5LYJB

Tubulin-combretastatin a4 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cis- and trans-combretastatin binding to tubulin
doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lyjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lyjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lyjB01
4O4IA 3WGJA 1RQ7A 4ZI7B 3WGLA 3M8KA 4O4IB 4TUYA 5MN4A 4FFBB 4ZHQB 5JCOA 3UT5B 3RYHA 3RYIB 5JQGB 3VO9A 2RHOA 5JVDB 2VAWA 4X20A 4HNAB 3HKCA 3RYCB 5JH7B 3RYHB 3RYIA 5JQGA 1JFFA 5LP6A 3RYCA 3JAWB 3VOAA 4B46A 3HKDA 4EI9A 2R6R1 3HKCB 3JAWA 1SA0B 3ZBQA 4I55A 5JH7A 5M7EA 3N2GB 3CB2A 3E22B 1SA0A 5CB4A 5CA1A 3ZBPA 5JVDA 5LP6C 4I55B 4X1YA 4ZOLA 5LOVA 2Q1XA 5LXTA 3JALB 4B45A 5IJ0A 4TUYB 1FSZA 3JASB 4X1IB 5LXTB 5GONA 4EB6A 5EIBC 4YJ2B 1TUBB 4X1YB 4O2BA 3VOBA 4YJ2A 4X20B 4HNAA 3JASA 4X1IA 2BTQB 4YJ3B 2XKBA 3RB8A 1TUBA 1W5BA 1JFFB 3JARB 5LP6B 2BTQA 4EI7A 3HKDB 1Z5WA 3JARA 1W5EA 3JALA 5KMGA 3N2GA 5GONB 4EB6B 5EIBD 5CB4B 3N2KA 5CA0A 1W5AA 4DRXA 4O2BB 2Q1YA 4F6RB 2RHLA 4ZOLB 5IYZB 5LOVB 5J2UA 4O4HB 4YJ3A 2XKAA 5IJ0B 5CA0B 3JATB 4LNUA 4O2AA 4U3JB 4O4HA 2RHJA 5BMVA 4TV9B 5JCOC 4IHJA 5C8YA 3ZIDA 5EZYB 4DXDA 5ITZB 3JATA 4LNUB 4O2AB 4U3JA 5EZYA 5KMGB 5MN5A 4TV9A 1Z5VA 4I50A 2BTOA 3WGKA 5KX5B 3C8LA 3HKEA 4DRXB 5KX5A 5ITZA 5J2UB 3HKEB 3WGMA 4TV8A 4U39A 4WBNB 5J2TA 4I50B 2R751 3M89A 5IJ9A 2VXYA 4TV8B 4XCQA 4WBNA 4O4JB 5BMVB 3N2KB 5EYPB 5IJ9B 5C8YB 4O4LB 3VPAA 3HKBB 4X1KB 4F6RA 4ZI7A 1W581 5IYZA 3RYFB 3WGNA 3HKBA 4X1KA 4EI8A 3VO8A 3RYFA 5EYPA 1RQ2A 3JAKB 4IIJB 5FNVB 4E6EA 2RHHA 4IHJB 5LYJA 3JAKA 4KWEA 1RLUA 5LA6A 2VAMA 4FFBA 4ZHQA 3UT5A 5LA6B 4I4TB 4O4LA 2GVIA 2VAPA 3R4VA 3V3TA 1FFXA 5MN6A 1W59A 4I4TA 1OFUA 1W5FA 4M8IA 5J2TB 3E22A 1TVKB 4IIJA 4O4JA 5FNVA 5CA1B 1FFXB 1TVKA 5LYJB
chains in the Genus database with same CATH superfamily
3L7DA 1SKVA 3W5AA 4KQ1A 4LZPA 3A0HZ 1A2QA 1G6KA 2FUKA 2HO4A 4FOOA 5KO2A 1PWXA 1UZAA 3BXEA 2F55A 4P4SA 3X1WA 4G01B 1TJ4A 4P9PA 3BHMA 3H0EA 1NLYA 3FVQA 1V3QE 1C3OB 3PFCA 4L4YA 3MB5A 1R0SA 3OOHA 4EECA 4F93B 5HK9A 4DPLA 2A5DA 4BQSA 4UTRA 3CZMA 1YQDA 4M1QA 1Q7YW 1I7LA 4ZHYB 1N2GA 1SCDA 2VNHA 3PX2A 2FPIB 1ABFA 1RHJA 1Y5RA 2HGSA 2Q9AA 1P81A 4WFQA 2PSEA 3ZGNA 3QBTA 4IX1A 1W8IA 4ZP1A 5EQJB 5LN1A 1GTZA 2DN9A 5CT4A 3E15A 1FFAA 3N2EA 3EZXA 2VWHA 3C45A 5FOSA 2C2XA 2IPAB 3RUCA 3Q4GA 4RY9A 1PL0A 1HNXB 1JIQA 2B4KA 2Z83A 3WLSA 3LPAA 4WVFA 2CMHA 3EYAA 1G1MA 1ODSA 1DIGA 2RHBA 3LUHA 4IZHA 3K0FA 1T5LA 1FOEB 5A06A 2XKKA 1SXJA 1Z2AA 2GEJA 3E9EA 3GFQA 1OWOA 3M5DA 1KJNA 3PENA 4ZQGA 1ZUQA 1KSHA 4BNVA 1KYOF 4UM7A 1Z0DA 4MKFA 5KUTA 2FRDA 2OCCB 1G9TA 4ZPJA 3RG2A 1OZAA 4ZYXA 1RP3B 1UDRA 1V9SA 2CJPA 3CINA 3BH6A 4IF6A 4PICA 5CUQA 2V3CC 2EQAA 4UOEA 4YAOA 4C2UA 4ZCLA 3C5VA 3TVDA 3T1NA 1GTRA 4L51A 5KOIA 2OSVA 1Y4UA 2JI4A 3L18A 2LCFA 3V1LA 2QMOA 3KL4A 1GXSB 2ZIAA 3PICA 5C34B 2O06A 1K4MA 4J76A 4DANA 1RWPA 3EBPA 3OSZA 4Y2HA 5DGCA 5K8TA 2NO6A 5DLEA 3LFHA 1RXWA 4NXMB 3Q8WA 3BAFA 4A36A 4JI5O 3VHXA 4Z4GA 2PS0A 2JK5C 5SICE 4KR6A 2PSDA 3KSDO 1B2LA 3L0SA 3W7UA 1N5OX 5EFZA 2J6CA 3UHOA 1TEZA 1UJ2A 4Y2JA 3AHGA 1SCQA 1SK9A 1TT7A 1VLQA 4A1FA 3QUCA 3ZYCA 2JS7A 1EGHA 4M60A 3E03A 6GPBA 3D2AA 2PMPA 2R1TA 4HP8A 1HEYA 3ND6A 4MLCA 3IEWA 2FMLA 3GYBA 4CKEB 4I50A 4RF3A 1LBTA 3H7AA 1OBOA 3ZEDA 5ITZA 3INRA 2O8DA 4V1CI 2OAQ1 3M89A 4N5NA 1IM8A 1E2QA 1N0UA 3BORA 1E9RA 2BZGA 4RPIA 3RHZA 4KMOA 4LBEC 3FX7A 1YZHA 8ABPA 4M53A 3RBVA 3TSWA 1FBTA 2D5AA 4MW2A 3LK6A 4EDFA 3EGWA 1JBQA 3KOUA 5GZ6A 1EXVA 4QT0A 1G4HA 3G8AA 1GQ2A 3PNPA 1P4RA 1Z7YA 5GWXA 4FHEA 4CRWB 2ZUSA 1C3JA 3KQLA 2C3OA 3Q41A 1OMOA 4XWAA 3DHVA 5FAXA 5C4GB 4IHJF 5BR4A 1G7TA 5CLIA 3WG7C 5HQ3B 4UXIA 2VHVA 5IYZF 1UL1X 4B3RB 1VI2A 1KGDA 3U7QB 1C14A 1TKBA 3LHKA 4LMBA 1RPAA 2C92A 2IJHA 4JEUA 1W88B 3L1JA 4R3NA 3ZHZA 5KQSA 4RKFA 2OZLB 3C8MA 3GO4A 1GAJA 1NWHA 1P4SA 3SQDA 4EEQA 2OCIA 2Z98A 3K0AA 4GPTA 3CYOA 3LUFA 5FNVA 4BIZA 4CLRA 4ABTA 4UVAA 4E5SA 4YTEA 4F5WA 5AVJA 3T0IA 3X2SA 1TM7E 1KK3A 2GEUA 4FLUA 1NMXA 3I4LA 1MUUA 1TGOA 1G8MA 1TDJA 2Y4OA 3EXIB 3JQ9C 4L4UA 3STTA 3CPWU 3RTCA 1MENA 3BCUA 3NTUA 1GUFA 1THMA 5F2NA 5KVAA 4W5RA 4HDAA 3TLCA 3DHYA 4KMRA 4WZ6A 3L43A 5JU6A 1YCIA 4G41A 1VCHA 2HA3A 1D9ZA 1GCUA 4YCDA 2G25A 1CFZA 1WIWA 4U2GA 5FP0A 2DZDA 3AG6A 2IH3C 5JH7B 2DHCA 1BA2A 5E6RB 4QOIA 3O3OB 1E2HA 1JD1A 1XZNA 5C8YF 4N40A 1D04A 3BXGA 3K6KA 1OBVA 3T1HB 3DCJA 3KWMA 4HNRA 3TR6A 4QPCA 3OJCA 4LDJA 3AL0C 1G6OA 3IPAA 1QZZA 4YK7A 1O77A 2XMPA 5T64A 4N18A 3LP6A 2VGMA 3TXSA 1HM5A 3DO6A 1I2CA 2ISCA 2X8LA 2PEYA 3O7WA 5I9TA 4BO8A 4DG8A 3ZDCA 3ZY5A 1IBKO 4RH0A 2B20A 2OCKA 4KACA 4N8SA 1MIOB 2DOSA 4QYXA 2RGWA 4PELA 4ESEA 2W6PA 2CFCA 4DGQA 4HVCA 1T9BA 2DMRA 2Y1DA 3P0EA 5IW8A 1QKIA 4UHKA 5HFAA 1L7BA 2FPKA 2WFMA 4CU2A 5JW6A 1S9DA 1IG0A 2B61A 1H6AA 2I3ZA 1WF3A 2RSLA 3LBYA 5DM2A 3K15A 1KZHA 3V8QA 2QG9A 1GQYA 2EP8A 4ZK2A 1R9GA 1FXHA 5DTIA 2ZI9A 3CUKA 4PGHA 3G67A 4JLPA 1K4KA 4J0KA 3V1UA 4YV1A 2Q7OE 2WTUA 2QJRA 3KT0A 2I4TA 1SKQA 3EXHB 3PFWO 3TQTA 4EATA 2R1ZA 1Q92A 3BB3A 2C2YA 5HKAA 1F60A 3OI7A 3PLNA 1Z6QA 4Y2XA 4ALLA 1EVZA 1XI2A 2OV1A 1UDXA 5H4GA 