLA 3PHCA 3DNPA 3BL6A 4BGEA 3MT9A 2OTMA 3SDLA 3DXFA 4CKEB 1AI6A 2PEZA 5JJLA 4O4HB 3UTDA 4N5HX 3VAAA 2HPAA 3BE5A 1BFUA 4RFLA 4GZ5A 3LGXA 4Y2RA 3KVYA 3AP3A 2E18A 1E66A 2ADPA 3T5MA 3P0ZA 2O14A 3TGPA 1CUBA 1G9SA 1EG7A 2ZI5A 1FDVA 4CLOA 4GKJB 1BD3A 4HQFA 1XTPA 3A1VA 4ENPA 1G42A 1Z88A 3HZHA 4Z4GA 3H5TA 5EIOA 2WT9A 1SZXA 3KK0A 2CCKA 4FPPA 1U40A 1NN5A 1ZHOA 2DPYA 4BJ1A 3U6BA 4L16A 3SEFA 4W1PA 3UB4A 1UJNA 3OQNA 3JQBC 4YRIA 2QD1A 4HAIA 1RIFA 4NBKA 1Y34E 3P2JA 1R1BA 3IOBA 1XMQB 2W37A 3OZ7A 3P30A 5IF3A 2BL4A 3GLKA 4D0SA 4BNNA 4RHUA 3CEHA 5T64A 2QUKA 2G40A 3GXBA 2MSNA 4NH0A 2XA9A 1H2BA 3DDNA 2C1ZA 3TAUA 3ESJA 1JXOA 2HWXA 1Z7YA 1UC4B 4FHZA 2X9NA 2FSGA 3T1YB 5FPYA 1ZIXA 2CAZC 1ZZGA 1KMMA 3NBAA 3O65A 2RARA 4U9UA 1TEVA 1XQ9A 1VE5A 4PYIA 2RBEA 4JBLA 3EEIA 2JATA 2QSAA 2AHRA 2QZSA 5KWJA 3WIEA 1E2KA 4ENRA 4L8GA 3GT0A 3ZS8A 1IHXA 4JI8B 4Z3KA 1SF9A 2C2ZA 4B81A 1VQ9F 5IDYA 2Z1TA 4NNOA 2V45A 4RHXA 3ETCA 3ZXYA 3LKZA 1P91A 3B77A 2C96A 2J6HA 2L35A 3TN7A 2PH3A 1C9EA 1ZMTA 3UO2A 4OLBA 3IV6A 1Z4QA 1LLQA 1R9NA 4BBPA 3NIBA 4FT4A 5G1NA 2P0EA 3PKJA 2AJLI 2EERA 3JARB 3NPMA 1SXIA 3GUHA 1Q3TA 2JAHA 1L8LA 4PC6A 3A6LA 3ZHRA 4UDYX 4MR7B 3HUFA 4PGHA 1ZI8A 4JYPA 2A9KA 5JH7A 4ZQEA 4E22A 2O20A 1RWPA 4XPIA 5EJ7A 2IYRA 5BT8A 3J81k 1KZ4A 4C82A 1PDOA 4L08A 4IUYA 2R4UA 1CJCA 3ROTA 4M8IA 3G2KA 4KQFA 2H6EA 3FMOB 3GT7A 3DAHA 1T0UA 4IHJB 2RKBA 3WK7A 1N5LA 3BL5A 3FAKA 4C4YA 3AWIA 4CNQA 2CNKA 5ALYA 2ZWMA 4AY2A 1NX9A 3DC6A 2A84A 3AHDA 3N2NA 2XD9A 1VJDA 1M5IA 1XHZA 2AHOA 1RHMA 3QFRA 1AV7A 3KKEA 4J07A 3GZTB 2B8WA 1LSOA 1I94B 1KFEB 3OICA 2LCFA 4BVTA 4D2IA 2R6R1 4K28A 2QZZA 4J0GA 3OA2A 4MSUA 5HKKA 1NXQA 3N0TA 5CCXA 2AB0A 4GKJO 1EUZA 3AY3A 