5LYJB

Tubulin-combretastatin a4 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cis- and trans-combretastatin binding to tubulin
doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lyjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lyjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lyjB01
2BTQB 3JATA 5MN5A 4I4TA 4O2AA 3HKDA 4O4HA 4B45A 4YJ3B 3JALA 5JCOC 1FSZA 4KWEA 4M8IA 4ZHQA 3RYFB 5LYJA 5EYPB 5IJ0A 4EB6B 5JQGB 2VAWA 5GONB 1W5FA 5GONA 5JVDA 1W5BA 4FFBA 1TVKB 1Z5VA 4EB6A 5KX5B 3JAKA 4YJ2A 4TV9B 1SA0A 5LXTA 5MN4A 5EZYA 3ZIDA 4XCQA 4HNAA 1TUBB 4IHJB 5LA6A 3WGKA 4U3JA 3VOAA 3UT5B 4O2BB 5KMGB 4O4HB 3HKCA 3HKBB 2BTOA 4TV8B 5JH7B 4O4LB 3ZBQA 4ZOLA 1JFFA 4F6RB 4TUYA 5KX5A 2R751 2RHLA 4DXDA 1TUBA 5IYZA 4X1YB 5IJ9B 4EI9A 3RYHA 4I55B 4TV9A 4WBNA 4FFBB 4ZOLB 5IJ9A 3VOBA 5JCOA 4O4IB 4B46A 2XKAA 3VO8A 4IIJA 4F6RA 3N2GA 3N2GB 1JFFB 5ITZA 5FNVA 5C8YA 2VAPA 2GVIA 4O2BA 2RHOA 3UT5A 3M89A 3WGJA 3RB8A 4I50B 4YJ3A 4WBNB 5LA6B 4IHJA 4DRXB 5CA1A 4IIJB 2XKBA 4I4TB 1W5EA 4ZI7B 1W581 1SA0B 5IYZB 3RYIB 3JAKB 4LNUA 3JAWA 3VPAA 1TVKA 5M7EA 4I55A 3RYHB 4X1IB 4ZI7A 2RHJA 3HKBA 3RYCB 3E22B 5J2UA 5IJ0B 4U39A 5LP6B 4TUYB 2RHHA 5LYJB 4O4LA 5J2TA 5C8YB 5J2TB 4TV8A 5CA0A 4O2AB 2BTQA 3JATB 3HKCB 4ZHQB 1W5AA 3VO9A 3N2KA 4YJ2B 3HKDB 1FFXA 4X1IA 4HNAB 5EIBC 5LOVA 5MN6A 4O4IA 5CB4A 3JARA 5LXTB 4EI7A 3JASA 3ZBPA 3CB2A 4X1KA 1OFUA 3C8LA 3WGMA 5LOVB 5EYPA 5JVDB 3WGNA 4DRXA 5CA1B 1RQ7A 3R4VA 3JASB 5JQGA 3N2KB 2R6R1 3JALB 5CA0B 2VAMA 5FNVB 5JH7A 5ITZB 2VXYA 3RYFA 5LP6A 5KMGA 4O4JB 4E6EA 5BMVA 4U3JB 3E22A 3RYCA 3HKEA 4X20B 1RLUA 3JAWB 1Z5WA 5EZYB 4LNUB 5J2UB 5EIBD 3WGLA 5LP6C 3JARB 5CB4B 4X20A 4X1YA 4EI8A 3M8KA 1FFXB 4X1KB 1RQ2A 3HKEB 4I50A 3RYIA 5BMVB 3V3TA 2Q1YA 4O4JA 1W59A 2Q1XA
chains in the Genus database with same CATH superfamily
3UW3A 1M57C 3L1JA 1YIJF 5JPCA 2JI8A 2EV9A 4TTAA 5GOZA 2R4TA 4ND1A 2G5PA 4LX0A 4NMMA 5CYFA 4B4VA 1ESMA 4GE3A 2VT7A 4BO9A 3IQHX 2ZT8A 1J6UA 4YP7A 1OFVA 3LW8A 5E7QA 3CE6A 4MVJH 3CJRA 1GA4A 3VZPA 2A84A 2JFHA 4GPBA 5B1OA 3T7AA 1S5PA 4HUTA 4YQFA 5F2EA 3TKYA 3D6MA 4K9NA 1UFRA 3MT9A 4OYYA 2QTPA 3A2LA 3IOBA 3Q8WA 4GKKB 3CPSA 3LCUA 4OCZA 4FKMA 4QBGB 4A8TA 3LUTB 2XB4A 3L1VA 1T29A 1LLUA 4LWPA 3SQWA 1SZQA 1MMMA 1K4MA 4A4DA 1U0HC 3NVIB 3NEPX 4B0OA 4DG5A 3LWRC 2BTOA 1DAMA 1TRKA 3DEAA 4D8WA 1YB5A 4PSVA 3SQXA 4IV8A 2O2JA 2HEGA 1GH6A 2OYQA 4RTRA 1X80A 2PGGA 2R96A 4IWYA 3F74A 5EK0A 3K08A 2OXRA 2Y3IA 4PPFA 5FX2A 1EGVB 1Z5GA 3TJMA 5HR5A 4LHWA 4FMCB 2EILB 2NN3C 2R2AA 5C7YA 3ETHA 2P7HA 1FP1D 4HATA 2NQTA 3OBYA 1UJMA 1SNYA 3R9KA 4D8TA 4E11A 5LZ8A 3QEMA 5EXXA 2GMWA 4Z3KA 3QJ5A 1MEOA 1XZAA 2Q45A 2CFOA 1MABA 1XU4A 1U02A 4ENSA 1QIKA 4H1UA 4DDHA 4L78A 3D64A 3T0IA 4D2IA 1YGPA 2GXUA 5HXAA 2Q3CA 3IHTA 2DR2A 4MW8A 2FU5C 1G20B 1ZGZA 3U9SA 1ZC4A 2J3EA 3BIFA 4I8DA 3REGA 3VR1A 4BZPA 4PSAA 1S7GA 3MINA 2Y8EA 3ANMA 4EZEA 5BNWA 1T0UA 5CLJA 3KKPA 3MN1A 5TC4A 3W05A 3LLMA 3GN2A 5J47A 1VSTA 4LXXA 5A3RA 4K6OA 4KO1S 4RVUA 2FZLA 3OTGA 4WN3A 4DPKA 2CTPA 1KQSU 3KSRA 1EUQA 3IQFA 2B9EA 1JAHA 1WNTA 5IAGA 4PY2A 1KO4A 1C7FA 3NHLA 4KXVA 4P5EA 3RHSA 4G0VA 1ZVJA 3UEOA 3AK2A 1T2NA 3F3KA 1KRXA 1WBDA 3HJGA 4L8VA 5DCVA 4PC6A 3V33A 3E3NA 3PC7A 2XMPA 2PGIA 5KVQA 1JA8A 4ENRA 3G0HA 4LIPD 5E4YA 2X23A 5G41A 4AX8A 2JRCA 3CB2A 2R00C 3JQ8B 2J7KA 3B5JA 3GWZA 2X6AA 1J0XO 5E2IA 1U43A 3A9WA 3L0DA 1YASA 2EERA 3PZBA 4RW0A 1JNXX 3DQZA 3AP1A 1B42A 2CD9A 4NEGA 3MHSC 5DW3A 1A3CA 3OSZA 2ZQMA 3SYMA 2CYAA 2G1KA 3O4HA 2V7TA 4A8PA 5AW0A 1ZN2A 3ZWNA 4MCJA 2QUAA 5B64A 4RJIA 3EEIA 4JB8A 3PCXA 2JBWA 3B48A 3BE5A 1JEQA 1LKZA 2CZWA 1Y1QA 1TLLA 2PGAA 3EMVA 3ER8A 1KMIZ 3EC1A 3BMOB 1D4ZA 2QUBA 2O54A 5HZHA 4ICGA 4CCAA 3LWVC 4E13A 2GPJA 2IW3A 2GAOA 3R9XB 2JAQA 3PBKA 1GYPA 1Z3CA 2QEXF 1YONA 2JGUA 4N3AA 4R1PA 5E1MA 1GAQA 1P2BA 1VARA 2QV7A 3RJ5A 3U1TA 5EIEA 2AF4C 2PPVA 4B7KA 4ZI7F 1HT1E 2IEDA 2M2IA 3LY9A 2YFKA 2EWVA 4GYCB 1XD2A 3OQMA 4DW8A 3A4LA 3CE2A 1NQUA 1UJ4A 2JBAB 2ZVZA 4OQPA 2VPZA 5J63A 3PJRA 4AXBA 3M4YA 4HFMA 4XB1A 1YQEA 2ARKA 3L7LA 3R4CA 2EFDB 5IJ0A 3I56F 2XT0A 5AM5A 1LNZA 2R6GA 1RA4A 4KH1A 1IY8A 3OHMA 2IDKA 5TMEA 5LGTA 1R4ZA 5CNJA 3T61A 3U3XA 2WU0A 1Q7CA 2YC4C 4R1MA 1TMOA 2R8YA 1OYYA 3BHNA 3HDJA 4LCJA 3RUIA 2Q1WA 2IRWA 2IY9A 4HDKB 2VGMA 4EJSC 1NFRA 4BNDB 1NPDA 2I4MA 2XZPA 4QQRA 5DNDA 5ELMA 1L4YA 3GWKC 2R60A 3OEEG 4RHEA 1K1EA 