3F46A 1OIXA 2D1FA 4ID3A 4MW9A 1K6MA 3L3BA 3VPCA 4K9MA 4YDHB 4PX5A 2YJ5A 3W7SA 2FDXA 2ID8A 4ZYZA 1XU4A 3NIFB 2PBLA 4HB4A 4QYSA 3B2NA 3KEFA 3T61A 4EKDA 1ZCBA 1SEPA 3O95A 2G6TA 3V00A 3G2HA 1AY0A 2C4MA 2JIZD 3TJRA 4FB5A 3I61A 3LC0A 3IHWA 4CNQA 5DN6D 4X3MA 4TWJA 3ZDZB 1NN1A 4HX5A 2LQTA 2JEZA 4JHLA 1CC1S 1PTJC 3REQB 2DPXA 3VNBA 1GTL1 2W90A 3KB1A 4BATA 1PU2A 2R7KA 4C6HA 4EQ6A 4HWOA 2R44A 1V43A 3WK9A 3BMQA 1N0WA 5AXDA 3UOGA 3U0OA 1V5EA 3G2PA 3K5HA 3R0ZA 4GP7A 3GWZA 3D3EA 3WPXA 3K0SA 2FUG6 4C8EA 4Y2UA 4G8CA 1CNFA 5HE9A 5CFOA 3I3OA 1ODCA 4ALKA 4PS0A 1Z2PX 3LUKA 2JDIA 4EEKA 2L0XA 3JAMN 3CPHA 1FLNA 3EXEA 3AFNA 5A4DA 5KWSA 3M6UA 3ONEA 5AESA 4KMSA 3X0DA 3TB6A 2F7SA 2X8JB 4DMUB 2IZ7A 1CUHA 2V9CA 1Z0KA 2NQTA 4BYMA 1FDRA 1CQWA 2QX8A 3OHSX 4INOA 3K8ZA 1PSDA 2Z08A 2C2WA 4YCJA 1DRJA 3ZJTA 4IICA 1P4AA 4DWVA 2ETVA 2E89A 2IT1A 2NZ2A 5EHXA 4HRYA 5KKNB 4LA4A 1Y81A 1CULC 2AMFA 5DN6G 2V03A 2KW5A 4S05A 3C1AA 3WY9A 4ETMA 3SYOA 1N7HA 4PZ0A 4S35A 1KQNA 5JAIA 2BR3A 3BHJA 2QDKA 4F85A 1V2HE 3HZZA 4C4ZA 4DDUA 5A4FS 1Q17A 4FINA 4DC9A 3B5JA 1EIZA 1QZ3A 1OXMA 2G63A 3M1YA 5AI8A 2R8RA 4CZZA 4BVQA 3GJ7A 2WVJA 3L9WA 3O0DA 4BTEA 4FX5A 3MRSA 1CRPA 2E1RA 5L3DA 4LY6A 3GEMA 3VNAA 2GVZC 3JQ9A 3KUKA 4ENPA 4AP9A 1WP7A 1S1MA 4J3JA 2EF1A 4P7FA 4R9RA 4RC9A 3MGGA 4C87A 3JAWA 3RQIA 1SZCA 2H3HA 4UVEA 1MG0A 1Z2OX 3EWNA 4G84A 3TLGA 2DFVA 4ILEA 1T4DA 3FDFA 4IG9A 9ATCA 1C7ZA 1UKZA 4CDRA 1C30A 5JVDA 4RX1A 1XTQA 1P2VA 5DJ5A 5EZSA 1IJKA 3UWOA 3CF6R 5AHOA 3EFFK 4HEA1 1NULA 4YMHA 4C0HA 1V1MA 5HEKA 4NEQA 4UQLA 4DW0A 1UT8A 5EY5B 3T8YA 1OTXA 1VB5A 4BC1A 1RTTA 3V7UA 2WD8A 5L7TA 1CJVC 3TKYA 1FVOA 2QY6A 1XMVA 2VHWA 1IUPA 2P06A 2HJSA 2IY8A 2Y0BA 4JT4A 4B7ZA 3F5SA 3VYRB 5TT0A 2ORWA 4A8JA 3Q15C 2NUAB 1GRVA 3DKRA 2J6HA 4QDUA 3AU9A 3D4BA 4IUCS 4LKRA 2ZCEA 3G71V 2ZVDA 1PR1A 1E3TA 2RGUA 3OF3A 4K46A 1M2JA 4INZA 3A3PA 3BXFA 4OX9Y 2E4XA 4XD7D 4C0WA 4J94A 1EVKA 1TAGA 2QRLA 2ZR2A 1I3MA 1Q84A 2AGVA 3CWQA 3DO8A 3Q2KA 3AZPA 2JI6A 3HCEA 4KIUA 1NQXA 4EFBA 4RM2A 1KEPA 5CA0B 1K9MH 2PJRA 2CEAA 2AEEA 1LC3A 2I78A 3A26A 1XU9A 3CLRD 3H5WA 4UV8A 1LDYA 1MA0A 3L01A 1L5MA 3ZNOA 4JYCA 1T0BA 3B38A 1KC8H 1HLDA 4DZTA 4DEXA 4MDHA 1JQJC 4R68A 3PCTA 2OV8A 5IMSA 1KI1A 3ZN1A 3I37X 2GAIA 3UY4A 3CG0A 1VIVA 3PQ3A 2RHWA 3BTOA 3R4CA 5ECDA 5ADHA 1VECA 2XUDA 3MVEA 1T0JB 3ON1A 4IJKA 4GLBA 5B3AA 4IM7A 3RC7A 1WEHA 1E7WA 1E79G 2Q5JA 2J9FA 4OM7A 3ZIAA 4OQZA 4Q3NA 1Z9BA 1R37A 1L6RA 5C0OE 4BTLA 5G3YA 2QJTA 2VH2A 4KWHA 2RGGA 2A5LA 2UUPA 2VXCA 3AEUA 4IUBS 3T1QA 1IEWA 4BMVA 4EGFA 1GITA 4EPYA 1BU5A 2HS4A 2JJMA 4N7RA 3CIFA 3EHDA 3ZEAA 1TVCA 4UQOA 1T6XA 2ZRFA 3ZIAD 4XJSA 3PX7A 1DOAA 2K2QB 5AICA 4D4LA 1QH0A 2HU8A 1N3LA 2IY9A 4PVDA 4PAOA 3CO0S 3KIPA 3O8QB 4LMAA 1EWYA 5FFMA 4QYWA 3ZHTA 2GN1A 4IINA 1JQ5A 4PO1A 4S3MA 3V97A 4K3AA 4NFYA 1DC6A 3CX6A 4RD3A 4B0OA 4Q6WA 2O5RA 2Q49A 3H5VA 2O0LA 1GPBA 1YTFB 3LDTA 2H31A 3FPSA 4PCUA 4PYLA 4YWHA 5BN1A 5H9WA 1QXSA 1G5HA 2O9JA 3OMIB 2AC7A 3BH0A 3LV8A 3KZ1E 4FEGA 5H3HA 4JYAB 1I3OA 1U2RA 2WEKA 4YX9A 6AT1A 3FR7A 4TROA 1VQ7F 3R6TA 2O2HA 3EHEA 5ILGA 1YI8A 3RFTA 4RFVA 5CB0A 3PJRA 3O84A 4NU6A 4LWZA 5CXSA 4DCOA 3TIIA 1KR2A 4PV1B 3NHLA 4TKZA 4N41A 4GBMA 4L4XA 3L6RA 3WQRA 4J07A 4JAVA 3LF1A 3OFJA 3RRBA 1EX6A 1FVHA 1A5AB 3QFFA 3VR2D 3PC2A 5B37A 3UAWA 1RC1A 2J67A 3E5NA 3NX4A 1R9NA 1X52A 1Z3IX 2PSHA 3L6UA 3LWBA 2IA5A 1FS5A 4KAJA 1RQLA 5COAA 1BHBA 1SHLA 1YS9A 1NX9A 2IHJA 2QTFA 3HL4A 4D02A 3TSCA 1YVPA 3MEQA 3WPWA 1UPUA 3ZV5A 1KMIZ 1RZRA 3N75A 2YY5A 2O05A 4IVPA 3OT5A 1XZBA 4MGEA 5CBGA 1HORA 1N6PA 2GWHA 2P77A 5I4IA 1ODIA 2NU9A 3G2JA 3CVYA 1W44A 1JMKC 4OGQB 1CZNA 5E9QA 1QV6A 1Y67A 4UV9A 3K73O 4WN3A 3QTBA 5HS6A 4H6WA 2CH7A 3NTQA 2C00A 4FILA 1IXBA 1MQ9A 4O33A 4XDHA 5A2QM 5DLYA 1E64A 1S9HA 3CUSA 2OTMA 1DTSA 4UDOA 5HKBA 3NBFA 1L5NA 4MHTA 1ZJYA 2NX2A 1RWVA 2YYEA 2FXIA 3D6VA 5EJIA 3SPJA 4H6XA 2EX1A 5EWJA 2GGSA 4AUEA 1IPFA 5DXJA 3JSNA 4I0XA 4L4ZA 4M9ZA 1PZMA 3CBQA 5CDFA 3CF0A 4Y6GB 1J1ZA 1BYUA 3R8FA 3B5IA 2A67A 2P9FA 3E9DA 3FMFA 3PNMA 2VBFA 1Z8DA 2OHOA 3CM0A 3C6BA 3D8TA 4JEIA 3SFTA 3S2EA 4F4DA 4H0NA 2YX1A 5ED0A 3WJQA 1Q90D 4XWOA 1KQSU 3D81A 4UMDA 3WLEA 3M2TA 5JSHA 3WMRA 5F5NA 2C42A 4CCYA 1L5YA 1OCZC 5B66Z 3CQ9A 4RHUA 5LBTA 4URXR 4ND2A 1EFLA 3TNJA 3WLIA 2PBFA 5KHAA 4JTAB 1BTOA 4LF5O 1ELOA 3NHBA 1TYEB 4WLNA 4RF4A 4I3HA 3DEAA 2CUGA 2QTSA 5IN4A 4PLGA 4Z4EA 3EVEA 2ZWOA 4MUNA 2VJQA 5FL7D 1UMBA 3E8FA 3VISA 1F6WA 1ZCAA 2XUPA 1T3GA 4WZBE 5HKOA 4AJJA 3NK7A 1DX9A 4RGVA 2DBZA 2C0PA 4Y7DA 2JFBA 3O4RA 1QQCA 5L3RA 5IS2A 4MTOA 3MOGA 3H2GA 4YLEA 1G1XB 4H6PA 2YIDA 4QYMA 2IX9A 3O9OA 1ZUHA 1D4ZA 3PJGA 3QMMA 2AFVA 2QUHA 3ZVMA 1ZK3A 1IY1A 2F9MA 5K2MA 1M0EA 4DKJA 5KYKA 1V26A 1IOZA 4M36A 2CHEA 1LI5A 4Z3DA 3TBHA 4OOFA 3W2EA 1XN4A 5LQJA 1AMOA 4AIRA 2HA7A 4RHYA 1I0ZA 4IUDS 2C4HA 1VKNA 3DLTA 1TEXA 1NU8A 4RTLA 1RYEA 2XUQA 1MC4A 2JFGA 1BE1A 2VJKA 1OA0A 1P7GA 2ZIXB 4NTWA 2CVPA 2Y69C 2B4QA 2WM3A 1F8UA 2ZPUA 3C4VA 1ISGA 3JQ8A 3DYBA 4J0CA 2X1LA 3KKQA 2A0LA 1P72A 2VYND 5AOBA 2DT5A 1W8DA 1J42A 3AG3C 4I5SA 1QANA 1LLCA 1UFKA 2C07A 4TMXA 5I6DA 3S3TA 1V5GA 5KHKA 