1R88A 1XFAA 2R60A 3EZGA 1N5OX 3U5ZB 3CYQA 4U7WA 4PRKA 5EE9A 3JAMA 2W98A 5T8KC 1ITZA 1PTKA 4ZI5A 4C01A 4YNBA 3NHBA 3GCWA 4U7JA 1FX0A 1ZXXA 4OPAA 3IT2A 2O5RA 4X6LA 3WICA 4L50A 1VPWA 1V1MB 1YE3A 3I2IA 4OCZA 1IBSA 2WAXA 1HNZB 3UICA 2ZJBA 2GSDA 4NFYA 1RFYA 3ROEA 1VPLA 4UBOA 4LF6O 4BCDA 1JLMA 3PDWA 2FUG1 4UCWA 3W5DA 3CNBA 3VZDA 4HQ6A 1MW9X 1BKSB 4BWVA 1L4HA 4FFPA 5G0SA 2HPHA 1NV8A 5BY1A 2WMOB 1NOIA 3K9AA 2VKQA 1PS0A 3W8EA 1TM4E 3JQBA 1F2VA 4I99A 1PK8A 1KEEB 1VSTA 2G09A 1DIOB 3DCIA 1X1EA 3EY9A 2JFZA 3QTCA 3PHBE 4M8SA 4UOZA 4US2R 1R16A 3ANYB 2HUPA 3LZ6A 4FR0A 1N77A 3SE0A 4GRDA 5CLHA 3ICOA 4HAUA 4DT1A 4A16A 4R1TA 2PRIA 2Q49A 3J7AC 5LZ8A 1N75A 3BXHA 4A0QA 3EG9B 1BE0A 1UL1X 5IK2A 2ZRJA 4D44A 1CIJA 4QEKA 2WP8J 4PAGA 3BK7A 3JSNA 3PWKA 4OQXA 4PCVA 5HBGA 5MN5A 3AIMA 4FYWA 4F3RA 4TV8A 3D31A 1EB8A 5ISMA 1G20E 1DC8A 4DUPA 2YFKA 2WYOA 1H2LA 1K7XB 2Q1SA 3OHPA 4CT4B 4AO8A 1Q19A 2RMKA 2UXBB 4RC9A 4LXUA 3SWWA 4URXR 4BVLA 5JARA 4G5XA 4QGBA 2BGRA 5EKUA 1VEWA 4OBEA 3A6ZA 3VI3B 5BXYA 4B6GA 1WR8A 1Z47A 2ATCA 4MQFB 2Z1MA 2DF8A 1E2MA 1AUPA 4LV5B 2XNKA 2IJHA 2DHRA 3R3SA 4S0XA 4K81B 4RLSA 3QGMA 4ZI7A 1U0HC 1N57A 2H11A 4LWSB 5F9MA 3V46A 4JWTA 4NU5A 3S5UA 1UM9B 5AH0A 2RD2A 5KQPA 4DXDA 4PN3A 1BHSA 1KKLA 1MRNA 5EE0A 1ZISA 1YVPA 4KXUA 5F7OA 1VSQA 4BQEA 1UEJA 1XEFA 4P86A 3DDZX 4FR2A 1J8DA 5IH7A 5DI9A 2BUBA 2FNAA 4BP8A 4CBCA 2O8FB 1Y48E 3CRMA 1X7YB 4TQAA 4WLFA 3LWPC 2W6JG 3K79A 3MDSA 3FGOA 5CRIA 3C98A 1CFZA 4F6EA 4KMRA 1UDXA 5C8XA 3BCCH 4HJRA 2V3VA 5F5NA 2W6OA 1PJ8A 3WU2Z 3RA6A 3ZMUA 4MWBA 4Y98A 1ECGA 2ZNJA 4MH0R 1ECCA 3UCEA 2PZLA 1IUOA 1FFBA 5J5AA 4ZU3A 4G25A 3F6PA 1UBHS 2WA2A 4ZREA 5KNDA 1KQNA 3FFWA 5AVXA 1CJKC 