1JA9A 4JFAA 1QE0A 5ALQA 2FYTA 3G5MA 2ERXA 2ZVYA 3L0CA 4UEKA 5GGYA 3SM9A 1Q22A 4DUPA 4IF4A 1G5PA 2OB2A 2OHFA 4OQMA 1B6RA 3IVAA 4F97A 2FE1A 2JF0A 2P91A 3FPJA 3PDUA 3AR3A 1Q43A 3ETLA 1A04A 5DIZA 5HWEA 3FKSD 3BHMA 4KACA 1QP0A 5BO5A 1SQ6A 4C4XA 3D59A 2ZM6O 1SKVA 3OMIB 3TE7A 4D9HA 1N3LA 5J5VA 4F93B 3QY9A 1W3EX 2DHRA 4MUKA 3C5EA 2FQQA 3DTTA 4OQEA 2FPSA 4DV6B 5TEVA 1GQYA 1GV0A 2AJCA 1M8PA 1RYYA 5L8VA 5JS1A 1OYWA 4JLJA 4WBSA 2OLEA 1ZBDA 1KAQA 2YWDA 3K8QA 5KUKA 2F3SA 4Z86A 5KYUA 1M0SA 1NRJB 2H65A 2NZVG 2WJAA 1I6LA 1KI2A 1M2WA 1AZLA 2W0MA 4L76A 4PAMA 4B85A 5K9ZA 3L6BA 5BR4A 5CA1A 1XHEA 4WOJA 2Q5FA 2E75B 3O1IC 4PQEA 5THXA 1COWD 3D8BA 1YA4A 1A9PA 2CXSA 2EFEB 2Y1FA 3BK1A 3T1QA 5KZMB 5ADUS 5LWHA 1FYXA 3GLIB 3UMBA 2FPMA 4BXOB 3BEHA 1XRNA 2XKJE 2BHNA 5DV9A 5JJBA 2F1OA 1B93A 4ZI7A 5BUQA 4RL4A 1DQRA 3HKBA 4H08A 2CL6X 4YRKA 3HYTA 1KZ6A 2AW5A 4TQDA 3BERA 1EVYA 5INTA 2B7LA 5JPDA 2AUMA 2LUOA 1YIDA 3THRA 4HQ0A 5HYVA 4FLTA 1NSYA 4YH1A 5DRYA 5ITWA 1JZQA 1YL7A 1CYDA 3G2OA 5ICFA 3AYZB 5CURA 3E8MA 1QE3A 2QTVB 1HFKA 3HA2A 3KQPA 3DOIA 2QA4F 2Y1DA 2B5VA 5DWQA 4BJ6A 3U7JA 1E1CB 1C14A 2PX3A 4Q9DA 3HR0A 1HNWB 1PTJA 1BCSA 4G1EB 1G4AE 4E51A 1LNSA 2Q5JA 3HB1A 3A1NA 3SYCA 4HLCA 4K9QA 3U7QA 4BFUA 3X1JA 1RVV1 1JKIA 3O3NB 4G0QA 3UNXA 2FEOA 3D54D 5IULC 1PWXA 4RPGA 4HRYA 1DBFA 5JNVA 2I87A 3V5NA 1T6BY 2F8LA 2QL6A 3M0EA 4L9WA 2FUG6 2GYWA 3RWMB 1XZCA 1N4CA 1WB5A 2EKZA 5CFRA 3FPHA 4R9VA 2HDHA 1EHYA 4FYKA 4DJDC 5IFKA 3Q7IA 4QVKA 5DZSA 5J9PC 4DS3A 1WB6A 1LH0A 3G82C 5FI0B 2ZBEA 1ZU4A 1VLQA 5IKPA 5JNWA 3L4BA 5F4ZA 1QLEC 2IHJA 2F9FA 3B52X 3RFUA 1OA0A 2R5WA 3NHBA 4R7CA 4DLYA 3TLZA 3P0HA 2CMKA 4JJ6A 2N1BA 3FWNA 3I23A 3OFVA 5LMUB 4EW1A 2QN1A 1SEVA 1T6NA 4Y0VA 4F8EA 1YJNF 2QL7A 4OSEA 1Z7YA 1QE5A 4L3VA 3PL5A 8ABPA 1PK8A 1NJ5A 2PKXA 1ZIDA 3G71F 3K4PA 3PHHA 3DE1X 1KJQA 4V0SA 2BFFA 3EAQA 4M1KA 4TKUB 4YX9A 1UPTA 1OWPA 1Q7YH 1TJPB 3N87A 3TLCA 1AGXA 2O20A 2Z2IA 4FLUA 2H9YA 3CXRA 4D41A 2JFGA 3EC2A 2DG2A 4QAJA 2R8PA 3S5JA 5KJFA 3F7MA 1A9OA 1D2CA 3Q6NA 4EVSA 4B6EA 2O8CA 1ICIA 1JSZA 2WUWE 4BKMA 1QVFF 3MGAA 1ZITA 4N76A 4P3OA 2YDXA 3UM9A 3T0FA 2ZXWC 1KBHA 1P7ZA 1YBFA 2EBWA 2HK9A 2V6FA 3QXGA 3GRAA 1C2TA 4FS3A 1DG9A 4JH0A 1U9IC 1V3QE 2BKVA 3OGCC 2J5KA 3ELWA 3OFKA 3D6JA 4KLCA 4TT3A 1P2VA 3QTBA 4X6XA 3VSEA 4A36A 4KFRA 4G5RA 3WBBA 3NT4A 1VQPV 1UZAA 1INLA 4BW5A 1L4BA 2HBQA 3CH6A 3RAJA 3GEPA 4E32A 1MSWD 4AKTA 2JFPA 7GPBA 3KKKA 3HP1A 3U1VA 1SQSA 4BNWA 1EMDA 4BR6A 2JGMA 3EXHC 3OPVA 3NTVA 2TMYA 4TV9A 1SKYE 2PCJA 4JI0B 2QG6A 4R69A 4WFEA 5IVDA 2WFLB 1XPRA 1QDLB 2Q27A 4ZOLB 1OH7A 4I4LA 1QYWA 5LP1A 1FSSA 2YI9A 3ADKA 3O3CA 4DLVA 1RKQA 4F3YA 1WSDA 4L4UA 4Q48A 5H7XA 4RNCA 4QODA 3AEIA 3RVJA 3G02A 1L0LH 1I3NA 3GJ8A 1ULBA 1Z08A 4MRRA 3QVSA 2B94A 2B8WA 3M2TA 3QBTA 4I50B 4LKOA 2CVOA 5IBQA 1ZH8A 1C8KA 3KD3A 4H6VA 4BVAA 3JQ7A 4BLUA 2R25B 3VQYA 4ZI7B 2XV1A 4H6PA 1RHUA 1FP7A 2VRZA 5KAPA 3COSA 3GV0A 4C6TA 3QX7A 5ITSA 2O2EA 3BL5A 4G41A 4JYPA 4MQ4A 5B37A 3CSXA 1TFUA 1R0XA 3OP4A 4Q9AA 5IUNC 4MVJP 4UUQA 4DLZA 1CF2O 5ABPA 5L3VA 3SVLA 5GZ6A 3ABTA 1S2OA 3IP8A 2JFBA 1IIBA 2ZTVA 3ZGLA 2ZIUB 1N8KA 4EO9A 1GQSA 2DP4E 4BNIA 4MSUA 3B1VA 3IUNA 3UMFA 3CC4V 2B8NA 2OUKA 1QS0A 1JG3A 1XU7A 2IX9A 4JB2A 3T7RA 5CAEA 2OBXA 3RJMA 5BSHA 3BTVA 3PEUA 3HDHA 2CHUA 2NT3A 4NY1A 2AG5A 3HBNA 2GN8A 4E88A 4LV5B 4R1QA 3UMYA 1NLZA 1PI3A 4R1UA 3E3AA 3E1GA 1ZVQA 3EOAI 1W2WB 3K2QA 1H0KA 3G67A 3OEEA 4WNCA 2IPOA 1FQWA 3FX7A 2I3BA 1AQYA 1GKUB 2PF4E 1RADA 2W5UA 2ZUUA 3AF5A 3DDCA 4B3MO 2IVFA 3EODA 3CPWF 1N6OA 5CTAA 2J6CA 4BIZA 3BIJA 4I9UA 5EUQB 3D1LA 1IQRA 2OILA 3SSMA 2AZ2A 4W1QA 2ZTMA 5KSZA 2JLYA 1VE6A 2BY4A 3N05A 3CG0A 2RC5A 3SYAA 5GTHZ 3M8KA 3OWXA 2LP7A 4TLCA 4XKJA 2B0CA 1E1RG 1U7WA 4X6UA 1R0KA 5C1PA 2VBIA 2EIJC 2NTVA 4OJKA 3DZCA 1AHPA 4YJ2F 3LTNC 3AZQA 1FLDA 4PSCA 4A0HA 2CK3G 5K0JA 3BB3A 1KQFA 1W2HA 5FFNA 5K09A 3HSSA 4AY2A 1G4HA 1U0JA 1DQYA 3ILSA 4G5YA 4MS3A 2Z1DA 4MRMB 3C7KA 3C3BA 1H0RA 4RX1A 5BW8A 3KQQA 1FJ2A 3NIFB 5DTEA 3F1KA 1I2DA 3J80A 5E2BA 1QZZA 1TTPB 3TF5A 1VI2A 4IDBA 4B7XA 3CY6A 2EJUA 1E5DA 4LUCA 3RIGA 4R9SA 3WDKA 3A8TA 3ASNB 3QVJA 3PF9A 3VQXA 4MV1A 3S29A 3VJKA 5E79Z 3RHTA 4XVRA 3DVRX 2F1KA 3N0WA 4MZDA 4DJEC 2O7VA 3ILHA 5BYAA 4RPCA 2I6SA 2CJPA 2PSEA 1MTOA 3GHHA 1XP8A 1MABG 1X86B 2FWIA 1PJQA 2GBPA 3HV2A 4LHXA 3RS5A 3QFTA 3BICA 3DKVA 1EX6A 4EBFA 5IU6A 3CVYA 4I4CA 3LF2A 