1SKBA 3D4LA 4G1FA 1E2EA 5E4FA 1YRLA 3X2FA 4YROA 4EG7A 2CFTA 1AUXA 2WV7A 1UBRS 3DMNA 4FNOA 4HB0A 1PJBA 4IJUA 3ZQ4A 5HY4A 2OENG 1K7EB 3U3MA 3EVFA 1PRYA 3O74A 1S3FA 2PKQP 4LJRA 1I1HA 3B82A 1DWOA 2H18A 5D3KA 2GCGA 2HK7A 3RABA 2L19A 3IA7A 2HA4A 4RA9B 5GIOE 1CJSA 2YMMA 3AP3A 4ZT3A 4JLVA 2A35A 3A6HA 4NS1A 2JEYA 3DBRB 5JD4A 2BW0A 5HDQA 1I5RA 5IEBA 1VIBA 4OHYA 3I7TA 2IX3A 4D44A 1JUDA 3H0KA 3JZMA 3TE7A 2NZJA 4EIWA 1DT3A 5KX5F 4Z3KA 5KWEA 3DB1A 4IT5A 5B1AB 5J4KA 4CEHB 1FTYA 1EFVA 4L15A 1H8HG 3JD0A 4P7BA 2LCQA 2HP0B 3PFFA 1QO0D 2V7GA 3B2EA 2AL7A 4PLHA 1UKYA 2QI9F 3RIHA 3WNVA 4BLUA 3O3NB 4HSGA 3M4ZA 4JUDX 4QNHB 2XE6A 1MC5A 4MRNA 4QUJA 1RD4A 2JEXA 2M6KA 1VDZA 4EJ2A 3L0CA 3PQDA 4LAFA 1XZMA 3Q8XB 1VQ7V 2AOVA 4OIMA 2Q2VA 3HJBA 2IIBA 3WB0A 3H11B 2DPMA 1SKAA 1H2AS 3D1JA 3DL7A 2WWWA 3KYDA 1WDWB 3QBVA 4ZPXA 3MDSA 3IC5A 4PWTA 3FCXA 1QLJA 1F3OA 2VKQA 2YQ4A 3OURA 1FU7A 2ZRBA 2YWRA 4UFNA 4AG6A 5LOVB 5KS2A 1S8FA 1KAOA 3QV2A 2XNDG 2RK6A 2YTZA 5C7IO 1P31A 3WA6A 3L7NA 5DGHA 4FU0A 4DCUA 5KTOA 5AD1A 3JATB 4LNUA 1CUVA 1NOIA 3GIWA 4DIUA 2EJ7A 1XRRA 2BAGA 3K1AB 4GLLA 1S2IA 3TEFA 3UBMA 3BMCA 3D8NA 2XYVA 3AB7A 4MW6A 4DXDA 1Y4ZA 3OEYA 1Z5PA 2VFAA 2ZSHA 4MI9A 4PLCA 3ZCUA 3FAVA 1YOVA 3I83A 3KTOA 4G5SA 5A6SA 3THYB 1NQ3A 3C8LA 1C9YA 4K9RA 3TOSA 5FH9A 2PVCA 3C3XA 3KVNA 2H5IA 1ZD2P 2CV2A 2AKEA 4YMGA 4RNDB 4XEUA 5BNTA 3VUEA 1AZWA 3GUCA 1ODFA 1IBMO 1E2NA 2VHUA 3BVPA 3MCTA 3OJ0A 4AM8A 3N87A 2Z6QA 3M9WA 3AEZA 4RU1A 1GCGA 5GM1A 2WVHA 5C37A 4EF5A 3A9TA 1OWLA 4IL6Z 3V2UA 2O2GA 1NJ5A 3BD6A 2IF2A 2W4QA 5B53A 4OH1A 1JR9A 1SQPH 2JH3A 3KPVA 5AJZA 5D5HA 2VTBA 3TLJA 1VQ8F 2VR1A 1VLLA 2IXBA 3GGOA 4JZYA 1AR1B 4RAQA 4TS4A 1SPBS 4G6ZA 4PPGA 5CJPA 3WZLA 2ZR3A 2BBTA 3RRXA 4QPDA 2RB9A 5FYDA 2ZRMA 1EHYA 2NP6A 1TAUA 1QRSA 4FFBA 4JJ8A 2OFPA 5CYFA 5DYYA 1JEOA 2Q5ZA 1QH8A 5LMZA 1BH6A 1WXDA 3A28A 1HDJA 2RGAA 3H86A 1YEWA 1VQ6V 1FJGO 1WZUA 2HHAA 3CLRC 1G41A 4U7FA 3JTEA 2RB5A 1W36B 1EUCB 2Z2XA 1H3EA 1RCUA 3AESA 3PQCA 2AW3A 3FOEC 5DNCA 3FB1A 4C0XA 5KVVA 2EIJC 3ZXXA 3DAOA 2FMTA 5FEMA 1E1RA 3IHTA 5DBEX 3WL7A 4WFEA 2VJLA 1QAMA 1PK7A 3LCMA 2P41A 3UT5B 1OIWA 3UQ8A 2BISA 5KSYA 3I62A 1V55C 1LH0A 2LXNA 4ASUA 2E0IA 2C8JA 3DXRA 3INTA 4D3YA 1OI7A 4PANA 1R0XA 2FQYA 4WXEA 4BVFA 5BR8O 5BPFA 3VAYA 4UPEA 2HMAA 2B8JA 4IHKA 1TX4B 4LXQA 4OYHA 3ASUA 5CHEA 2QTOA 1PFVA 1HFJA 2A5JA 1M6VB 3CH6A 4A0FA 5EQDA 5ALUA 3N2GB 4HLUA 1RWBA 2IGTA 5CHYA 3R7AA 3WYAA 4DMHA 5F23A 2R7AA 2GJ4A 3GA0A 3PRJA 4B4VA 4EY4A 1CFJA 4Q9IA 4TXJA 3IDOA 3MJ4A 3NYRA 4KGDA 5GOTA 1S5LZ 1U7ZA 4M38A 1NUUA 4MTLA 1YS4A 2B7BA 3KSAC 3OLYA 3UJDA 1I7PA 2WILA 4OK5A 4ENQA 3HTXA 2VAXA 1Z2NX 1EYZA 2IGBA 2ZTUA 3B78A 4MEAA 1RFLA 3AETA 1THZA 2BJVA 2CUTA 4C89A 1JEQA 1TC2A 1OGJA 5LP6B 2VI5A 1JYEA 5WRFA 1MFPA 4IJWA 3ZC3A 4OJMX 4F2DA 4GWLA 2BFEA 3B3QA 2IS2A 3LBFA 4CLXA 3P1JA 3IR9A 3INYA 5C1OA 1ES9A 3SSOA 2WG2A 1XEWX 4FZJA 1V5IA 4P35A 2GN9A 3SIWA 3PNOA 1P9LA 2LUOA 1OCEA 2E85A 1T15A 3HDTA 3PNSA 1WQ3A 2D1RA 3HPQA 1UDBA 5BT8A 2XDYA 3FTEA 1KJ8A 2E48A 2A06H 1SXJB 4NYMQ 2VRWA 4BQEA 6REQA 5E9WA 3RSSA 1ODKA 1SD5A 3VR6D 3RJ5A 4DF3A 5FUXA 3HDHA 4HGRA 1SKUA 3AERA 4X1OA 1PUXA 2B9VA 4O29A 3UGTA 2AC2A 1M56C 3LLUA 5JSFA 2WTNA 5EJ6A 2BMDA 4RV5A 2QBYB 2PLRA 3DXXA 4FLXA 1Z18A 2XCUA 4BX3A 2I6RA 4NIMA 1CY0A 2WYHA 1TF7A 1QM5A 3IRVA 4LXIA 3R9XB 1BMTA 2QGNA 1AB3A 3CH5A 4TXMA 2HJFC 3A04A 3NCHA 1ZJ5A 1K3UB 4IIUA 1NKTA 4KXNA 1KFCB 1VLHA 3TOXA 2EQ5A 2V0GA 5GW7A 1DKPA 1Z35A 3H7IA 1JFVA 4S0ZA 1KFBB 3MWEA 1GGHA 4W1QA 5ENVA 3AUFA 5HK8A 3V4VB 1Y8RA 1GN3A 1YB1A 3EEBA 3KWLA 2YJ6A 2RH4A 5CH3A 4F3NA 3KELA 2XAFA 3T1CA 4GSKA 3IUPA 3UMVA 3VVLA 3VR5A 1KYIA 4REOA 1VSUA 4MIEA 1XFDA 1WW2A 1N57A 2OXCA 2FZEA 1XJWA 1ETHA 4RK4A 2CZWA 2HQSC 1F8XA 1M2FA 4OU4A 5EERA 3RSGA 3CCLV 3KJZA 4IF4A 5LZ2A 1LGYA 1B0ZA 1JLHA 3C74A 4D43A 4NXNO 1XHXA 2G77B 3QA3E 2RGYA 3BIFA 3HA2A 2WTEA 4P86A 1H0SA 1FSFA 1KK1A 2BMVA 2EFCB 4L6CA 2Y05A 4RCVA 1U97A 5ESXA 1XZAA 4C14A 1ZHOA 2FF7A 1Y34E 4QX6A 3AHJA 3SKYA 2QWXA 3EVBA 2DQYA 2O6LA 1ZWZA 4AS3A 5C93A 1FNNA 2GASA 4B2YA 4JZ2A 1PT5A 1PD3A 4C7UA 1KO1A 1SOMA 16PKA 1P19A 1TQ8A 2FOIA 2F66C 2KQUA 3E83A 5IAEA 5ICSA 4PC6A 2O7NA 3HP4A 2PHNA 1P8JA 3U7FB 2J3MA 3IXQA 1VSVA 4OMDA 3BJRA 3FAZA 5JCOA 1XB2A 3NM4A 5IJAA 3F4KA 4Q15A 3QXCA 3U7IA 4CF6A 1C7IA 4LCBA 1FAFA 4EGCB 6YASA 4JI2O 4TYYA 3CE2A 4BGUA 2V1DA 5EIWA 1VQ4F 1JJ2U 3GZNB 1PQUA 1W87A 1U96A 1JJOA 3C15C 3GK3A 3A31A 4JBXA 1US8A 4L0DA 3VMMA 3WL6A 5CD1A 1W88A 2LBXA 2EDAA 3FW1A 1V6SA 1VXOA 3KVRA 1MO6A 2FHPA 5TISZ 3CPJB 1LX6A 1I36A 2WNSA 3UFBA 1C30B 1G17A 4C7JA 5AVXA 1S5PA 3MWJA 3WU2Z 3RU2A 1DIRA 3FNGA 2X9VA 2D8MA 3GZ4A 1WDMA 4JI3O 1H6DA 1XKLA 2AQHA 2GO1A 4WZAE 4AMUA 1RQPA 2D4AA 3KQNA 4KR7A 2P6JA 1Y66A 1FSZA 2H85A 3VAZA 1AHPA 2NV2B 2AN5A 4WNCA 3TGLA 1TUBB 3VZBA 4A6XA 5D8DA 4C20A 3UPDA 2CZCA 1PFGA 2PYZA 3BGIA 4FFMA 1Y3AA 4QGFA 4PM4A 4ZYYA 2GKSA 4BAGA 1G20B 1H9AA 4E08A 2BEWB 2NOAA 4ZD6A 1E2DA 2VYFA 2B9EA 2RGEA 5C9ZA 4JXZA 5FR2A 1ESZA 2CLKB 2I3BA 2WWFA 2JI9A 4Y1EA 1X1CA 2FN9A 3T5CA 1NMUB 2X8BA 3OW2U 2AQIA 4WCFA 5F98A 4RDCA 2QVCA 4ZV9A 4BQRA 