3WQBA 1PAUA 2GD0A 2YMQA 4H35A 1XQ6A 3AG2C 4H15A 4YCSA 1VXRA 5ECWA 1BE1A 4UUQA 2WSSA 1DRJA 1FBTA 5BQFA 4PRYA 4DCGA 2R6CA 4QXOA 4OFXA 5E8RA 2YJ6A 2P9HA 1P0PA 1N0HA 2J6CA 2P9ZA 2VH5R 2RAPA 2QJTA 5CR9A 4DBLE 1M1YB 2ZXUA 5FB3A 1TAQA 3BUSA 4Q6BA 3M6LA 3ZHUA 1KE1A 4DA7A 1E6LA 1RBZA 3KJGA 3BC1A 1WP9A 2QZJA 5LQNA 2NZVG 4M89A 1BIFA 2ODWA 1SKBA 2ORIA 1SKQA 3VBCA 1RVDA 3EARA 1LTQA 1GZ6A 2R1VB 2JNWA 3O9ZA 1MOZA 3SJCA 1PRYA 2J5QA 1VL1A 2Y93A 4H31A 4EMSA 1RWBA 1ODLA 2JIBA 4WESB 4MCJA 2IHKA 3WYDA 1MAUA 1Q57A 1C1HA 5JY6A 5KA5A 2AH5A 5FWXB 3T8YA 4HEHA 1LXCA 1NVBA 1ZH6A 1L5SA 4HG2A 4HEA1 2IPOA 1O8CA 4IF6A 1VJ1A 3R0VA 3A9CA 4QNMA 4J7AA 3K0HA 2ZTMA 1CDOA 4IX1A 4QGAA 1KJJA 5AD1A 3BKXA 3SD7A 3NU1A 2X0FA 3PFGA 3JVEA 2VTBB 1U9ZA 3KFXA 2NSLA 4NPHA 6REQB 1QUFA 3FNHA 1FTGA 2I6DA 3LPNA 3GP3A 4E94A 3TD9A 3PJRA 1U9YA 4JFAA 3N53A 2OTCA 3TKYA 2C7OA 1RDFA 1VGQA 2AXPA 3EX7C 4ZYZA 4URWR 3SCZA 4Z0NA 2Q67A 4MIYA 1KYYA 3AF0A 2VPIA 5KX5F 5BSFA 1KRXA 3TQRA 1JU9A 3PHIA 5EXEA 4BAZA 1O5IA 2IOFA 2QAGA 2Q6OA 1CJMA 3FOCA 3D4NA 1PZMA 3O03A 3HZRA 4TTJA 5A5FA 1AGRA 5ETJA 3TZ6A 2CNNA 2IITA 1JEYB 2FRVA 2AK3A 5GZ3A 2AOVA 1H6CA 1L9KA 2B2CA 3RRNA 2GYWA 4BMOB 1YQDA 1KYWA 3PV0A 1A98A 1V1RB 1VDZA 5ALGA 1ADFA 1NMUB 3GDOA 3BAAA 4TMZA 4CKEA 2V4DA 4RY9A 3A1FA 3CSSA 4EG8A 3UGQA 1MR3F 4A6DA 4B31A 3HSSA 1NUTA 3LUJA 5KAIZ 1ZM3A 1ULTA 2QSUA 3KOUA 2QLTA 3C3JA 3OUFA 4BY9E 1LSJA 2IF0A 4F4LA 1EN5A 5D2CA 4UAVA 3QVWA 1R18A 1FVOA 3RVYA 5FOWA 3HXLA 3PQ4A 1IBLB 2ZBRA 4DIMA 3DGEC 3JW8A 2C31A 4I50F 1CY0A 2EKQA 5GJWC 1BHJA 3ROKA 1F06A 1E2JA 4RTQA 1U02A 1U43A 3NBYC 1R8JA 1JHQA 2ANBA 1OIVA 1LBTA 4CM3A 4P3YA 4KBGA 3G9QA 1Q0SA 3GGGA 1GTL1 1UBMS 3K0TA 2EDAA 