3DC5A 4C4YA 4MJ7A 1E3EA 1CUWA 1XNRB 4ESEA 2HRRA 3H86A 4I7ZB 5JJIA 2XY4A 3SFZA 4LZPA 2Q3JA 3TLBA 4PFQA 1J1IA 1JWBB 1D2AA 1S3IA 3QYPA 3ZU4A 4B73A 2JFOA 3R09A 2RJOA 3AFHA 5E0KB 3HXOA 3W78A 4LXQA 2GBCA 1B73A 1Y1LA 1I14A 3H5AA 5ITZA 1JAZA 3NJRA 5FEMA 5JI3E 2QX8A 4FLVA 2RHBA 3LUGA 2G1AA 2VAPA 1I9CA 2CDBA 3AKDA 4X3PA 3D00A 3TVYA 1XAIA 1LBQA 2G67A 3LSQA 3NIGB 3WHLA 2ZBGA 3OW2F 4FDMA 4GS5A 1ANKA 3AILA 3CCSV 4DC1A 1T4MA 3BC1A 4EUEA 5AW3A 5DM2A 5E4FA 4PELA 1N34O 1SZTA 1LRLA 2VYND 4O3FA 8GPBA 5I3CA 1DRJA 4ZAYA 4LNAA 1G20A 4BRWA 2EQ5A 5HE9A 4NNOA 1ACLA 3H11A 4AURA 4EJSA 2GZRA 4F21A 3UJ6A 2IU3A 4LOLA 1H6CA 3WLLA 3A4TA 2MSNA 3HFJA 3ZCSA 1SD1A 1QVVA 3EXAA 1GRNA 1XN4A 3G7UA 2PXAA 3KXPA 3ZY5A 4G9GA 4ZI2A 5DNUA 1SM4A 5E8RA 4Q9NA 3FSEA 2XAQA 1E2EA 1QF7A 2FH5B 4FWTA 1UOOA 4FQ8A 4EPWA 5F3WB 2CW4A 2D2FA 3THSA 3V9AA 3ZBPA 3LW7A 4DMGA 3D1JA 3FCCA 4E21A 4LISA 3AFNA 3OIWA 1BZYA 2Z58A 3B2QA 1AD2A 3N6VA 5CJPA 3CCVV 3BXEA 3I5MA 4BU0A 5CG1A 2YFHA 2R65A 3R6TA 1YF2A 3B3QA 4YCBA 2AB0A 4PJ0Z 1HNZB 2VC2B 3BAZA 2P41A 2IZ7A 3JSAA 3H1IH 3OE1A 1J7HA 1K68A 4HAZA 1SHJA 3C45A 3T3OA 1A72A 4I0XA 2RSLA 3DC6A 3KYBA 4XLLA 5DGCA 5FTJA 2AL7A 4AF7A 5C51B 3FTFA 5BN4A 2N04A 2E4VA 2N1MA 2XCQA 4B3XA 4UV8A 2B9VA 4EGFA 4YMVA 1Q57A 4ZCRA 1M0TA 4Q4DA 1MF7A 1HEUA 1YZTA 4HX2A 4LYJA 2WZDA 2QSYA 4ZI3A 4J0IA 3H18A 1PR6A 3OX1A 4L4XA 4PO1A 3ODGA 2Y66A 4B40A 4D9JA 1B8NA 4HX5A 4JLOA 4BNYA 1VK3A 4P83A 1LC0A 1ENOA 4I2VA 4MKHA 4OGFA 3VDQA 4JTAB 1J07A 2X2PA 5ALXA 5C35A 4FXOA 1KU6A 3DV2A 1V55B 1DBQA 2WALA 2BGMA 1M2OB 2ZAGA 3X0DA 3GNQA 3D3JA 3H2YA 3G1TA 2HXYA 3OZWA 3JQAA 1M8FA 1ZUNA 3GK3A 4DR4B 4Y9DA 1ISJA 1V5FA 2FR8C 3WC4A 2JNWA 3IC5A 4DV0B 3K8OE 3NHZA 2IGBA 1YXMA 1J2RA 3TD4A 1SA0A 4J9ZB 3CCQV 3V9PA 4PG8A 4TKVA 3F5QA 4EYGA 2YVKA 3O7MA 4NJEA 4HUQA 1YU6A 4RVHA 1NL3A 4PA4A 3AF2A 4S3MA 1UKAA 1U6IA 2FC3A 4BVSA 2SKEA 1S5HC 4GQIA 3H5OA 4I14A 5ESDA 5H5JA 4O2BB 3T4PA 2JI4A 2O05A 4ADSG 5KQPA 5DEIA 4CL0A 4RZIA 3TPZA 3OCUA 3QUQA 5AG2A 3BF7A 1M8KA 4G0ZA 3ZR4B 3L7YA 5BSKA 5EJMA 1Z5PA 1YCIA 1UIRA 1VCIA 4UVGA 4Y7DA 2F9MA 3UT0A 5E9WA 3TLMA 4D99A 4W1RA 5EIXA 4Q3OA 2HG5C 4LJ5A 2JFQA 1MZVA 4P7KA 4FNAA 1XPUA 1SZPA 4LCEA 3ICXA 16PKA 3CISA 3QBDA 5HHTA 5FL7A 5HIIA 4Z7JA 3FTEA 1KY2A 3CEJA 3ZWXA 3P71T 4X8OA 3G9XA 3G0CA 2B98A 5KNBA 3MJHA 3TUZC 4JYMA 1G5TA 1P81A 1IUNA 1B26A 1PTJC 2OAGA 2BR3A 3P9SA 1J5EB 2O2ZA 4Q1EA 4RQTA 5CM8B 4BX2A 1EVEA 4O2BA 1K0UA 3RB8A 3SLRA 5JAQA 5CG2A 4NLLA 2PYDA 3R20A 4OFBA 4XAQA 1YAHA 4Y2UA 2HPZA 2P1RA 2FG6C 2R47A 3H1PA 4NBTA 4MDHA 5EZSA 3MMXA 5F73A 3CCUV 4ND3A 3KYJB 2BKXA 3H9UA 1QVAA 4X54A 2ITCC 3RYIB 4XTCS 5JVDF 2QG9A 3F3SA 3KR0A 4KIWA 4M37A 1LZKA 4I55A 2VZEA 1TKBA 4JYAB 4CQLB 3B77A 4PZ0A 4S05A 4HTFA 3LZCA 2ZDGA 2ZAYA 1AKQA 1G2QA 4K88A 4UNQA 1YEWA 3SQDA 4PHFA 5BY2A 3M2PA 4CTMA 4CMEA 5HUQA 3JD0A 2PH3A 2QVYX 4PFKA 4O8CA 5H0IA 4G4VA 3T54A 2NU8B 1KIMA 3LWPC 1UMKA 1ZI6A 2ZYAA 3IO5A 4IJVA 2WLNA 2POQX 5G02A 5MN6A 4KLAA 2BR4A 1MGOA 4KRYA 1XZPA 4WK2B 3SSNA 3TQOA 5C80A 1R5BA 3FFTA 4P4NA 3NFYA 4PNZA 2CVZA 1JDBC 2J9ZB 4QATA 4BO2A 5EHNA 3CTPA 3JD2A 4MHTA 2ZJ8A 1O58A 1WTCA 4CW7A 4M9SA 4EJ2A 1YZUA 3O2QB 4M88A 4FJ2A 2AMYA 1GAJA 5A0TA 1JL3A 1KAHA 4GX2A 1KUQA 1ONSA 4DLNA 1Q5OA 2EJ7A 1BQEA 4BT2A 3MHTA 1WN7A 1U2DA 3DJYA 2YNMA 3ASOC 4QDKA 3QVWA 1XG5A 4U6SA 2ZCUA 4IPTA 2ZULA 1CR6A 4GMDA 1VJCA 3QUBA 2EJVA 3WMFA 1PUIA 4KN5A 4U00A 1QMGA 2ZIOA 5EIBD 2UXCB 3ZY3A 3LLSA 1SULA 1IM5A 1NBEA 4INZA 4QHSA 3ZUGA 4D26A 1YRHA 3DVAA 1RQPA 1ZU5A 3H5LA 3OAAG 1EP2B 2G9IA 1JVBA 1LRKA 3RE3A 2C3OA 2OXFA 3B8HA 4IGIA 4AJEA 4JI4B 5I01A 1XZNA 3MD9A 5DNEA 5LL6Y 1C1DA 4DGQA 1OH5A 4DB2A 3BJZA 3WWDA 2IM9A 3NONA 5HWSA 1B3QA 1M74A 1OC2A 1I1NA 1C4XA 3COVA 1E79G 4YO8A 1NR7A 4L0DA 1NPTO 3URMA 2FDCA 5MFZA 4DILA 2EJBA 1H2RS 4F4CA 1DWQA 1V6CA 2C4UA 3GCWA 5ETJA 1QM5A 1C1DB 1FYVA 1UBMS 1W0KG 2G9NA 1BVRA 3NT5A 5JQGB 4XVCA 1I4TD 4FFWA 4PW0A 1I3MA 5JJNB 3JQPA 4M46A 4EB6A 2X9LA 1PUJA 5T64A 3OFSA 3ABLB 4ZIBA 1T3GA 1IATA 2P6UA 2QIPA 2IH5A 1GZSA 1N2IA 1BX1A 1Y1TA 2BZSA 3I2FA 5EJAA 4AFNA 3FFXA 3MMNA 1IQUA 1GQFA 1E18A 4IMIB 3SEQA 4B3TO 1JEAA 4LF8B 2NT4A 4KB5A 1W1UA 3LSSA 1F4LA 1RRFA 3BDIA 2ZSFA 5CM2Z 1L8QA 3L8EA 3CP1A 4I4NA 1KH3A 3MJCA 4B32A 2YXDA 4AYWA 4DVGA 5EWMB 2IJJA 1RMYA 2ZQYA 4II7A 3CJTA 3ZGNA 5E1AC 2QDOA 3C43A 2PX0A 1XYYA 3FHJA 2PNJA 4WESB 4CMKA 4EBBA 4EQ6B 1TJYA 5B6PA 5F35A 