4D92A 1EHCA 4I9WA 4L73A 4M0DA 4YRNA 1G3MA 3CNHA 3RREA 4DR2O 1H1TA 2GDSA 1G55A 3BL6A 4BT6A 1KZ9A 4C82A 2RG7A 5F7ZA 3HN7A 2HMSA 4WKPA 4B3SB 2HRUA 1ODLA 3OT7A 1RLIA 3QUSA 2OWOA 1YZKA 2JLAA 2XAAA 2ZIZA 5LKRA 2BEUB 2W2KA 3NRJA 3PT5A 1A3CA 2ZAIA 4ESVA 4LFCB 3PC4A 2OC9A 2CE2X 1VSTA 2EGHA 1UAAA 3DPUA 3IT2A 4BVKA 1HNZO 1LBIA 3TM5A 1RU3A 3DE2X 5DYIA 1F8GA 3SM9A 4TRJA 4KPYA 1GNPA 3EFHA 1T8UA 1FYJA 1U28A 1ZCFA 4KIWA 4ND1A 2COUA 5MFZA 5ALMA 3HKEB 2WFLB 4CFSA 5HX7A 5AMXA 4J6EA 1D8TA 4AHCA 2QA4F 3LC7O 4MYHA 4DEYA 5HQ3A 2PM8A 3QXGA 2MMGA 1ZK1A 3ZLVA 2IM9A 4NMLA 2GERA 3HVRA 4PD4F 6LDHA 2BGRA 4PHGA 4ZYVA 1XVAA 3B8EA 1K8AW 1YFZA 2WJ3A 3OM8A 2BBSA 1TA9A 1CCWA 1UZUA 2FHSA 3CEMA 1EK0A 4MCJA 5G53C 1XVVA 1C4OA 1E1CA 2HN9A 3CYPB 3LUJA 2ZOVA 1R00A 4FJ0A 5FNVB 4AZTA 3QFSA 4I99A 2IIVA 4J3NA 4AKEA 2G1JA 4Z5XA 1B16A 5ECGC 4BFSA 3GT7A 2P75A 2QV0A 4IXDA 4N21A 5T7BA 2QAGB 3FOCA 1TYDE 2MWMA 4NC9A 3ZR4B 3K3WA 1SVNA 2W6ZA 1KYYA 1R4MA 4I9HA 3BMXA 2XMGA 4N3AA 4Q3KA 1EVEA 2ZBUA 2P2CA 2WPDD 3LSTA 1WOMA 2PLAA 1VPDA 3NBQA 3ROTA 4BO3A 5FRDA 2C7QA 4QPJA 3C5HA 3KQQA 1QX4A 2AXNA 1GJRA 4FK8A 4L28A 4O4JF 4EQ6B 2CHQA 5A03A 2Y0PA 1FFXB 1YR8A 3HB0A 4BBJA 4F92B 2XZOA 5DHQA 4CQNA 1GZ0A 3VNUA 4ZARA 3OWXA 4I81A 2X0EA 2NP7A 2NU8A 2YOHA 2XMSA 1NVAA 3C2QA 4QUDA 4KL8S 5FV7A 4C4XA 4BPRA 2JVDA 1ID1A 1VZ3A 3L0ZA 2O8EA 4QBHA 2OLEA 4ZCIA 2K5UA 4QREA 2ETXA 4F45A 4DCVA 2PH7A 3KR9A 4J29A 4HDQB 4KIJA 2OD2A 5HHTA 2VATA 3S70A 1CY6A 1DC7A 3H19A 4XVQA 3SIRA 3CF4A 4OI4A 2FLWA 1EXMA 4F21A 1E5QA 1JW9B 4MPRA 5LMCA 2CNNA 4HWTA 1BT8A 1XQ1A 2C4WA 5EIFA 4EB3A 1E58A 1N2BA 1XZCA 4XLZA 5HCUA 2ZJ5A 4CG3A 3H8WA 4L6IA 2E75B 1NF8A 5JCJA 3K1YA 5K4AA 3OKFA 3GOQA 1Q44A 2XMZA 5KA6A 4QSMA 4DUGD 5I7OA 3BA6A 4OXXA 4I55B 4K03A 3WAGA 1T26A 3C7KA 3PHCA 1CF2O 1IV1A 3R2JA 1KNQA 1XELA 2X0KA 2PWPA 2VHCA 1WB8A 3SP1A 3WKDA 4RZIA 3LYUA 1BCCH 4D9NA 1VE5A 2BFNA 2VDNB 3CMAV 2CMDA 3KX2A 4E03A 2MCFA 3M5WA 2VLBA 1L7NA 2YJZA 2YUTA 1M2WA 1D3AA 3OZIA 3CRRA 1M75A 4P3YA 1R0WA 5A1TA 4DV6B 1SBTA 3STXA 3CN9A 3EXHC 1AUOA 4EJMA 3QY9A 3VNVA 1LSSA 1M7GA 3N5CA 4OMFG 4YR7A 4R2LA 5HRCA 3GVPA 4U0KA 3WL3A 3ITKA 2OM6A 4QO7A 3S1LA 2HUPA 2Y1OA 3NEPX 4CL3A 4DLWA 3LZCA 4D46A 2Z0MA 2IEAA 3KOWA 4JYPA 4EYSA 4ARUA 4EUNA 2PH3A 1RACA 4IOMA 2HCJB 2FWPA 1T0KB 4KVAA 3WGQA 4INAA 1LY1A 5EEHA 5F4BA 1KP3A 4CUJA 3NWPA 4LF5B 3PRHA 5AJXA 4RPLA 4Z2AA 1JR3E 1FU4A 1LVUA 1FDSA 4RZUA 4BXOA 1AHNA 1LB1B 3DXYA 5BRNA 3SQMA 2VPPA 4XX0B 2W37A 2VHYA 3TL2A 1ISHA 1EGAA 1QOQB 1E0KA 1JPVA 1JQKA 1P2TA 2GPNA 3NT2A 4HXYA 1Q20A 4Q4JA 2RGBA 3AR5A 2HEPA 4FLTA 4ZXPA 1Z73A 2JIZA 2WTAA 3E2PA 3RE3A 1IBLB 1NJFA 4UTPA 3OM0A 1NBAA 1XJ0A 3R5JA 3OIWA 1BROA 1NNLA 4EI8A 1DKNA 1RI2A 2Q3JA 3AG5A 3B52X 4FHCA 4PIPA 3V7FA 3VQTA 4ALMA 3Q4HA 3U5TA 3AY0A 4E6EA 3GFFA 3IX7A 1O94C 4JR1A 4HDMB 1OGIA 1JG2A 2IUYA 3EZ6A 4UZFA 3CVXA 4LBVA 2HT1A 4G5OA 1NFRA 3DUFB 1U4NA 2XSZA 4TLCA 2XUKA 4YP7A 3F7OA 1K7SN 3E8XA 3V3TA 4PR0A 1NI4A 4JZKA 2Z58A 1K5SA 2JDID 1IEXA 4RXMA 3VBBA 4DILA 2ZZMA 4LP8A 2OECA 2YWCA 3FPJA 4I8IA 3LLCA 1CZHA 2DY0A 3TEJA 2ZIXA 2W93A 4WNYA 4IIJA 4KFUA 1F7YA 1DAFA 2DBYA 4B5KA 2BEJA 1AJQA 1SQGA 2BM1A 4F2WA 3JWJA 4BCCA 3DO5A 1CSEE 4MVOA 4MPDA 5HZGA 5JJEB 1IE3A 3VNSA 1HV8A 3F6MA 3CU5A 4HFJA 4PRYA 5BWOA 2I1LA 2JGFA 2P4VA 4UCUA 5JVDB 3G1WA 4A6DA 2LGJA 4N3CA 4PCLA 3TNFA 1QPGA 4DWJA 4NDZA 2BE9A 4P0TA 2ZP1A 3VOAA 2IUTA 4RA9A 2P78A 1I2DA 3O8QA 1WXHA 5CGQB 3SX2A 4D4IA 4N49A 1USUA 1YQTA 3OLXA 4IEFB 3K1ZA 4OREX 1ISRA 1QHEA 3OF5A 4P9NA 5CEFA 5JNLA 1XDZA 4NCKA 3LNCA 4TQAA 1V4VA 4TM7A 2G9UA 3N27A 3H5NA 1AI5A 1X7OA 2B3TA 1KO5A 3KWFA 1ZNXA 1PZHA 3QPWA 4PAMA 5E0KB 1ZP6A 3DMGA 2BJWA 2ZPAA 4IGFA 4RHTA 4W5WA 5ALQA 4K9QA 2OZBA 1BQ3A 2TYSB 3N2NA 4TTAA 2PL3A 2RFLA 4FFRA 5EGSA 1I3CA 2XD9A 1KEWA 3AG2B 1N4CA 1V1RA 3CXHF 2QNIA 5DGXA 4YUWA 2VF7A 5BUCA 4HMOA 1G9XA 1JDTA 2PYJA 3S7TA 1JJVA 5ILQA 2ZJ2A 5DBGA 1MNGA 4UBOA 5GVSA 1YE3A 1WB9A 5F33A 1O96B 2J0VA 3DHWC 3W8EA 2VYCA 2GF2A 2H4YA 3JALA 2VF5X 3QSYA 4L8WB 1OI2A 5LBQA 4RQEA 5K8UA 1QZUA 4LH6A 2GLXA 3FFBA 4BLWA 3JWPA 3M3HA 1WD5A 2JIOA 3OQNA 2JLWA 3RJTA 2A3QA 2EHDA 5EXEA 4DV6O 5EKSA 4BAZA 3NJ8A 4JLUA 3O65A 2HU7A 2IE0A 1XQ9A 1BN7A 4Y3UA 5EXXA 1RJWA 2WG1A 5K3FA 4MWDA 4O4HA 3HPRA 3MYYA 2PFSA 3O03A 3VOTA 3KSMA 5AKZA 1WP8A 5UKDA 1TIBA 1PS9A 3EEFA 4D6PA 5K6TA 2GHYA 2HIGA 5D1NA 4XXHA 2C2GA 1JQ3A 1DBPA 3RK1A 3ZHBA 4NCAA 4NXMO 3FTFA 4UUMA 2FMIA 3GHZA 1R4ZA 3M70A 5B5EZ 2V7VA 3AEUB 2OPHA 3UXEA 1PEAA 1M57B 1DG3A 1GH6A 2EFDB 2ZAYA 3GEDA 4HAXA 3SZ3A 5JSZB 3R5XA 5LZ7A 4Q4HA 4KV9A 3MUEA 4BGIA 3Q7SA 5BNZA 5AW5A 1AROP 1DIOB 5DPMA 4AKSA 5G02A 2BI4A 3NVDA 3ZU5A 4TQ9A 4WJLA 3SYCA 3M33A 3VU8A 4GM1A 3KSZO 4JP2A 1YKGA 2D2FA 1FNSA 1MABB 1TTQB 2P4QA 5T4EA 3A4LA 3WGNA 2EX3A 1FMCA 3GCGA 2FLKA 5IFLA 3U4QA 2KG4A 1Q16A 4LRSB 5H9VA 1J2UA 2UUAO 1Z0JA 2BGNA 3LC1O 1XMJA 2VWKA 5FADA 2F9ZC 4K0KB 5ARBA 2DHQA 2C1EA 2OHJA 4GGOA 2VTKA 3ZU4A 5A62A 4J0QA 4TWRA 5GZ1A 2XCSB 1H85A 3IQHX 4Y9RA 3HR7A 4JKOA 3ZHVA 1HOXA 2E87A 2XW6A 1ZK0A 4NRDA 3F74A 5JAQA 5HZHA 1ZIYA 3T1YO 4ARVA 5HJ5A 2XECA 1N2CB 3DOIA 5J2TB 1KORA 3TD4A 