4LYAA 5BUZA 4CRWB 4PXYA 5BR7A 3G8CA 3TRIA 4ZICA 5AJZA 4U9IS 2A5DA 4IJ5A 2ZQMA 4UB6Z 3QVVA 1Q12A 3U4IA 2VTDA 2PX5A 2IU6A 4FYYA 1O5OA 4ZKDA 1BVUA 1VB3A 4MP3A 1NP3A 4R1NA 4X0EA 5C52B 4CXMA 4P54A 1H5UA 5AOBA 1HNXB 3A14A 4ENSA 4F9FA 5EMLA 3I9MA 2BIFA 1H69A 3ROFA 5AI6A 1S0VA 3UAZA 3VR4H 221PA 3O2JA 1DB3A 3GLHB 4P7BA 1GTVA 1XD8A 3DTNA 1JECA 1RWOA 4XR9A 4NFLA 3AXSA 1PQPA 3Q5DA 1JHPA 1WABA 3JARA 5FLEX 2HU2A 4MPJA 2BSQA 2VPXA 1H48A 4GBGA 4XCVA 2AOUB 4MR7A 1EWVA 1C7JA 3R41A 2C1XA 2IEZA 3PFNA 1ND6A 2PKRA 1ZVMA 1VFNA 3BE6A 2PKWA 5ES3A 3C97A 4KB5A 4HLQB 1EXVA 4JOQA 3RS4A 1L7RA 2R72A 2RHCA 2O2CA 2HK7A 2H3OA 2XMCA 1SCKA 2BEJA 2NQTA 2GZDA 2XE8A 3BZWA 3CNEA 1Q86H 2RJZA 1JAYA 5KNBA 1Q3EA 3K5LA 4IHJA 3KZIZ 5JMTA 2FLKA 4MVXA 4WADA 1E1RD 1U28A 5JFTA 4F72A 5KDDA 3SG0A 3NDBB 1DC4A 3ZW8A 5F2KA 3FNEA 3ENKA 5I48A 2UZ0A 3OBYA 3AVWA 1AF7A 2DFVA 1SBYA 4G9BA 4B6SA 3HSYA 4X6XA 3IKTA 4MKIA 1QIFA 2JFFA 5EKTA 4KODA 1CRLA 3ZGVA 2HHAA 4OBWA 2WKPA 4Q24A 3B51X 3AL0C 1AUXA 3KYIB 4OJTA 2FG5A 4DC1A 3ZKWB 4KO4S 4GSLA 2EILB 4TRNA 3Q1LA 4D3SA 3HVHA 3K8QA 3HBLA 2KSQA 3PXUA 1Y6JA 4D45A 2L82A 3IIJA 2I1LA 2BELA 3T4UA 2C9YA 1QOPB 1M0EA 3WNDA 4IHKA 3RS7A 4ZGBA 4FKZA 1QX4A 5K20A 2BHTA 3RREA 5C7LO 1XTIA 4O8ZA 1NTRA 1PJSA 4AYXA 2JCVA 1FFHA 4MVOA 3O74A 4JI3O 4MUEA 1V1MA 4QNRA 3U80A 3PXGA 2ZYGA 3L77A 1JHUA 1UDBA 1J25A 2P91A 2LBXA 1C7ZA 3E03A 2ZBGA 4D0GA 1IHUA 4G8BA 2VWJA 3SVTA 2LUOA 3PNQA 3OA0A 2C5EA 1G6OA 4DY6A 1J6UA 1L6IA 3O73A 2G3YA 1MG1A 2CYBA 2XOKD 4K8RB 4K3VA 1HC7A 1N8SA 5THKA 1KEEA 2FX5A 2X5JO 3DBIA 1Q20A 4DCVA 3UB2A 2XF2A 5BWNA 4JAVA 3DC2A 1TO6A 3PCXA 5JSZB 1N8TA 1VYHA 4NYKA 5BPFA 2N1BA 3ZI4A 4LRUA 3TG8A 3GMDA 4NFHA 5AW2