1CULC 2PZEA 3WSTA 1FVHA 3UKDA 3KJKA 3K0FA 4QRHA 1UT6A 1FMFA 2VR1A 5JCOA 1UBOS 2D3WA 3BTOA 1Z45A 3NBKA 4WK4B 5AICA 3HVKA 1V48A 4INAA 2H2WA 2WSBA 2ZJ3A 1W6RA 3BQMB 3FUCA 5JE8A 3WLPA 4CKEB 4DWWA 3KVNA 5CFLA 2JRIA 4XEHA 5IMBA 4KKXB 4TQUS 3WK5A 3ZI7A 4EG4A 1NUSA 3K8YA 3G68A 4HAYA 4Y6OA 3W3AH 2GQ0A 3FUVA 1S0VA 4PGGA 1FXKB 4RD0A 1TK9A 3K05A 2H2FA 3QLTA 4FYMA 4G5SA 4MVQA 1Q92A 3F5FA 3GRUA 3S2FA 3ESBA 5SY4A 4AUNA 1SESA 2BI4A 3PLNA 4N12A 3D54A 4IGEA 5HCIA 4GIBA 4S12A 3WGVA 2JS3A 1S5JA 2Q4TA 1D8AA 3OI7A 5L7WA 1TW2A 4ZODA 4E0BA 4ER6A 3TOSA 3WZ2A 1HE4A 3Q8KA 3J7AU 2DFVA 2I9PA 4CLEA 4IYJA 2PM8A 4CEIB 1R00A 2DPLA 1GLGA 4S1WA 3G1WA 3PEFA 1QD9A 1M72A 2CJWA 2UKDA 3N07A 4OP1A 2HC9A 1WUIS 1IJKA 2FWJA 2EWMA 2TMKA 3OCXA 4D9MA 3WBKA 2GPNA 1GJRA 1LX6A 1GFIA 1P5JA 3M34A 1RP1A 3BH6A 4LCBA 3P5BA 3KU1A 5SY9A 2UZHA 1QZ3A 3PNYA 1EFHA 3K15A 1JKFA 5FWAA 4Q3BA 3TD9A 3OD4A 3DW1X 3C6YA 5K6TA 1PJAA 1RWNA 2Y4NA 5AM1A 2F55A 2AX3A 4BC1A 1T3LA 2Q9CA 2PV7A 1WXEA 2O2GA 1UPGA 1YZVA 1VE7A 2A35A 2QAIA 4EGAA 1ID8A 4TMWA 2DR0A 5AOCA 4OXRA 3B1WA 5IC4A 1Z5WA 4ND8A 3KYDB 1EZ1A 2FLWA 1Z0UA 2D59A 4YT5A 3SR0A 5G0WA 3FPIA 4PBTA 1CETA 1LPBB 1QORA 2GKSA 2QYOA 4HH3C 3UZUA 2Q4DA 5LA6F 2XYRA 1YTFB 4XDHA 3VC3A 5KCZA 3BB4A 2QEQA 4YXFA 3WISA 2C03A 3PD1A 4EA7A 3FTPA 1RCUA 2PKRA 4WXHA 1P7VA 2CF6A 1L0BA 4JJKA 3CVUA 3ISVA 2PUDA 4Y3UA 1U5AA 1P7BA 1YMUA 3LQKA 2BTUA 3OKFA 4HQLA 2PU5A 4X0EA 2YWEA 2BSQA 4LVOA 2NUTA 2YVUA 2EQBA 5FFFA 3D43A 3UMJA 1E1YA 2KB1A 1GPH1 3PQ6A 1GUDA 2GM3A 3E53A 4HAVA 4HD8A 4OK5A 3JCMM 5SZKB 4A6PA 1M1UA 5ALWA 1MIOB 1DEXA 1TIBA 3MWFA 4NOKA 3FDZB 3TL6A 5EMHA 1AKRA 1Z6YA 1RM5A 4IIJF 5E7IA 2EJTA 5F2NA 4XASA 2P3OA 1SUSA 4FLFA 3A2FA 4LXHA 2WD7A 3DLPX 3WTCA 1JG1A 4B4OA 2P6PA 4B3IA 4GC5A 2YWRA 4JR0A 1HTWA 4AMUA 2OV6A 2HRUA 4MOWA 1GSAA 1G6HA 2JHCA 2NGRA 2OXEA 1R0LA 2CCJA 3B82A 3RM3A 1UFVA 2V98A 3AHGA 4MB6A 4UBMA 4EHIA 5LNK6 4PC7A 3FYIB 1X7XA 1QGOA 1YIJV 3OFND 3EGCA 2H94A 4RD1A 5AHWA 4ZU3A 3O9OA 5TRTA 4HC4A 3TQHA 2IHZA 3S3TA 2NSYA 3I2YX 1KZHA 4B83A 4EI9A 1AQ6A 2NR5A 1Z35A 2HSGA 2ZS7A 3LQFA 3I6QA 2XEDA 4GOOD 4ZQCB 5HKOA 1EFAA 4C4PA 1QRUA 1NJ8A 1QCCA 4MIYA 1TC2A 1TD1A 3OAAA 1DEKA 2F1JA 5DYYA 1L5SA 1QHHA 4K0RA 5COQA 3A9RA 1YI0A 4P82A 3IOMA 1OFUX 1XVIA 1Q16A 3TZLA 3EGDB 2NZ2A 5CA3A 4R05A 3UPTA 2AQHA 5I9IA 2VF5X 2R8BA 4L51A 1VJRA 5DN9A 4ZT2A 2COUA 3P5SA 4M98A 4ONEA 3LDDA 4IJQA 2Z09A 3L7JA 3HA5A 3J81M 4H37A 1VJTA 3LBFA 3B36A 3K6SB 2XPCA 3M6IA 4E2XA 2VRBA 3C85A 3H5IA 5G2OA 5CX4A 1R0CA 2RGGA 4YRMA 1FFYA 5LDHA 1Q0LA 3PUZA 4BMXA 5I7RA 3LWOC 4KWHA 4MULA 5KPDA 1D9XA 3OF5A 5GOTA 5CEJA 2BELA 3VDXA 1YBAA 4FHZA 2G0NA 1L1RA 4Q3AA 3RUAA 3FPKA 5KREA 4PXSA 3RFXA 1BWRA 2IYQA 2OFOA 2ZIAA 5DX0A 5K4GA 2WTNA 2XR1A 1KMHB 3WNQA 4X3MA 4JI1O 1RM0A 1ZN7A 3LRTA 3ZQKA 3TOZA 4D7SA 1QG6A 2OBMA 5ALMA 3CVWA 2C2YA 2PUVA 4R0MA 1W36D 4NCAA 3C6XA 2HU5A 1J5EO 4XX1A 2UYCA 4DRZA 4LFBB 1E89A 5EBLC 1WPRA 3PICA 4WOPA 1T1SA 2ZIZA 4GZRB 1TLFA 4Q4AA 4RM3A 1NZJA 4C89A 1BD4A 1J1UA 1W96A 3I7TA 1KZGB 4URYR 5J23A 1ITZA 1KZYC 3GD7A 4PPGA 3ZDEA 3OO0A 1JIQA 3L6OO 3K0HA 4YWJA 1H0SA 1PSZA 4NV1A 3HM9A 2D3OW 3KKNA 2C82A 3FPLA 4OQQA 2RN9A 4V03A 5ERGB 5HNKA 2LIVA 1M34E 2AMJA 4DCVA 1BG6A 2ZIGA 2ZRNA 1IEXA 3ET4A 1SHLA 2GWRA 1V5GA 4YMTA 3PC2A 4KHPO 3OZRA 1WCXA 4AP5A 5LP6C 3F5MA 2BKAA 3FPFA 5ISMA 3B9RA 4QRDA 4A6EA 4E5VA 1XI2A 1K88A 1XRSB 3G8YA 3ILXA 3K9HA 4JP5A 4QASA 4YCLA 2H4YA 1B0UA 4R0VA 1AHHA 1O6GA 4V0QA 4Y2VA 5HVNA 4FONA 3WMEA 4HL6A 1GRRA 2XMRA 1HY3A 5E4TA 3TMYA 5AW7A 3SDBA 3I72A 4JEUA 4ALLA 3HWWA 3OTFA 1J23A 2AF3C 2DF8A 2WLMA 1Y67A 5KWSA 5A3VA 3ROEA 1ECLA 1G8FA 2VT6A 3LSYA 1C1HA 1ZONA 1UOPA 3D4LA 5HGJA 1Z16A 3TPCA 1OCOB 2WF7A 3LA8A 5BR8B 1MRSA 4TX1A 4TN1A 1QGUA 4NX2A 4KRFA 2W2LD 3A9TA 2AE1A 2YZGA 3AXSA 3NV7A 5FWXA 5GANK 5IF9A 3JCZA 4DA6A 3R3WA 4H31A 3O4RA 4RDIA 3ZJZA 2HOQA 3MPUA 2I6TA 4WCDA 5FI5A 3FCEA 5FAKA 3ZGZA 4EFLA 1VCOA 1YFZA 2ANCA 3KZIZ 4WXEA 3U1BA 1W7AA 2UYOA 3LC2O 3QU4A 3N8NA 2ILTA 4QVGA 4E5MA 3L49A 4B17A 3APQA 2B5WA 4B3GA 2XZOA 4NE9A 3CRNA 4F4FA 1IOZA 2FMUA 2PR2A 2C8LA 3L7CA 4M99A 4OGKA 1U2EA 1VJ0A 1F4MA 2RGNC 3BIWA 3H1GA 3HUDA 3W2GA 2XCTB 2H2HA 2J0UB 4TLDA 3CZRA 3ILVA 1F8FA 2ZYUX 5EWRA 3AVQA 4TV9F 3H0EA 1D7AA 4J4TA 4RTJA 1XBLA 1FE8A 2VH1A 4P31A 4G88A 5HF6A 3MFYA 3TIFA 1A5TA 1GO2A 5L9AA 5MGNA 1YBHA 1RMTA 5E6RA 1E0SA 2CFIA 3J7AR 1WNSA 2CDYA 