2XYQA 4AX8A 4ABYA 2UVPB 3J80M 4WTOA 2UZAA 1OH8A 1QG6A 1Y4SA 3KKNA 1XFAA 4FMTA 4B3RO 5DSXA 2ZKIA 4L7QA 4DNFA 4DQUA 5A7HA 4KI7A 1ZXLA 3KXLA 5CU7A 3AC0A 3C14C 1KEUA 5FBQB 2ECKA 4BNZA 2IOFK 4UCQA 1E0DA 1UT5A 3B9BA 2AE2A 4O5OA 1SQ0A 1E7QA 4OQYA 3RJZA 1MA3A 5T3YA 2X6TA 4WKOA 1U1DA 3C3BA 3H83A 1P80A 4B83A 4FYMA 2ZK7A 3OSUA 3QKUA 5JS8A 1E4EB 1MVLA 5DLPA 2P2DA 4RQTA 4B5LA 2DM6A 1QIDA 1YIJV 4U6SA 1NQTA 2D0OB 1VQNV 1H5QA 1J2JA 1M1YB 2XD4A 3F5DA 4NENB 1OF1A 2Z3WA 4RGBA 1ZTEA 2HV9A 1LRJA 3DTTA 3IOBA 4PX2A 2GJSA 2EINB 3C3TA 3QPVA 2AI3A 3PVSA 1Q1BA 4NARA 5JS7A 3QWBA 2W11A 5HOQA 3CVWA 5F7OA 3WWDA 1WCV1 3A06A 4Q05A 2W22A 4MVMA 8ATCA 4PWZA 4V03A 5CNIA 4X6YA 5H4HA 3VHRA 3OZSA 4UEKA 1MIHA 1DGQA 4PNHA 5E95A 2YN4A 4DJJA 1XMPA 2EILC 2AMVA 1Q7YH 4B3MB 3PPVA 4G85A 1N32B 1B41A 4H77A 4HQRA 2C04A 4OEHA 4ZV4A 1RPJA 1DQNA 2A9HA 1V35A 2CD7A 3KZVA 3UB2A 1FS0G 3GJRA 1B0AA 1FX1A 5DHFA 3LP5A 4EY7A 2Y69B 5DYNA 3NMUF 4ZYLA 1FMLA 3DZCA 4HGOA 4DV3B 1NUHA 3GMTA 3DR3A 4DYHA 1QFYA 2Q2WA 3IMKA 2PIDA 4LFCO 1SETA 2FG5A 1X80B 2VP6A 4IWYA 4M87A 5C46F 4MMZB 3SYRA 2JARA 2ZB4A 1OVGA 5AJVB 5L3EA 1YSCA 2EJVA 4I36A 4TKLA 5IJ0B 2UYNA 1NMQA 4XM1A 5K20A 2JDIG 3TRDA 4MTGA 1HSZA 1HRDA 1QGOA 1W2BF 1TJ3A 4U7TB 4BFLA 2FWIA 5IC6A 4X97A 3UJCA 1W4AA 2JFXA 5T4HA 3R1IA 2DWDC 3SAJA 1K6JA 3FOBA 4NV0A 2Z2JA 2YBEA 3LUGA 4OMCA 4CKWA 1H05A 1W40A 1FKAO 2FQWA 3C5CA 4C4WC 1PEKE 4GI2A 5E9AA 5GP1A 1WVGA 5LXTF 5JASA 2ID7A 1I4WA 1WLYA 1CRLA 5CNMA 1CZLA 3KHKA 1V39A 5THXA 5CFLA 3H11A 4BY9E 1M67A 1TA8A 3BEHA 2AMTA 4PC1A 3ZTTA 3RROA 3SQWA 1QOPB 4M86A 3WYNA 3PDCA 3SDBA 1OXUA 2NLOA 3MAGA 3VOSA 1NZ6A 3NS7A 4M8LA 2GLUA 1B04A 1U0FA 1UJCA 4KN9S 2P30A 3I2IA 5BV8A 3CEHA 4IAOA 3W9BA 4AF7A 4A9AA 4J1TC 5DEIA 2WMDA 1A2KC 3EZYA 2A9FA 1E4OA 3USZA 4EPVA 2WRZA 2A92A 1GLNA 1FP2A 1EBOA 4KXVA 1WSBA 3S2GA 4OHWA 4CMEA 3R0PA 3OE7A 4J8PA 5G40A 4GI7A 4BRWA 3THYA 4G4VA 4L8FA 5AKIA 5I9LA 3E89A 2CE4A 2JGNA 3O4JA 1DXYA 2ORIA 1BL8A 4I4TA 3AJ8A 1N2EA 1MOSA 1CNEA 3HBNA 3NJ4A 3OZBA 3OMXA 3OZXA 3LXRA 3A3OA 4MYCA 5IMBA 3U1TA 5B1YA 2C2AA 3MERA 1TT5A 2G5PA 2X0IA 1AKQA 2W6JG 3MNFA 3S44A 3MPOA 4CW7A 4YUZA 5FPHA 2YXBA 3WGTA 2QQFA 2X4LA 4OLAA 4R69A 4RLSA 2ODBA 2AVNA 4JLWA 3SIXA 2JA2A 2CJYA 2OHXA 3DBRA 2PUWA 3IEMA 4DYVA 2B98A 3O8RA 2IW5A 1YJBA 4Q1VA 5KJFA 3SR0A 4ZIBA 2QJOA 2RI0A 1KPHA 4DAOA 1YS2X 2N1BA 5THKA 4UHJA 1OHHG 1EK2A 1VBKA 3DWFA 3HJGA 4ZVQA 2IWRA 2YNMA 5JZSA 4HNHA 5CVUA 2QWRB 5JYEA 1NXQA 2RAPA 3SXJA 3GV0A 3DE7X 3T99A 4D3ZA 4EUFA 3HXKA 3LBIA 1TW3A 2DYSB 4JL6A 4LHWA 4NNPA 2CVOA 1NW9B 4CL2A 4AJ9A 1PT8A 5IABA 4XVRA 2O0JA 5ARCA 3RS7A 2VN8A 1MHTA 1H65A 1VHAA 2LDBA 4UATA 5SY4A 5TVKA 3TJMA 1PZXA 3B20A 4DT1B 1BGXT 4I7EA 2BPOA 3V4OA 4LQDA 3VPGA 4BCBA 4PHCA 1MC1A 1YB7A 2IU6A 2OQVA 4EYEA 1X1BA 2ZXWB 2BFCB 2FMFA 1KQ3A 1M54A 2NXJA 2YFKA 4MEJA 2JS3A 4NMWA 3STUA 2O52A 5DEOA 1G20A 4FE3A 4BVAA 3G6EV 3HB3B 5AVRA 2OLKA 2P69A 1KAGA 5BWCA 3KE1A 1GNSA 1E9AA 3DYIA 4EFDA 3B40A 1EM6A 1H6BA 4AILC 1NSFA 2IFTA 3FRJA 3ITEA 3PIDA 5LB4A 2OPBA 3ZV6A 4C76A 4ON9A 5EUCA 3H9GA 3JARA 4JASB 5DOZA 5EWLB 5LC1A 4A73A 5I5GA 2PMDA 3IV9A 1M2OA 3CCUV 1QIGA 3PC8C 3ZE8A 3IUYA 2PV7A 1Y37A 4LDZA 2ZBDA 4E07A 1L9KA 3Q0TA 4RDXA 5JD5A 1LUAA 1SC5B 4LYAA 3NHJA 1SU7A 4PSCA 3T3MB 1JG7A 2ZXUA 3FETA 4PG8A 3L4BC 1EZVH 5JHHB 1Y8QB 4DCPA 1Q82W 3LXUX 3V1TC 1KYWA 2AFHA 2WZDA 1V7ZA 5BMVA 3K6JA 3VPFA 5K03A 1B3BA 4S0XA 2I8LA 4W82A 2NQ2C 5EZYB 1N5IA 5HXUA 2FUCA 3TJTA 4XWTA 1KY3A 2BMAA 2YY7A 3CA8A 1UK9A 3MTIA 4N5MA 3HZOA 1OW3B 1TFRA 2JK1A 2V55B 3LK7A 3R41A 2IYEA 3FUUA 1TM3E 2F8LA 3DLAA 1DQPA 2VTBB 1S76D 2AX4A 2F6RA 4PDMA 2FPSA 3L8MA 4NUTA 2YRWA 4JBGA 4BLRA 2H8PC 3ONDA 2JGAA 4B1FA 3T5BA 4I5GA 2ORVA 2R62A 5G0TA 3FD6A 1Y1PA 1H4VB 2VCEA 3OLQA 5DHPA 4GMKA 5EEGA 2AG5A 1FCJA 4XCVA 1N32O 3T5DA 2WLMA 2HCBA 4TYMA 2DKFA 2FFQA 3PQ5A 2BMJA 4JOCA 3ENKA 1JNXX 1A5BB 2J7PA 2V4MA 4YRAA 3QV1A 2CDRA 3VKWA 4AYWA 1HOTA 5D7BA 1S2NA 3ABKB 5KTNA 4OLHA 4CTKA 1N5LA 3ZU2A 1SG9A 2GETA 5KYWA 4ZDKA 3PUJA 3TK1A 1P61B 2JHCA 4KUEA 1HDGO 4OHUA 4TX1A 5BWBA 1B42A 4HBNA 2HJ9A 1UEXC 3AB8A 2WTMA 2R97A 3PFHA 4E33A 4RCYA 1U6KA 1VKHA 4O2RA 2R1VB 3O83A 4Y9TA 5H3CA 4UOZA 5BORA 3MSXA 3M1LA 2I0FA 3P9ZA 2XA2A 1EESA 4B6RA 1OCOB 1N8SA 3LUAA 2WHRA 3KJNA 2WT4A 3VDMA 5U9CA 2IS6A 1VHDA 3EA4A 4M55A 2E6KA 4JVOA 4FKZA 4FJ1A 2VA8A 4DMRA 3OH8A 2FZKA 4FYKA 1G1AA 5BN5B 3F6YA 1EWVA 1YULA 2YS7A 2XGOA 5CX1A 4YRBA 3VO2A 1L4MA 1PV4A 4FS3A 5CYOA 3QNEA 3ME5A 4CTOA 1Z13A 3IVGA 4URZR 4Z1MA 3STVA 4G26A 4RAIA 4FR0A 1N8RW 2R7NA 1D5CA 2ZDIC 3IQDB 5AVZA 4L57A 4FDAA 1NJ6A 4QJ3A 1F23A 1AZSC 2I55A 4C21A 2QSAA 1F6DA 3X1JA 2J9RA 3KHUA 3BWMA 3D6FA 3TTTA 2AOTB 4F4IA 3OJLA 1UBFA 3RC2A 1GN6A 5IZCA 3CC7F 1O95D 4MWOA 4PZ9A 3BOSA 3GEIA 1RAHA 4UBMA 1LLQA 4CLHA 5ENZA 1KYQA 2KTVA 4DMGA 1GM8A 2QYHA 5ALRA 1H2ZA 2MMCA 3IDSA 2ETNA 4NESA 3LIIA 1IQ0A 4GDMA 3K0CA 2BFEB 5JRJA 1NW3A 5JZBA 1CP2A 1EU1A 4U5QA 3ROKA 1EFAA 3A1DA 1KJWA 4BNKA 2R68A 3H1PA 4JLAA 3UKMA 4HWGA 4OYRA 3IKTA 4HYYA 5G2OA 4BW0B 1SIOA 4LFAO 4ZO9A 1PNKA 4KI0A 2WLIA 5DN9A 4F2HA 3KEQA 2BFBB 3TDKA 4NE7A 3ZDDA 1MJGM 2AUNA 1JEEA 4MVZA 1KI7A 2HRZA 2OXEA 4U7PB 2G0TA 3RO7A 2HWWA 3OU6A 2OV4A 3DLIA 4RKQA 4KRXA 1GYPA 1RKVA 4NEHB 5H83A 1KAMA 3W5UA 4D41A 1FW6A 4WN9B 1M57C 3B6ZA 1XK6A 2WTXA 3RK4A 3DWGA 4CR6A 2P7IA 4G9GA 1C9EA 1P5HA 3JAMA 2FW6A 3WRXC 3WQHA 3NONA 4RYDA 4KPFC 3D6MA 3T7CA 3STHA 4RQOA 1DAEA 3FPCA 3O8LA 2CAZC 2JAWA 2PPLA 4PX9A 1QFXA 5F1OA 3G9ZA 5K2OA 4QYIB 1BXGA 4KOAA 4C2BA 4UZEA 3EEQA 1LZLA 2XCQA 4LECA 5E7JA 3ZE9A 1UPGA 2OT3B 1SURA 1RMQA 3TXYA 5F76A 1UPBA 4WZBA 3H2ZA 3RNOA 1YKFA 3ZZ1A 2PE5A 3BL8A 2BKVA 3MBOA 4RMNA 2GDZA 4JVLA 1AI4A 1N0HA 4X90A 2VG8A 2YCBA 4QHYA 3WISA 4XYLA 3T1HO 1XCMA 2XAUA 3R3WA 4G5RA 3VTIC 3DHEA 5BSGA 3FYEB 1Y4AE 2IW1A 4JHXA 2NNLD 3HKBA 5J5VA 5EN4A 4WDRA 4QJFB 2UYPA 2I71A 4H3SA 1UK8A 3TLMA 4HVLA 1FZQA 1TB4A 1I1OA 3SLGA 3VDQA 1EP3B 5LIRA 2CFRA 3E81A 3QQ5A 1TO6A 5IK2D 1QU3A 1MSDA 1ZAYA 4S1NA 5EXTA 2VL7A 1MT3A 5LA6A 1KDRA 3CE9A 1DADA 1E8NA 5T6BA 5L6LB 4MVWA 1U4SA 4BVBA 4CT4B 3KEGA 3ZCQA 2XMQA 4FZ0A 4OHRA 3QF4A 4L6AA 4UCXA 1CIJA 2ZRQA 2I7DA 4BO1A 4EB0A 2OZVA 3D36A 1FXWA 1Q5OA 3E6AA 1NP3A 4COKA 1O2DA 2GD0A 4E5DA 4PIVA 1M6EX 1ZMXA 3SBOA 1U4OA 4EJSC 3F7MA 2OE2A 1P4JA 3FPBA 1XDBA 4EY5A 2C4VA 1QPZA 1SY7A 2D06A 2GBCA 3IS3A 2IVZA 5HQTA 5LLTA 2CMKA 1JB1A 2J7PD 5AIBA 2HEGA 5THQA 5BURA 1E2UA 1TK2A 2F59A 2DFTA 3IPLA 1DT9A 1G4YB 2PD3A 3IQWA 4QASA 4BRSA 3QRWA 3F90A 221PA 3H1FA 3TSAA 3EGOA 5TVGA 2GPWA 2EKPA 2B4AA 4TVOA 2Q68A 3CHYA 2EAUA 1MB2A 3AOEA 3T3IA 3WQQA 3E2EA 3ZCRA 4Z9FA 2NXNA 4TLLB 5B58T 1F14A 4HDKA 3HJAA 2Q7XA 4LXYA 4RSHA 5ALLA 2A4MA 2IPOA 4OHVA 4NF2A 3C48A 5HYVA 3TFWA 3IE1A 4O63O 3DAGA 3ETLA 5DGTA 1IZYA 2G08A 2V6GA 4YJDA 5EJ2A 1PQ4A 3PL1A 4Y1RB 4CF4A 2V65A 1XCGB 3C6YA 4EH1A 2HWXA 4F3YA 5HGXA 2C2HA 3OOYA 3B6NA 4JX9A 5LXTA 5F2KA 4ETNA 5M2QA 3MCUA 5ESRA 3ZK7A 4OUDB 2X4DA 3O21A 3E4DA 5C1IA 3TM4A 2ZSFA 4B4DA 1W25A 4JH0A 1B4DA 3EZGA 1RRVA 4H1TA 3VVMA 1WPBA 1K4YA 3GNLA 4Y1GA 2WIJA 3V4PB 1KETA 1IBRA 1N1EA 1ZONA 2P4EA 3RGWS 4Z1OA 5GIOC 4PHHA 5K01A 4K8RB 1OPXA 2VJNA 3B5EA 2J0QA 4YJGB 3C3AA 2UZIR 2DR2A 3TMYA 3C6QA 3APQA 2QUBA 1HYQA 1YBFA 2VK4A 4BWFB 1J9GA 3GJ4A 3R20A 3UA4A 4E5NA 4JI2B 1H2GA 3LM8A 4NNJA 2KMLA 3OZRA 3L1IA 4KQEA 3WBFA 2V8OA 3TOVA 3AV0B 1W5AA 1BGYH 1BGWA 4K8OA 5FIUA 4BRZA 3PQ4A 3DEKA 3TGWA 5L3QB 4XSVA 3KK0A 4OL9A 4R2HA 5ELMA 4DDKA 4GL2A 1YXMA 2J0EA 3B3GA 1SESA 1H3FA 3GPIA 4DXAA 1WCIB 3JCUZ 3PDJA 1SXHA 5U1PA 4OBWA 4MGHA 4JLDA 4L76A 2QHXA 2ZRAA 1MMMA 4BMYA 2X41A 3L1VA 3ZOZA 2YUIA 4ENWA 1OYWA 2WYWA 2H3OA 3CKKA 3HN2A 1SELA 2HZ7A 3RS9A 4C01A 3DPIA 3P9RA 2MDTA 1UADA 2BCGY 2WU3A 3BA1A 1JH8A 4OFZA 1HE2A 2H7XA 4KSCA 4YJHA 3W4IA 1E3LA 3OUUA 1BFDA 3CCLF 3GT0A 4ZT5A 1NFFA 1WPRA 3T5TA 1JAZA 2FAXA 7AT1A 4H7HA 1DLBA 3RVMA 3CMAF 3LWOC 1NJ2A 1VPEA 1V9LA 1KVQA 1NE2A 2NV0A 1R4MB 2A1TR 3BIOA 3DOOA 3KEOA 4H9GA 2DYSC 3MCVA 4KV7A 1NN3A 4QTXA 1W581 1CR6A 1BVUA 3OIVA 3LBHA 3I23A 1JN1A 3OD5A 3UXHA 3I73A 1OXXK 5EK0A 2VRZA 1ZGAA 4JBLA 3O0TA 1UMDB 4R8RA 3S06A 4KE9A 3KZOA 1SRQA 1TVEA 5HF6A 2CXNA 2G04A 5LZ5A 2QAGC 4N0PA 1UXHA 5CW1A 4DLNA 1IMJA 3FKSA 2HK6A 2ASVA 5BV1A 4KBYA 1AM4D 3GLVA 5ITWA 3F8SA 1VG9B 3VX3A 2VNKA 1XCBA 1Z56C 4RANA 2ZBEA 4EITA 3QOWA 4RZSA 3DVLA 2RC6A 3KJIA 2IJGX 3T9FA 1GWNA 3FB7C 1YZUA 1K8YB 4O8CA 3FHJA 4RPGA 3B53X 5A5GA 4U02A 1D2AA 4Q4JB 1E7YA 2ZZNA 1OV9A 2J3QA 2X5KO 4WEQA 5TEWA 3T9BA 2FF5A 1TVKA 1J9EA 4UNQA 3L93A 5FWXB 3GLGA 2IZ5A 4AUNA 5JY1A 4OTZA 5BN4B 3ZRSA 4H59A 4GPAA 2V59A 4DZZA 4DTIA 1E2MA 2PGGA 1GEEA 3JQGB 1SRRA 3FX2A 3NBZC 2O0HA 2H2AA 4HCJA 5KU7A 2PWZA 2BGKA 2PRKA 3DDZX 1ZEJA 2B2NA 2HBZA 2NUBA 3MUOA 5I4CA 4ID9A 4W8OA 4DLPA 2V98A 1U8FO 1YO6A 1CP9A 3HJTA 4DUGA 1MB9A 3QP9A 1TZCA 1OLXA 5D1HA 3KIZA 3JZDA 1RJFA 4N47A 2OWEA 3VH1A 4QE9A 5E7IA 2ZE5A 4TZKA 4A5SA 1KOGA 1FX0A 1X1TA 3GRVA 5B4UA 1OJ7A 5JNVA 4C1NA 4HJXA 1HMYA 2B7CA 3GGPA 3EF3A 1MV8A 4DIOA 1LSUA 2ACKA 2JLYA 1XEAA 3ZBPA 2X1HA 2FR8A 2I6GA 4LN1A 3ZHOA 4JF3A 3ES9A 4U7OA 4N0QA 4D8YA 5SZHB 4EUKA 5B4VA 2JLQA 4PZYA 1AKEA 1Z0ZA 1PBTA 3BXHA 1BD4A 2Y1XA 3GLUA 1TZMA 3CLUC 4UM8B 4RHCA 1KRWA 5A9GA 5KWJA 2QTCA 4HD8A 1GGEA 5I3ZA 1L7DA 3RRFA 2MR6A 4M46A 4CIYA 4KFMA 1Y33E 3L9DA 1X8XA 4JENA 4JQSA 5JMPA 3N8GA 4P4LA 4WADA 2E21A 2G9IA 3NR2A 2JJ2A 2SKEA 4IBOA 2XXAB 4GSLA 1Z5NA 1JOYA 3WHKA 3V33A 1ZH8A 1K5DA 1MOQA 2WWIA 5B36A 2G1AA 2AIZP 3ZDXB 5C53B 3ZNNA 4TMTA 1CQIB 4M89A 4PNZA 5G1OA 1DRWA 2BZ0A 1COWG 1E5XA 3KT6A 1CDOA 2RIPA 3QUQA 3O1HB 4X94A 5DYTA 1HE3A 3E7DA 4IV8A 2PEZA 2ES4A 3K72B 4OYYA 4QXOA 2O19A 2W4MA 2XTJA 3H1BA 1CDZA 1YQ9A 2QIOA 3EA5A 3OBIA 3UMRA 4REMA 1A98A 1VSBA 3DV0A 3G8YA 3MTDA 3SLRA 3WGHA 1IZZA 2D74A 3W9UA 3B6EA 4AXXA 5IM5A 2G4VA 1VARA 1NQAO 2ADMA 1XF9A 5PNTA 3EPKA 5TC4A 1GX1A 1KJZA 1VHLA 2W2OA 2CNWD 3H2IA 3OQIA 1T4CB 4M6WB 3UHFA 4XH9B 2XAJA 2HCRA 2X8WA 3BMOB 3OPYA 5HKLA 5HUQA 4QG3A 1VYTA 4QBIA 3V8BA 2AD5A 1DJNA 1GEGA 2RBKA 4ITUA 3RFFA 4MK4A 1KXZA 3REQA 1NN0A 4UUAA 1G0OA 1F4PA 1ORIA 3DCNA 1KWKA 5FEUA 4C5CA 4EX7A 2IV2X 3ROQA 3VYSC 1CK4A 2FUG1 3OBBA 5AXCA 5A3SA 1V8OA 2FGJA 5F51A 4BT2A 3OVMA 1RFGE 5G41A 2BBWA 3W78A 5JTUA 2PSFA 1T2DA 2E76B 3WBJA 2Z2KA 2CHGA 3NETA 5LHHA 