3KQWA 4JLVA 3PSHA 3KVYA 4TL9A 5KI6A 1S6YA 2CFCA 3K35A 3P0FA 4F8JA 2DXIA 1XHFA 2DULA 2GZ1A 4OKSA 2B6HA 1K3FA 4MARA 2JD0A 1ZEMA 4JLKA 1SBHA 3TLYA 3I01M 2PUTA 4Z2AA 1BE1A 1MT0A 4PYNA 5F3RA 2HJVA 3DTNA 1QU9A 3BK2A 3KV1A 4HNHA 5D6NA 3TSAA 2IEBA 3GCXA 4JLBA 3UGTA 2DPYA 1X15A 1NVDA 4F6CA 1Z26A 1HNZO 4UTPA 1Y5IA 2I34A 5IJ0B 2VP6A 4LK3A 2CE2X 3T1YB 2X0NA 4HSEA 4DQVA 3JZFA 4CEHB 1D2RA 1I5OA 3P26A 1GMGA 1K6XA 2Q46A 2Z8XA 4TT3D 1PHRA 1GCOA 4DGSA 3QQPA 4KSCA 2ZETA 5BVGB 4WXMA 1DXOA 1Z29A 2V6MA 4F5WA 4JGGA 5H83A 3QVGB 5MF6A 3AG5A 4EFMA 4FR5A 3O74A 1CVLA 3LL4A 5KIAA 4IV5A 5JOQA 3BF8A 1CQJA 2WJIA 2XE7A 3G0DA 4MTFA 1YDMA 1VFNA 2YX1A 4IXNA 4XJSA 1EKXA 1I10A 5FPHA 3BY6A 3J81N 1AI7A 3R9XA 1NXPA 1YQUA 2JJ8A 2EW1A 3KTAB 3WIBA 2BZ0A 1YI8A 3FA2A 4RPIA 4TWJA 4DHEA 2M98A 1OASA 1Y4ZA 4QIWF 4A0RA 3SS7X 2IIBA 4YT4A 1IN1A 1JFLA 1M10A 2XGJA 1E6EA 2CJFA 1HYHA 4DV0O 4QTTB 4YBZA 5EVJA 3T1HB 1EIZA 3AL0C 1CUDA 4IQGA 2AJTA 5SY6A 1YQQA 1ZW6A 3F4BA 1GRJA 4UXHA 4Z4GA 3VMFA 3ZMSA 1USWA 1VF6A 4OXNA 2REOA 4Q6GA 5IZCA 5CXSA 2Z4RA 3KQOA 1TD9A 3JQCA 3ZV4A 1I5EA 5BR8O 2XXAA 2P9QA 3BKXA 4QUIA 1HT0A 2KM1A 4RQUA 4DMRA 1VA5A 2P62A 3R6GA 2XZLA 5H3CA 4L9AA 3NW9A 3DVLA 3HJTA 1OZHA 3PNLA 3GY0A 1OCRC 1T4GA 3ANLA 4UUBA 4ZICA 4YJ3B 3AFOA 1EDBA 1M1XB 3O8NA 4BS9A 1H69A 5TF0A 5JTTA 1MSDA 5FULA 1YF3A 3GJSA 3OUSA 1EXNA 4JEHA 2AFHA 1L8XA 3HU2A 4YR9A 4KNVA 2WWHA 3CMMA 3K0GA 1K5QA 1SQGA 1AQUA 1RRMA 1AR5A 1W5FA 2HF9A 2YL2A 3C6ZA 3KQTA 4ILKA 1MC8A 3P9KA 5D3QA 3K9FC 3B8NA 1P6XA 1I24A 1QBGA 2R6DA 3HYLA 1VPDA 1XZJA 3I2KA 3VPGA 5GINC 4Y2XA 2HTFA 2YC2C 4MX8A 3VHLB 4Q7MB 3IP5A 4BJ5A 2GOYA 3H17A 4U4AA 4RTNA 5IT4A 4G0OA 4B5KA 2QLFA 3EPKA 3AVTA 2WYHA 5EC2C 3KL4A 1RZUA 1RW4A 3MSXA 1DC6A 4IZOA 4MUHA 5AW8A 5KDDA 3C97A 2PQ2A 1SQ0A 1GN9A 2VWHA 4LHSA 3U0BA 5T8KC 4KITB 4X62B 3FPSA 4LFAB 3HRKA 3Q3EA 1TUBA 4IIEA 3IXMA 4DTIA 4K03A 4NE7A 3HBFA 4XA8A 4DQKA 5LJIA 1T1IA 3CRZA 2AVDA 2F64A 1D9ZA 5DYGA 4DDMA 3WG7C 4RZXA 3SK0A 2KE5A 1Q3HA 2DLDA 4M2LA 4LSGA 3W0LB 1KK1A 3T35A 4WASA 4G4GA 4Z51A 2C0CA 1E1CA 5K0EA 3CUKA 3U39A 2E74B 4K8OA 2CVQA 2B5UA 3LTEA 1MRNA 3FE2A 4NTZA 3S8MA 5JD6A 3IKTA 5FI3A 4YDSA 3FW1A 4FMCF 1IN6A 2OGWA 1XROA 1U11A 2Q4EA 1UJ5A 3DSQA 3KO8A 5ALLA 2XKBA 3OTIA 3VIUA 2J30A 4Z3DA 4EW2A 5CBPA 9LDTA 3KQSA 2WUDA 3BSYA 4TMFA 3ZLBA 3DLBA 4HYOA 1GNLA 2YTZA 4O33A 1Z6QA 3U17A 2YY5A 3FDZA 5ALHA 4CC6A 2OCPA 1VYUA 1QIJA 1OJ7A 2VSXA 4GECA 5E0OA 1Y8AA 1AK9A 2YUAA 3IQWA 3IRVA 3MJEA 1FUKA 1GCGA 1F2VA 3R1IA 1XP5A 2PTGA 3ZX5A 1WA8B 3V1TC 4EX6A 1JHYA 5BN3B 4X85A 4YECA 1YV9A 3LG2A 4MWOA 3D6VA 3LUAA 1X3LA 1RYMA 4GR4A 3WB2A 3WJAA 1VL1A 5EP3A 2H06A 1XNQO 2AKAB 3PI6A 1EINA 2WVGA 3H5NA 3QWFA 1DZIA 1G1AA 1H2XA 1S3SA 2Q73A 1GUYA 3VGPA 5AOBA 4CU2A 4B35A 4LY6A 1HKUA 2BEUB 4N6NA 4J16C 1ZXLA 2AZDA 1DOHA 1H66A 1XWFA 2H5IA 4PSKA 4W5WA 5IEBA 1Q12A 3S7TA 3KYDA 5JQGA 4MROA 2E4YA 1JZSA 5C9ZA 4MVWA 2JIZG 2MSKA 2BLLA 1GTOA 2DPMA 3LRXA 2FRVA 3NBUA 4BV2A 5AUPB 3T4DA 4C8EA 1WP9A 2JIZA 2ZTLA 2OAEA 5ICCA 3UJAA 3FYUA 5JJEB 1E2QA 1QGED 1H47A 2CNWA 3OCYA 1LD3A 3SOPA 3TD2A 3IBFA 1KETA 1XOUA 1JWAB 1WJGA 2PA0A 3IS3A 1AKEA 4KE8A 2XNSA 4MIOA 5FYDA 3CC8A 1K8XB 4R3UC 2BE7A 3BDVA 2JS5A 1SCJA 3K6JA 5ICMA 3ZCCA 3QF4A 5F7ZA 3SQNA 5JAUA 2DM6A 2HJGA 3SPGA 3M1IA 5FBWB 3G7SA 4AROA 3S0HA 1ADCA 3OTQA 4WZAB 2GJSA 4CPDA 3AK1A 4UCOA 1ZD8A 1YVRA 4DNXA 3T1CA 4KDEA 2D5IA 3B6KA 2C42A 4AO8A 3F0TA 3TLJA 1J8MF 5A5FA 1A9QA 3UWKA 1BNCA 4PXYA 3THWA 4WFAV 4PLVA 2YYAA 3HV0A 4AC9A 3OQJA 4AMVA 1RZVA 3FB8C 4YVFA 4LJAA 2QMYA 3WZLA 2IEAA 4X62O 3MTIA 1GTJ1 3PHJA 1H2AS 3RC3A 2WVAA 5KAFZ 4TZ6A 3WR5A 1J33A 1DPFA 4BNXA 3W4IA 4AZVA 4YJ2A 2VOJA 3LGXA 5D7NA 1FXKA 4WFGA 2J4CA 1P1JA 5G3YA 3F7NA 2XUOA 4BQOA 4EHDA 1XN1A 5I51A 5LQDA 3W5UA 3FF4A 1JWLA 2EP8A 2C5AA 4NBUA 3G2HA 4LYFA 2HRBA 3T1YO 4PYKA 4ZVQA 3C7CB 2EU8A 6REQB 3ERNA 2C7QA 1KWGA 2FFRA 1CFZA 3SYOA 7YASA 4D0RA 1EFUA 3RYHA 1XXHA 2Q07A 4OH7A 1DVRA 4WINA 4DR2O 3ZWCA 4J75A 2INGX 2IL1A 3A1WA 5BWLA 3FAVB 3MDOA 1XAJA 3IFSA 4O5AA 4EQ6A 2GK6A 5IT0A 2PZ8A 4Z9XA 2IF0A 3ZE7A 3UHJA 3VX4A 4MWBA 1AH2A 1Q3KA 1N78A 4AKHA 3BHPA 3BIOA 3K9SA 2DH6A 3NEAA 1O6CA 2F3UA 3QPCA 5ECDA 4ZC1A 4EFKA 2BM0A 5LFAA 3W5JA 1LPOA 4IIJB 4RDHA 3FKSG 2OIEA 1VRVA 1J42A 2ID9A 1U2RA 4U2DA 5AT1A 2NYVA 1SQXH 4KFMA 5IYZB 1KPIA 1MVOA 1ZGCA 2BFCA 2XWQA 3A6JA 4MYHA 1VH8A 1F1JA 1NBWB 1QYDA 2BF4A 3C4QA 3KFXA 