1PPJH 4IIJB 1W4BA 2HF2A 3DDHA 3IESA 2C5BA 4K1LA 1N36B 2XRMA 1D0VA 3O2NA 4OVKA 5B3JA 1GKYA 3C1OA 3H99A 3DZHA 1TXGA 4G5FA 4H4CA 4DCNA 5IPFA 4RTOA 4OOEA 4WXRA 3EVNA 2UUCB 1YJ9F 4I4TB 2YXHA 1LI4A 4E3ZA 5LVAA 3PEWA 1GGJA 3KKPA 1MMFB 3B7PA 2JW5A 1DX6A 2HFEC 1UH5A 4C4RA 3K5NA 3H9CA 4G9BA 2WSLA 3FXAA 1XVLA 2ODNA 1Z74A 5FOVA 4GVLA 4B4UA 4EHHA 3OTWA 3RIGA 2Y48A 3DBLB 3LY5A 5M3BA 2BOVA 4J49A 1ECGA 2XUJA 3GBSA 2QQ5A 3H42B 4RQUA 1T2CA 3G17A 4IMPA 1J6UA 4HZUA 4G0ZA 3ABQB 3MGKA 4EHFA 1NNUA 3MJTA 5JRZA 3KR2A 4L50A 3S81A 5H5NA 1JR2A 4Q9JA 3EOAI 3GR6A 5AUOB 1SCJA 1VQ1A 1IULA 3O91A 4HNAB 4LPSA 3JTMA 1QHIA 4WCVA 4AJ1A 1YNOA 1CUWA 1SQ6A 3FTPA 5K0CA 2CWDA 3IOEA 1YHNA 5ALNA 1YHQV 2ZT8A 2MJLA 2H5JA 3T34A 3V8PA 1WETA 3HKDA 4WK2B 1XP5A 2PAFA 5HFNA 1FNDA 2QT9A 3SF8B 3WYBA 4BMDA 3UMSA 2O20A 4PLFA 3CZ4A 1N9ZA 1VGRA 3CPWF 2EYQA 3JQCA 3JV7A 1XC7A 5JSKA 5IKPA 2XBMA 3G59A 3EG5A 2B1JA 2D3TA 2OFOA 1Y1SA 3F8TA 5FWNA 5ICMA 1WUIS 4OUKX 2EFGA 2ZVYA 1CV2A 1NBEA 1W46A 4L95C 4QPZA 4WAUA 4XPIA 3JALB 1MB3A 4YQEA 1VYHA 4MVJM 4B3DA 1SVSA 1JR4A 5F2EA 1E2GA 4YAWA 1PFUA 4JP5A 3B2EE 3RFXA 2YIMA 2A8YA 5CNJA 4EKNB 4RTMA 1E2FA 2Z3YA 3H1KH 3OFNG 1L5ZA 3HTNA 2WJWA 1TM4E 3HUUA 4GEKA 3NDBB 3ZE0B 2Y3IA 2Q3CA 4R1SA 1EWQA 2ZDGA 1PJTA 5CDGA 4RAOA 2QDOA 4XD7A 4R7CA 2Q1WA 2A78A 4JOQA 4Q48A 5HRAA 2OZEA 1BDIA 1TCVA 3K8YA 2JCVA 3EIUA 1YQXA 1L4YA 1QK4A 3O3MB 4Q4DA 3SKXA 2WM9B 5DM6V 3UG7A 5M04A 4L9AA 4LVUA 3N2KA 1Q86H 1SKYB 1HWYA 2XPCA 2YHAA 5JSZA 1QS0A 4LVOA 2GUZA 1P7BA 1IV2A 4E13A 4CKCB 3OPQA 3EZ2A 1LPSA 3N0VA 3I56V 1A04A 1L8LA 4UVBA 2HMYB 4Z99A 3G89A 5C5DA 4RVUA 5TT1A 4HDCA 2FRXA 2NPFA 1WKCA 1RZUA 1RJGA 2Q4RA 3TG2A 5ALDA 1N9GB 2IYOA 2YC4C 3L49A 1NR5A 4HYTA 5AW6A 1SKMA 2BUAA 3TB4A 2R6CA 1OBFO 2WWTA 1SVWA 3JQFC 4BV9A 3U10A 2QTMA 4PONA 3RSZA 4KUMA 3ZIAG 1Q7TA 2OTJF 1PUIA 2XNHA 4NOMA 1ZWLA 1S2LA 2WPDA 3PWZA 2HRRA 4KZKA 1DELA 3W34A 1KB9F 1FYXA 2Q29A 3DP7A 1M8KA 2DR3A 2X5JO 3PRYA 4HBGA 4HUJA 4PTYA 4WA8A 2GD2A 3TG8A 3C8DA 1DKLA 3IKLA 3N6VA 4BTVA 1QFMA 2AIRA 4AK9A 2JPDA 1X80A 4UCWA 2CSUA 1C8BA 4MS2A 1VKJA 4KHZA 4CKBB 2H1VA 1HF3A 2HBYA 3NCTA 1M74A 4P7KA 3VVCA 3I5AA 4ZAYA 1J09A 3FJOA 1VMIA 1ZGJA 2CXPA 1HTWA 2I99A 1N6RA 1V54B 2QQ0A 2P1ZA 4MUHA 1NBHA 4DQKA 3L7MA 3VC2A 1I0IA 2JLXA 4EGSA 2GJ8A 1PT6A 3IP7A 3UKJA 3MQFA 4HEQA 4JJGA 1YNSA 2G76A 4X8HA 3U48A 4LV6A 2VSOA 3MDOA 2RG1A 1DRKA 4I9NA 3OTHA 2XEXA 4LGCA 4PU0A 1GTOA 1RHQA 3C6KA 3TAXA 3VMFA 4INPA 2AG6A 2ZIGA 2YBDA 1S7GA 5MF6A 3D6UA 1Y5MA 4G8JA 1UM9A 1Z4QA 5CG1A 2GBGA 3CRZA 4JVNA 2LGQA 1UKAA 4YMIA 3U09A 1BX0A 3M0EA 4MCIA 3IR6A 2Y71A 4DA7A 1KU9A 1CQPA 1S3GA 2MK3A 4MV3A 4DVJA 4Q4CA 3NT4A 1QRRA 1AF4A 1E77A 1ZJ4A 3PD1A 2QU7A 2QI2A 1V3UA 3H8VA 3IUEA 1EK6A 5CX1B 1M1YA 3MRTA 2PY5A 5GTIZ 4CCAA 4CQJA 5KQPA 3IP8A 5DZSA 2RHRA 1K97A 3KUUA 3DM9B 3OJXA 1LQTA 2V7XA 4US2R 2WSIA 3CZAA 4V39A 6ABPA 4MDFA 3O93A 5TARA 2PUCA 4D26A 4DSAA 4X20A 2B69A 1JEAA 3ZHUA 4FMPA 1NJGA 1ESDA 1A9TA 2CXTA 2ZAMA 5CXXA 5BVGA 5H6RA 2YV1A 4YIHA 1A0OA 2D3OW 2P5UA 1D6SA 4M0PA 1B8UA 4BB5A 3BKXA 4WZAA 4PFSA 5CXUA 2ZUDA 2XR1A 5IC4A 4J80A 3NWOA 5EZQA 3ZE7A 1PHPA 3AVXA 1KECA 2IXAA 4Q1AA 1J70A 1JDNA 1V1JA 2Z2YA 2QWQB 3AINA 3LUCA 3FSGD 4GE0A 4WF9V 1ZYUA 4DWWA 3QF7A 1TC1A 1OU4A 1YR6A 2Q5QA 1QTQA 3DLCA 1NIJA 1YRWA 2ZYVX 4TUYB 4MUEA 3JASB 4WASA 2W70A 3CRMA 2CDAA 3ELYA 3OCUA 1P7WA 4Q3CA 3UYLA 4D8TA 4OAQA 3QUAA 4BB9A 1VKOA 4X92A 2I7VA 2J33A 1EB9A 1L4KA 3N2LA 3F67A 3SFZA 1E8MA 3RHTA 1TKAA 2J5BA 2QG4A 4D96A 1VH8A 2ON6A 1K5HA 3T15A 3K14A 3HL0A 5CT9A 1B0UA 4DREA 1IK6A 4CR8A 1L1QA 4WOKA 1JKJA 2QX4A 1QIHA 2NMUA 4QWWA 4DIMA 4ZCRA 5ERXA 2MW2B 4NAVA 3VTFA 2HPHA 4YMSA 2Q4EA 1G3IA 5F78A 3RC1A 3JSLA 1DBQA 3WLMA 5EJAA 5JWPA 3RVKA 2E4ZA 3E18A 3T9AA 4OI0A 1SCKA 1NTRA 4X9QA 4FM0A 4JEMA 1K73H 4YH1A 4KR9A 3TUJC 4TSFA 2E5FA 1JDVA 4TMVA 5AW0A 4IPTA 2QUJA 1Z4LA 2JLBA 4E5MA 3IPCA 3GRPA 2X5XA 4GT1A 4M0UA 4V0OA 1OUMA 5BRAA 3NW9A 3IIKA 3E8SA 2XSZD 4HTFA 4H7KA 2YYYA 1GZHB 4MWZA 3DE6X 3CD6V 3M7IA 4Q3EA 4NJOA 5I7WA 4TYNA 4FEYA 3B4SA 4B6QA 3AIMA 4BGEA 4JBIA 3RKRA 1JPXA 4JAAA 1AJNA 1R0CA 2KJQA 2WA1A 1A88A 3BK7A 3IH5A 3VJMA 5T41A 2FOXA 3LVRE 2HU5A 1N7IA 1J7JA 1ST2A 3G5TA 3A2NA 2PMKA 4O4JB 2VKTA 1FDVA 1EGVB 4J9ZB 1VQ9V 3K0DA 2PN1A 3QMVA 4IOLA 3SC6A 4IL5A 4O0LA 1LF0A 3DZFA 1EBFA 1TQ2A 1PGQA 2F3PA 1U7UA 1NNEA 1VPWA 2CXXA 1QMGA 2I8CA 4H18A 3C9SA 2M6YA 3U49A 3JAKB 5BY2A 1T5IA 2VRCD 4ZOCA 4BQOA 4PDVA 4LYHA 4AU1A 1XRQA 1DZ3A 2VUUA 5E1DA 2HDNB 2JFWA 2VHJA 1XZ8A 4YP0A 3RNLA 1BE8A 1NGSA 1O9GA 4D6XA 2QLLA 3BRCA 4YAFA 1SBIA 1E89A 4Q93A 1W5FA 4XARA 1SR8A 2N1MA 3WRVA 3BABA 3MPUA 2CVQA 2PDAA 3LP8A 3PFKA 4JYBA 1S4MA 3FNQA 4ZGBA 3FOZA 5IVKA 3QVGA 3H1IH 1CHDA 1TTTA 3PV0A 4RV4A 2JI7A 1G38A 4O4IA 3ZWVA 4B7EA 1EBUA 1HNNA 1SC9A 4WOCA 1K0UA 2LO1A 4XD2A 1QCYA 3L05A 4CLRB 2P2LA 1VRVA 1OKKD 2DU8A 2NSYA 2XVXA 3ICWA 4IWXA 1KVUA 2LIPA 3ZYZA 1ID8A 4JI5B 2BKXA 2GKGA 2GAAA 2BD0A 2ZS9A 4OGFA 4UBJA 5FOUA 3DE0X 1CY1A 3VI4B 4L1KA 3R3YA 4P4GA 5DMHA 2OO7A 4JAUA 1XA3A 1NBOA 4NZZA 4ZO7A 2DOKA 4ZQEA 2XE7A 4AN0A 4YXFA 4NYMR 3K70C 2XKJE 3CLSC 1KHHA 1ZXXA 3HFSA 