2FQYA 2Z4TA 1IBLB 4KVZA 5D8DA 4BV9A 4XDYA 1DXYA 2D1FA 1ILEA 1OGIA 4MW3A 3QYAA 2FVXA 3CH4B 1THMA 1TUGA 2GM9A 5JS2A 2E49A 1GZ6A 4Q7KA 3T1TA 4NYKA 1FQJA 1KERA 1QOPB 2ZJFA 1JU4A 1RPOA 5HFAA 1Z9BA 1ADYA 3NYWA 2X1MA 3PE3A 3A6LA 3NM5A 2QRGA 3A2NA 2JH3A 3GWGA 2OO5A 3L0IB 2VJMA 2ODAA 3MHPA 1JDZA 1BVUA 1GL9B 2H0QA 2A9HA 1I4OA 1XZGA 1YDHA 4R7GA 4W99A 1TPYA 4IXTA 3UGJA 1NI4B 3V4PB 4DQDA 3UJ3X 2AOTA 4E2LA 2JJ2G 3VISA 2BV3A 1L4NA 2BEUA 1S01A 2R6HA 4OY3A 1QIEA 4YUXA 4ZV4A 4CEJA 2FFHA 5GIPE 2YS6A 4D4KA 2PUBA 3OZIA 4HVLA 2XMGA 3IVGA 3ZWYA 3ZBHA 4ZCIA 2XAHA 3QZUA 5KSPA 3LCJA 2D4AA 2D5LA 4LE1A 5I47A 1SUWA 3UHOA 1V8OA 2GHRA 1PZEA 1RRKA 2IXTA 4OL9A 4RWEA 2OG2A 4D81A 1VL0A 2WKPA 4FLMA 4LJYA 4QU0A 1YNOA 2QM0A 2UZ3A 1VF6C 2A79B 1JBQA 2AG1A 2Z5FA 3DR5A 1YZKA 3PSAA 1G5IA 1PSWA 4HDNB 4DUZB 5EZYB 3OU2A 2YFQA 1KU0A 1W9MA 3LFTA 4OQXA 1RWBA 3TW6A 1B74A 1HXHA 1IHYA 1GXSA 3EYWA 3LDFA 1FFHA 2QWRB 2X2OA 4HAWA 1C8BA 4QPCA 1Q6HA 4E6PA 4EYEA 4D98A 2X7RB 2D2XA 3AIMA 3Q5DA 1GL3A 2JGAA 3TTSA 1IV2A 3DC7A 1ZN8A 3UAVA 5DNYB 1O6BA 2B9ZA 1LI5A 2OD2A 1HBJA 3HL4A 3T3IA 3G13A 1NXVA 3ETDA 1I4LD 2RGNA 3PDCA 3DHEA 4HAIA 4ZTBA 4RF2A 4BN4A 5JAHA 5EFZA 1P7PA 3VU1A 3H1JH 2O7NA 4XYGA 4DUZO 2Z95A 4ODIA 5AO9A 2FGYA 2DHQA 2Q8VA 3VYUB 4CF3A 4CQMB 1DAFA 1U9YA 2AYXA 3V8NA 4CDGA 3KAKA 1K5HA 5JV5A 4H77A 2VTBA 1SRYA 1STOA 5ESWA 5FLKA 2BHLA 2F00A 4WZ6A 1WBBA 3GXBA 1L9XA 1HPLA 2MHCA 1PDWA 4DAEA 3GQBB 5G4LA 1KIFA 3H2HA 1OLXA 4GSLA 4RTLA 3LKZA 5AVYA 4KYVA 2CD7A 2IBMA 4ZARA 1LDNA 4B8WA 1LZLA 1BSVA 3GUCA 1R7RA 2QVBA 4ZO4A 1D07A 4EUHA 4QBHA 1E3QA 4UJ5A 1BHAA 4J0EA 4NBSA 2F59A 3ZWQA 5E9AA 4DADA 1SKYB 1Q1AA 3I2JA 3REOA 1OYOA 1GLVA 2HQSC 4C05A 4AVYA 4HN4B 4FUTA 3M99B 2XOEA 4WKGA 2XRYA 2A4KA 2YMQA 2OBFA 2RH4A 1J8DA 3WGQA 2X8AA 1YE5A 1ZMTA 5IHXA 3UXMA 3GUZA 2VF4X 3AUAA 1QHIA 3MTGA 4LTNA 3ZE1B 4IIJA 2O19A 2C9CA 1EWYA 3HVRA 1TEHA 2ZIWB 5CK5A 1VQPF 2GARA 4YJGB 4A0GA 3IUPA 2GETA 1H8EG 2ORVA 1TA9A 3FYCA 2HX1A 3OBIA 4B44A 2Y9MB 1QJ4A 4YJ3A 1LBHA 3Q7QA 5DCLA 5HIJA 1RQNA 2ONYA 4FXPA 1H2NA 4YIPA 1OHHA 1PW5A 2GZMA 3NB0A 4C04A 1Y3CE 1E0AA 1SR8A 1SA0B 3K1ZA 1YUBA 2AXEA 1YT5A 3ZRWB 2DHDA 5SYNA 1ZH2A 3JSXA 1OZFA 3RYHB 3QELB 5ALKA 2OAQ1 4GGOA 4XGRA 2CBZA 1XT6A 5K0GA 1MG5A 3QLEA 4G2TA 4TXJA 5U1PA 3VH2A 4F71A 4FCCA 5LIPA 2P6JA 1GN8A 3LC0A 3HAXD 4XIGS 1P1IA 3CSDA 3MTEA 5CA0F 3Q98A 2NZWA 5J2TF 1P80A 3NHFA 4YMGA 4G5QA 4FM9A 4AS3A 4CH6A 1BVYF 1DKNA 1T0IA 3CWCA 1XTUA 2ZRKA 3PXDA 4ZVSA 3OD5A 2LNDA 3C3PA 4V0NA 4YALA 2DPHA 3C8DA 4D56A 1GUBA 3SS9X 3DV0B 2AHZA 1SHKA 4HQRA 4LOKA 4M9QA 5E1DA 1Z73A 2I76A 3EG9A 1ADJA 3U4CA 4BBAA 1J99A 3PNOA 3DZ8A 1MX9A 3FYTA 4ITVA 1CEZA 4HGQA 1PRYA 2PIDA 3D9QX 5C46F 2I2XB 3EQ8A 2EKBA 2F23A 3MTQA 4MS3B 2HB6A 2Q5ZA 1N9GA 2PMFA 4AN0A 1JYSA 3GEHA 2P4EA 1PJLA 2OWDA 3CPEA 2FP4B 2YEVA 3OPYB 4HB3A 1PNKA 2VKQA 1RC1A 2LQTA 3HCDA 5EN4A 4ASUA 4BBPA 1FS4A 1G21B 2H1CA 3HN7A 3DOOA 4RPJA 4LNUB 5SV2A 2RHMA 2XSZA 5IKXA 4LJRA 4INPA 4Z7QB 1IY9A 1VG9B 5AOVA 3LK6A 1XYVA 3DHYA 4XCVA 2MIIA 4JB3A 2H1RA 2QL5A 4ZALA 1KC8H 3TS1A 4K9LA 1AKVA 1DCMA 3JR7A 5JJJB 1ZXXA 4PLFA 5FUXA 4KR9A 1JEEA 3EDRA 3LV8A 4XJTA 1QB7A 3A4IA 4GZ6A 4FLXA 1TM7E 4OXXA 1NAIA 4X41A 3V2HA 2C9OA 2KW5A 2YY7A 1IONA 3M7IA 5CEEA 1TVEA 4IQ0A 5HUHA 4KL1A 2PZFA 3X1ZA 4WKPA 2AJ8A 1A7KA 1MC5A 2VQEB 2ZYHA 1EX1A 3HMKA 1BDHA 3JVHA 1YZQA 3CWQA 1I32A 3KQNA 2BIFA 3LP5A 2EG5A 1XQ9A 3FVWA 2OV4A 3MJSA 3RRBA 1N6LA 3VX3A 4EJFA 1VKRA 4EG5A 3L9DA 4P6VF 1WZNA 1F23A 1PGPA 3C0KA 4J7KA 3RVBA 1L5RA 4J29A 4BX9A 2M9MA 4C6SA 4DYVA 2FGJA 1G8GA 2GEBA 1SAYA 3K14A 1VGRA 2ZYVX 3A1EA 1E2NA 3PNMA 3I32A 3QLUA 4D6XA 1FSPA 2WF5A 1WDWB 3QG1A 4G24A 2YI8A 2PI4A 1UBLS 3HCCA 2EKPA 2LVBA 5DGIA 1QJCA 2XUFA 3ZZTA 3BH7A 2CNKA 4YLGA 5LMNB 2C4WA 1RM1C 2Q3BA 2AZ0A 5FA8A 4FYIA 4DL9A 2C3MA 5KDLA 5CA1F 5I7EA 2OESA 3HEMA 2YC0A 4BQNA 1M54A 1YUNA 4RC9A 2WUVA 2J9YB 2PUEA 1TW3A 2R68A 5E1BA 4E7OA 3KXDA 2F2TA 4MWZA 3TW4A 4KUEA 2WJHA 3NG1A 4XRGA 1NVXQ 1Q21A 2SICE 2OXCA 2E85A 5EHGA 5IC5A 5TIIA 3TVDA 2VHUA 1JW9B 2YHIB 4LF5B 4N49A 4LC9A 3GT7A 4Q47A 2JKVA 3OO1A 4BUJA 4EHHA 1FDUA 2VJYA 3P19A 1E9BA 1JR3A 1KORA 1RBMA 2IE8A 3P4YA 1JRLA 4OKIA 1W73A 5G0UA 2YHAA 3K2IA 1R6XA 3T8YA 4XI9A 1BW9B 1NGSA 4ZHSA 3AHFA 5L45A 1EU1A 1M2NA 4LQLA 1A5BB 3W5VA 1JQ5A 4LYAA 1AK1A 1YOVB 1GARA 4JSTA 1SBNE 1FIUA 5C93A 3W7XA 3E7FA 2WLJA 2VN8A 2OD9A 3EPPA 3NKLA 4E31A 1ZD4A 3DE3X 4NBLA 1VIMA 3F7VC 3KOOA 4RL6A 2EW2A 5CW2A 3FFAA 4WH0A 4W9NA 5DF1A 4A27A 4EIWA 3KCYA 3LBHA 4ZYVA 3X1WA 3PQ2A 3EPJA 1SD2A 3IT2A 2VTVA 3GFGA 4U02A 3VHXA 2RCYA 3M4XA 5ALIA 2IOFK 2C61A 4N40A 1XSEA 3P9RA 2F67A 3OF3A 2X6CA 4CM6A 3QPDA 2ZIMA 4KAAA 3WQQA 3AM5A 4Q93A 4KR3A 4U9UA 1HM5A 2F9LA 3AJDA 3OD1A 5DTIA 2H5LA 5J3JA 4JI8B 1N2OA 5EYPA 1SELA 3GVPA 4IY1A 3STUA 4MGZR 1RHKA 3OEHA 3L7DA 3BYZA 4DLTA 3LLCA 3RSGA 2RH9B 3K57A 4MT8A 1OV4A 1PS8A 2WHRA 3EK2A 5H4HA 3FBAA 2B92A 2IH4A 4E70A 2DFDA 2VUTA 1YB4A 2UUCO 3F67A 4X9XA 1Q1EA 2W11A 2XMQA 1TGVA 3ISJA 3PCTA 2X41A 3K5IA 1IUOA 1RYNA 4NAVA 3PTAA 5HJ2A 1XZ8A 3QEBZ 4HDMB 5FNZA 4EPYA 1LF0A 2JVDA 1BKYA 4PYJA 1FXKC 1ATIA 1A50B 1HKHA 3QPUA 3LUFA 3IMGA 4LMPA 1LU9A 4RQAA 4URUR 4DMMA 3A14A 4GOXA 3HA7A 5DGTA 2DYRB 1KP3A 3F3MA 1Q83A 3T3HA 1M5TA 3EZ6A 1K8AH 3I9KA 3PIIA 4GPTA 5DK6A 2EBHX 4X5OA 5JDCA 2CW5A 5BQPA 2UYJA 1DOAA 1JHUA 2PH7A 2POCA 3AIIA 1ZLZA 1XQ6A 2HWUA 4G5HA 4G8CA 4DNOA 4O4HA 5EPEA 4Y2JA 3OF2A 3C90A 2WZCA 2WKQA 1D0SA 3KQKA 4PNHA 5KYWA 1XAGA 3AJ9A 2IPNA 3I64A 2ALJA 2NZXA 3JQBC 1Q8RA 3E8BA 5DHTA 5EP4A 2EIKB 2E4XA 2IOYA 1RXSA 2P0AA 1QLJA 3P0JA 4CM7A 4F3KA 3GLKA 1GR0A 3BVOA 1T1RA 1H1TA 1ADGA 2I03A 2GERA 3GUHA 4JIGA 1WAMA 3VVCA 3UVEA 1U0TA 3F0FA 4F84A 2MTBA 5HZKA 1S2DA 1A2BA 1BCSB 1H8HG 2PKCA 2WU1A 3CN7A 2E48A 1JB9A 2UV8A 1XMPA 2HJHA 2VTEA 1FDWA 2QTVA 3BRQA 3GP5A 3JYNA 2IW1A 3LLUA 3TRFA 4BVGA 4WFJA 1IBMB 5JFOA 3G2QA 1JR6A 1CRPA 3ZDBA 1Y4UA 4MEJA 5I5GA 1ZCBA 2QD4A 2X58A 1XNHA 2WZBA 1X6VA 4R8KA 3SYTA 4Q16A 3L9WA 4U2FA 1K9MH 1N33O 3GEEA 4DDWA 4CM9D 3NQ41 3E20B 4PLZA 1WW3A 1JHPA 1KYOF 2IZOA 3CEMA 4PA9A 3QLJA 4P4LA 2CNOA 4DMKA 1GVNB 5M29A 5BSRA 2V8OA 2AZTA 1KI1A 4BIOA 4O4IB 1GRVA 3A6FA 4JP8A 4N9QA 3OESA 2O07A 5I7OA 3P4UA 4L8GA 4Q1CA 4JOCA 2BFPA 2RHDA 3OCJA 4FYYA 4P2BA 3X2EA 3ZCTA 1EFPA 1J90A 2HIGA 2HZBA 4QE3A 4DREA 1UPBA 1VIVA 4NBNA 5KYUB 3OX3A 3WGJA 1NXQA 4ALMA 3ICOA 3H1TA 2RH5A 3USES 2YKGA 3CMAV 1F9AA 5A4DA 1KOLA 1RWWA 4CZZA 2AFHE 1FTQA 2GSDA 3G0BA 1A88A 4OQFA 5CD9A 3Q2KA 4HO1X 2W4IA 3QA3E 2ZB2A 4TL6A 1QKIA 3QEJA 1SC1A 4WJKB 4QJFB 4DLPA 3F49S 1ZXBA 2V45A 1GVHA 1P17A 2P2LA 1QRDA 4ARAA 5FT9A 3NO4A 3JQ9A 3WJ1A 3PWSA 4HWPA 5DM4A 2VSQA 5LQUA 1RFGE 4J03A 1V7ZA 3TUIC 2ZJZA 3JQDA 3DAFA 3TCNA 1Z0DA 2IOQA 4E07A 2HT1A 2BTQA 1RC0A 3PHCA 4C08A 1E2HA 1M1ZA 4JSRA 4O4JF 4AG6A 3LX4A 4EG8A 4LDNA 4LRQA 4MP6A 4KRGA 4PHHA 3WNDA 2BFEB 5KUMA 2I8CA 4I19A 2BI7A 4PCLA 4XJXA 1RLMA 2B3TA 3IESA 3HU5A 3OZ7A 1VIYA 3FXAA 3SXJA 3W5BA 5FWXB 2VZLA 8MHTA 1EZJA 4UHBA 1RM3A 4YJKA 5B1BB 1EWTA 4QUKA 3ZTYA 4BN5A 2XMZA 1KBZA 1ZFNA 3WLNA 1XTQA 5FBHA 4CUZA 2FKAA 2D3TA 2W2VA 3ZD6A 3JALB 4GWKA 4OYHA 1S8OA 4DRYA 1E4EA 4ZOAA 3RWOA 4AKSA 1AIPA 4H7PA 4DIEA 1WB9A 1TDJA 2X1LA 1NRWA 4U2EA 4CVNA 2ENWA 3OZCA 1R8YA 3ZHOA 4E14A 2QRVA 4QZVA 4LQDA 1OAAA 2Q5EA 1AKNA 5EG5A 5FWNA 2HA5A 3QOXA 3R0XA 4OJNA 2NAFA 3HB0A 3D2LA 1JAXA 4QPPA 4OJMX 2JFZA 1E9SA 4NDAA 3U0OA 2VHXA 1V6SA 3GD5A 3SIXA 4CT0A 3KCNA 4R98A 2CJXA 3E4CA 3STZC 1FF9A 2C7OA 1W88A 2DQ0A 3H2GA 5KHLB 4YCAA 4ARIA 3NU1A 3RTCA 2W6IG 5CW1A 3TNYA 1P9RA 1W59A 2Q0OC 1T2UA 3PJSK 3PB3A 5ILQA 3P4EA 1NLYA 4X64O 4NPAA 1OXTA 4YGXB 1IBCA 5EXEA 2GPAA 3ZD9A 4IDCA 1NBME 4P32A 4ZT5A 4A0FA 1G0OA 2NZYA 3M6AA 4B2IA 1VXOA 3RAFC 3VR6D 2QY6A 2H8KA 5B1DA 4BMOB 2C94A 3M81A 4EVQA 1N2EA 1X42A 3CEAA 1SKUA 7REQB 2VOEA 2EF0A 1JPVA 1HH4A 2Z1TA 2Q0HA 1MG1A 3LF1A 3OAAD 3FNIA 4R8LA 4UASA 2AEFA 4EQZA 3E05A 1GCUA 3BMQA 2JANA 4H0CA 3GLIA 2WM2A 1MBZA 1QRSA 3ROTA 3I0ZA 3VNSA 1PFYA 5LDDC 4NE2A 4D6YA 3B70A 1CV2A 2OGZA 1OAPA 5JY1A 3ZWOA 5B3LA 3ZJ4A 5FLXM 3D36A 3WGKA 1D1PA 2CZGA 2WUGA 1N0JA 3NP9A 4M0PA 4G9BA 5DNAA 4WCFC 2O2IA 1K5PA 1KOJA 4FC6A 4IGGA 1JFFA 1WOMA 3QKWA 2CFRA 4NZMA 5TF4A 4ZYZA 3OZXA 1QP4A 2BBSA 2IQ5A 4NESA 4M8LA 4ZQFA 4QOHA 4MMXB 3USCS 4DMCA 3V7QA 2QYTA 2I7VA 4GOKA 4BNTA 3CYFA 4FMTA 2DCMA 4TWRA 2G77B 3LC7O 4UM9D 1PV2A 1EQUA 2B8JA 3TW0A 1BMQA 2FTKA 2EGHA 2HK8A 3O91A 6LDHA 1EFVA 2IBSA 1N57A 4GX0A 4MB2A 3E1KA 1I0HA 2ZSJA 4NCIA 4RABA 4DQXA 2R11A 2XUMA 1QR2A 1ZGBA 2XOKD 3T9FA 4LR3A 1CY8A 2A0YA 1V6AA 2D1SA 4X8MA 5CPBA 2PFGA 3MT8A 3E15A 4MHSA 4YP6A 1E8DA 4DRXB 4HZIA 4OGGA 1IU9A 2BE9A 3P2KA 1Y7HA 1GFWA 3PGVA 3RF7A 5IH7A 1ECCA 5IZCC 1JYEA 4XR9A 1T26A 2IODA 3KWMA 3RVSA 4FWIB 5GONF 2WTBA 2R5NA 4HN2A 1NNEA 3OE7D 1UC5B 3M3HA 3TSOA 4O5OA 3DCNA 3GAZA 4JZYA 