3V9PA 1FYVA 1PQWA 5F2VO 5JH7A 2V7PA 4FOSA 1EFPB 1SBHA 1X7WB 5CVVA 4GYJA 2J9ZB 4MVYA 1M1KW 1K7CA 3DAYA 4MKZA 1SZDA 2G1KA 4X60A 1WAZA 1R8JA 2WF9A 3BE4A 4PC3A 2Q1SA 2JKVA 3MC1A 4QAQA 4IO0A 5ECYA 4D4HA 4EG6A 2CHSA 5EWLA 3HB9A 4PGAA 5CVDA 3PQ7A 4US0R 1BGVA 2ZTMA 1QYDA 3LKBA 3LDHA 4RE5A 3WFIA 5M5BA 5ELLA 1H22A 5T57A 4C3VA 1H2WA 3PXXA 1G6HA 4HMQA 1U0RA 4IJVA 3VOBA 4U9UA 3K35A 4N01A 3TTUA 4PDRA 3ODPA 2Q7DA 4DADA 4CEHA 1QVFF 1UPFA 1OJHA 1Y8QA 3A37A 1GVHA 3KKKA 4HLQB 4RL4A 4Z4CA 3G0GA 3CLVA 1YFLA 3AZOA 4K26A 4OATA 1GPNA 5KCZA 1G64A 3QH4A 2WT8A 521PA 5K6RA 2J08A 3R7DA 1PL6A 1E18A 1ENOA 3AH8A 3KO8A 4GZRB 1XCLA 4G2NA 3LT0A 3PCRB 5JISA 1BO6A 3PZBA 4EB6B 2UYYA 2ZJ3A 4E32A 2XXJA 4Q66C 4YP1A 1KD1H 2OILA 1OX6A 5AKLA 2VS0A 4K87A 5IY5C 4P5PA 1CRWG 1X1QA 2R84A 3OX1A 4RIEA 2D1SA 1BE6A 5EIHA 3MW8A 2GM3A 1O7JA 1WLEA 4BN0A 1SXPA 2OHIA 1ZOPA 4K3VA 1JX6A 1K86A 4I1OA 1JLLB 4C88A 3G5LA 2J3KA 4GL4A 1X59A 2DAPA 5EJ7A 3TQIA 3L02A 3UNXA 3FVWA 3QWIA 5LHIA 2GPYA 2HJWA 3JYCA 1UXIA 2I54A 1NLFA 1F51A 2H65A 3ASYA 3OZVA 2BTOA 3LDEA 3PLAE 3FAVB 1S01A 2VWPA 4OBEA 3KOYA 4DY4A 4Q34A 3WTCA 2G83A 1YZTA 2HQOA 3D5TA 3FB4A 3ZKWA 2NXEA 3IBGA 3C5WP 3IAXA 4QC2A 5DNDA 3F3YA 5EP4A 3AVUA 1KQPA 3S2UA 1PNRA 2H1LA 3JXEA 1TA4A 1FDTA 2GVDC 2A9QA 2ZYIA 2QLBA 3C8HA 3INNA 3NV7A 1KSFX 3II6X 2R4TA 3W06A 3WAKA 4KITB 2X15A 1ZS9A 4UPVA 4FLVA 4R1QA 4NOKA 3LHIA 4BBPA 5CDHA 1C9NA 4M9QA 1PT9A 1T8WA 2OV6A 1LNZA 3LWNA 4C8GA 2PR7A 5FPTA 4Q9NA 3DD1A 5JFTA 4GCZA 1YQQA 1V37A 4G37A 4OQLA 2WAMA 3F7YC 4IMRA 1S77D 1QYIA 3UT0A 1MSWD 1OLOA 2P1RA 4F3RA 1USWA 3AGKA 2P9CA 1NA5A 1KMIY 4ZODA 4DUYB 2AEFA 1MEJA 3SD7A 4B35A 1IY8A 1E2PA 3PDHA 3T3NA 1CVIA 2X8JA 2ZXEA 2E49A 4U2EA 3GLQA 4KFSA 2WU0A 3FBGA 3MHPA 4PLYA 5HRUA 1HT1E 2JASA 4WZBB 4JLSA 4GRDA 3ZU3A 3ZVKA 1TVKB 1M10A 4OXQA 1ISJA 1L0BA 2ID9A 3EE6A 4E46A 1R16A 3PDWA 2H92A 2AK3A 2UUOA 3IT3A 1XQYA 1GZVA 4NCHA 4EDHA 5BSWA 4JLOA 1GFWA 4N82A 1NXOA 3ABLB 1DXOA 1P3Y1 2C57A 2BFFA 5IUNC 3R40A 5JCXA 2Z9BA 4DV2B 2QA5A 2PR2A 1AQLA 1GPJA 2Y1EA 3BTSA 3NRCA 3R3ZA 2KSQA 5CM2Z 3DW3X 5J40A 3AGQA 1KRXA 1XKTA 1AXGA 3TW8A 4NU5A 4N7JA 1MC8A 2NAPA 1O6BA 4KYIB 4NTZA 1IHPA 1YC2A 3UMBA 4XDKA 2AW9A 4QQFA 1KTIA 3HK2A 3OOEA 3I5UA 4RHFA 3LWRC 4RCZA 4G0UA 1JFFA 4KN8A 5CVCA 1BH2A 4JP8A 1A4RA 4V3CA 2ZE7A 3E8BA 1R0LA 2Q6VA 5ER6A 5IT0A 2IJKA 1BE3H 3OG9A 1CDEA 1U0GA 3IP1A 2EZ4A 1RXEA 5DNAA 1SVOA 2M98A 4QNRA 3ZBQA 4EHDA 3WFZA 1U7WA 3FTDA 4JLJA 4DJTA 3WC4A 2C8LA 1TJPB 2BP7A 3B77A 2XDQB 2YFHA 3F5QA 3C3SA 3WXMB 3ML1A 5LP6C 2DQZA 4K0KO 1KRHA 5M34A 2IW3A 1RYNA 3P96A 4P9OA 2W2VA 1OPRA 4JR0A 4YRSA 4MS3B 2WW8A 1RQXA 3VPHA 2BONA 3G2NA 3L8GA 3UO8B 3PHHA 4LHVA 3ML0A 2XNSA 5DWQA 3YASA 4BWGA 1JHVA 2C84A 1D5NA 2KBEA 4CDMA 3L46A 2FWAA 3P0IA 9ABPA 1V1MB 1X2EA 2B1QA 3NHUA 4RESA 4F06A 4EYKA 1UIMA 2OAEA 4E4EA 3NOXA 1TO1E 2CBZA 4MCAA 3WYFA 2HMUA 1BNCA 3T7IA 1HURA 1QZTA 3KTDA 5A4MS 2RGRA 1DI0A 4AMBA 3VR6A 2AJTA 2ODAA 3IAM1 5J2TF 4H60A 5CBPB 2HIHA 1YV9A 4B2LA 2A1UA 4GM4A 5LQAA 5GINE 2JAPA 2IOHA 3F7VC 1A8QA 4XWKA 1FD9A 3RT3C 1PZFA 3PN1A 4Z9AA 1DMSA 4L3WA 2F43B 4RUKA 4YMUA 3C3CA 1YD7A 4ME6A 3PNYA 4OUDA 4HPJB 2IDMA 1YTFD 4ZK7A 1PL7A 2QVLA 3TLZA 2OTLF 3L77A 2WF5A 1ZKMA 3A3KA 3LKDA 5IJXA 3IFXA 4I1SA 4FI3F 3GFGA 3TTXA 1OZGA 4LW8A 3U81A 1P39A 4YI3A 3V6LA 1DU4A 2AMJA 4PPNA 4NJMA 3IP3A 3SEZA 5I48A 3BULA 3MILA 1F8FA 1RJEA 2JH8A 1DEKA 1L7RA 2JCSA 3GEEA 1VE6A 2PGJA 1QGZA 4IFEA 4LGMA 3VSCA 4BQPA 3BHNA 2XMRA 4AZ3B 1D2DA 2P9JA 3I5MA 3AF4A 4FMCB 5IJZA 4L16A 2WA3A 3FD9A 2Z30A 3UJNA 3B3JA 1U0BB 1XMOB 2PL9A 5GGXA 4QUGA 1BEZA 5P21A 2J9FB 2CL0X 1C7RA 1UXJA 5IBRA 2EU8A 2XDWA 3DXFA 2ZWVA 3P9KA 3WYEA 9MHTA 1ZFNA 2DCUA 4FR5A 2JIBA 2PJZA 3U60B 1XEWY 1IBMB 3W9YA 5KLVH 4G67A 3UFXA 3VV3A 4A6PA 5BMVF 3HEBA 4IQFA 2VAMA 2TS1A 1G0NA 3DAPA 2IXTA 2RAFA 5KQRA 4DQLA 4Y98A 1Q7CA 1V47A 2OV3A 3T38A 2GQ0A 2QEQA 5IK2A 2J45A 2Y27A 4UEJA 7YASA 3PE4A 1DRUA 1WMBA 3BSFA 1BHJA 2Y0IA 3ZHYA 3M4SA 1JIVA 1DKOA 4XFKA 1U2SA 1TIKA 4GX0A 1L7QA 3G2QA 4KAAA 3X2QC 1I5OA 1MQAA 2DG2A 4KO8A 3VJRA 3CWZA 4AS2A 3RYHA 2FPXA 3Q72A 3G0OA 3ZKAA 3ZHXA 1SIUA 1NYRA 1QAQA 1SUPA 3PQ8A 4IIDA 3FB5C 4OHXA 1INLA 1J9ZA 1SDSA 3I6MA 1B43A 2ZIWB 1DBVO 3GROA 1SZPA 3FIJA 3PYLA 2GBOA 2E4UA 3T4XA 3ZVLA 5C8XA 4R2WA 1R3LC 1H0HA 1WY5A 1U28C 1VRWA 2V6JA 4R50A 4N76A 5A1JA 1US8B 1KEVA 1P7VA 1RM1C 1WAMA 3JW8A 3OCVA 4G0YA 4RMIA 4EW6A 3QE9Y 3BXZA 3PBKA 3EGEA 4QU8A 4RO0A 4Y6LA 3UAVA 5KIAA 2R5FA 5E1BA 4HEHA 4X5OA 1T9KA 1TIPA 4DV5B 5KINB 2G5TA 2OZKA 4MMYB 5G0VA 4ARZB 1U31A 4D97A 4KQ9A 2AMLA 3O85A 4OQQA 4OQDA 5TR9A 1HDIA 4MO9A 1GUZA 1KSJA 2B1RA 5EIBC 3ONWA 4H3KB 5IAJA 3TR5A 3R7WB 4BFTA 1Z6YA 1YI2V 3T06B 1AKUA 1L7XA 3A1TA 1Z38A 3TS1A 2ALEA 1EGMB 1HYBA 4NHEA 5JAHA 4RD6A 1X74A 4OV6B 4HAOA 1NP7A 2GK6A 3EDMA 3MTJA 4QHTA 1C1YA 4DZRA 3UVEA 5IDXA 4LWSA 1ZGZA 1MT0A 3EIEA 5TX7A 4DMMA 4MWTA 2BEWA 4D8XA 3KTFA 4KFTA 5LQKA 3P71T 4RUEA 1DQYA 4R51A 4D1YA 3IPYA 4KQ2A 4PN3A 1KQFA 2EZ9A 4WBNF 2CH7B 2OGWA 3IC9A 3BK1A 4RTNA 3UJPA 3P3PA 2AC4A 4BQNA 4C4YA 4EI2A 1JDSA 1VC2A 1FPOA 1CUIA 1LK5A 1U2QA 5IYZB 2G0NA 2NPIA 4TWIA