4GP9A 1R8QA 4KV7A 3N7TA 2V6GA 3AL3A 1JDUA 3PXUA 4DEXA 4H13B 1LLDA 4WVFA 2H1VA 5AKLA 1QFXA 2Q5HA 5JO9A 4AG5A 1C9MA 4B33A 3W6OA 1RHRA 4MVJA 2YEVB 3RVLA 3OPYA 3Q1KA 1CJSA 5F3DA 4R1NA 4YP5A 4TXMA 2ECKA 5K8CA 1YH3A 3GJ5A 1YI2F 3C3KA 4EY7A 2Y0DA 2IH3C 2QY9A 2A06H 4K0KB 2CSXA 3HE3A 2VT2A 4MQUA 2KB0A 4W7SA 1J20A 3N8GA 3DAYA 1ZAUA 2VDPB 1W85B 2X15A 1RSOA 2ZEJA 3N8DA 3BTUA 1CR0A 2XLCA 2YBDA 3R0VA 4JEMA 4YJFB 3TKLA 5JQGF 4RKWA 3RC9A 3AVUA 2PK3A 5CBGA 1SXJA 4EOGA 4DR3O 1Q2XA 1XALA 2XNKA 1FFDA 4UUPA 3NRCA 5TQ0B 3T41A 4ZGBA 1K4DC 3RU9A 1ZWZA 2OGTA 3DOUA 2GF2A 1AILA 2Y48A 3AB8A 1A2QA 4MLDA 1NJSA 3IC7A 1YWGO 2JGNA 1X1BA 2W6ZA 4NJMA 3LO5A 3ULKA 1H2MA 4RAIA 2ACVA 2BBOA 1KSHA 2WJVA 3GXOA 3BMCA 3U9LA 1I3LA 2PA3A 4G1UC 4GBJA 1D7OA 2CHQA 3B6JA 1NVTA 3KZVA 4X1OA 3HKEB 5JCXA 3WMGA 4MGHA 2HZ7A 3RYIA 2LBXA 1AKUA 1RLIA 3H2IA 1WDMA 4AZ0A 5KNDD 4PA6A 4W1PA 3GROA 3WLHA 1E5QA 4FD3A 5J43A 5B1IA 5K0TA 2QSUA 2BSKA 2KGWA 2RJ3A 3IPRA 6YASA 2B36A 3R0QA 4MW4A 1K7CA 4Q4HB 2Z6AA 4QEDA 1WG8A 2C9DA 1T0BA 2JDIA 1QMPA 4F45A 3JTEA 1NKTA 4P92A 5FWYA 1WXGA 1CUHA 2AIZP 3H9CA 3ZJUA 5KTSA 2IP2A 4P93A 4P22A 2WHXA 1LCIA 4UJ3A 5CNIA 2GH1A 4Q3KA 1U8ZA 4FVTA 2JGDB 1II9A 3MINB 4N03A 1HDEA 4RY9A 4ZQBA 4QARA 3SZLA 2QUIA 3BWDD 1YA8A 4NU6A 3ZKWA 1TUEB 3SF0A 5L40A 4KFCA 2ZR8A 1VBMA 3USZA 2QP9X 4NI5A 5DBFA 3KJZA 2NUBA 1W6UA 2X2EA 3K72B 3OGIB 2UUOA 4BQIA 4UVHA 1ZIYA 5BV8A 3QFSA 1Y8CA 3P2YA 3CCLF 4UKDA 1AMOA 2Y0EA 3QEMB 1L4MA 4BJ3A 5KKNB 1XTVA 1PJCA 3EDMA 1IK4A 4HXYA 4JNCA 4LSWA 3HABA 3NHSA 4R54A 3SSAA 4CLOB 1I0IA 1V5WA 5K3BA 5E4JA 5U4XA 1IWPB 2WHPB 3OE7G 2H8GA 3DEKA 2OEPA 4PG5A 3RDPA 1C3OB 1E2MA 3Q3GE 3CA8A 3VOBA 3E7DA 5EIOA 5CLLA 2VDJA 3MJ4A 3D31A 4RMIA 1DPGA 1KC1A 2VH5R 3EMKA 4UCTA 1WE2A 1W94A 3L92A 1W4BA 4U5XA 5CXUA 1QDUA 4G5GA 1SBQA 1POWA 1HQDA 1PZFA 2FPXA 2KHZA 2Z9BA 2J33A 3GA7A 4L22A 5EIHA 1TU4A 5I45A 1ZVKA 5IN4A 1E9FA 5LBTA 5EBWC 3MWDA 2HWYA 1QQCA 4BDTA 2RMKA 1OPRA 4JGSA 1RZ3A 2YJ4A 2V0CA 4ZPXA 4ALIA 3K70D 1R88A 2ZJAA 1OXKB 1W581 5DSXA 3RSCA 4TQGA 1S3JA 4HRXA 4IIFA 4N9WA 4BBZA 4ZJPA 1SBIA 2XHZA 4AS1A 2Z56A 2OOKA 1GXSB 1FP6A 3MYRA 1QYIA 2QTMA 4LRXA 1O08A 1K06A 1ZNWA 4RS3A 3BWVA 1X0VA 5AQ1A 1HT3A 1G2IA 3MT7A 2RHHA 3E58A 4HHEA 2C95A 4LZLA 1QFZA 2WWXA 1LQTA 1GDTA 5ALYA 3EUWA 4N39A 2M6KA 2IG8A 2O0LA 1PX0A 1Y6JA 5EERA 3JQGA 4IWXA 4LBYA 2I6DA 3CFYA 3I09A 1NYQA 3L8YA 4KP7A 4L73A 3K2BA 4X60A 1M56B 3L7MA 5LOVB 1FUIA 2P1ZA 3A1DA 5HK9A 4CEJB 3AHJA 1S96A 3O21A 2Z1UA 4KQKA 4QLAA 4IMRA 3VR2A 2D8MA 3B1ZA 1CWUA 3IUEA 1F0PA 1M7GA 1MJ5A 1RPAA 3HN2A 3PE6A 4UUMA 3TIXB 1U7XA 2FR1A 3B2EA 4RPHA 4FCVA 1TZMA 1I1OA 3F9IA 3PN1A 1N0VC 4GC9A 4ZZ0A 3NOOA 5T6MA 3HKEA 4ZO6A 5F12A 2V8BA 3ESZA 3KG2A 1KE1A 3MRSA 1IEQA 4Q66C 1HC7A 1GTZA 4BMYA 2O7RA 1NVMB 2GVDC 2XCIA 4QG7A 5T4BA 4DIBA 3KQHA 4WEQA 1DAPA 4NRDA 3BFVA 4RYLA 2VDVE 3TIIA 3ZWKA 5AJZA 2GZDA 3M5WA 3C3MA 3HCPA 4M0EA 3EVTA 3G7NA 3BWCA 1PE0A 3P9CA 2G6BA 1T2FA 4FMPA 3NZEA 3JWIA 2CTWA 2J07A 3JQQA 1L7MA 3CKMA 3M4ZA 4OHCA 3K06A 1YK1A 1IBRA 1SXJB 2QRZA 4N7RA 4Q00A 2ORED 4F04A 1DIOB 1K34A 5B7PA 1OT5A 1V54C 2CE7A 1RSOB 3DGEA 1V8PA 3IOCA 1JLKA 3EVEA 3RCBA 1E9DA 1MVNA 3QTLA 4K9DA 3SX2A 1G1MA 3BFXA 5E8JA 1YS1X 4KW7A 1SK9A 4HDCA 1ILWA 2R62A 2YIMA 4FMDF 5B3SC 5ARDA 4DLWA 1CY0A 4H0NA 1YZLA 5TSDA 2Q5CA 4GZ5A 4NUTA 2PGDA 3SSOA 1AT1A 2I7XA 5LR6A 4JYZA 5EE3A 1ZM2A 3L1KA 1RYHA 2I54A 2GK3A 4MYUA 5LA6A 3AGQA 1E62A 1ODKA 1WS6A 1CK4A 2G9UA 5LQMA 1OBHA 3DM9B 1SPBS 1OTHA 2IYTA 1Y6GA 3E48A 2OENG 1ZKDA 5B66Z 2AHYA 1WDLA 4L74A 1KKCA 1YR8A 1VQ7V 3SMVA 3IUJA 1H2FA 1GQRA 1E1QD 2V4ZA 2OMEA 2UUPA 4BYMA 1CIPA 2AI2A 1T5DX 2HK7A 3FDFA 4B6GA 2QM4A 4CQLA 4WBXC 4LCUC 4U7TB 4I55B 1TVCA 3LI2A 1NVKA 4BY9E 3NDIA 2FSVC 3GG9A 4CLDA 5EINA 2YWHA 4NZZA 2PE5A 2R6CA 3B51X 9ABPA 5A62A 2IS6A 1ZISA 1Y9ZA 3QHQA 3AVWA 5EEHA 4Z1MD 1HG1A 2GNOA 3LHIA 3TTXA 4REOA 2LW7A 4UEQA 3RLFA 1YQXA 4D0GA 1EB8A 1EUDA 1R1DA 3CWZA 5JALA 3SJQC 3LUBA 3EY9A 4ZI5A 5HKKD 2AG8A 3HXPA 5F5XA 1E5VA 5AUNB 3SE7A 3GIWA 1VIDA 5BXZA 1MW9X 4BVRA 2W00A 3L02A 1XNGA 4GO1A 4MGIR 3R5HA 1JG7A 4UHHA 4WN9B 2WOJA 4X6LA 3RARA 4HBZA 1ST2A 3IOEA 1F06A 1IPAA 4R50A 3OPMA 3IEIA 2V5UA 3FFMA 4WLNA 1E6LA 3AHCA 1PR9A 3WJ7A 2JDIG 2HSEA 1UCFA 2QRQA 1MJHA 4QGFA 2XUGA 1JJAA 4V0RA 2PCLA 5BSFA 4HBGA 4IQ8A 1VE1A 5HQ3B 2EP5A 4JXZA 3C3AA 2XUZA 1MX1A 1NR5A 4XYLA 1RQGA 2IPXA 2FW6A 3IPAA 1RM1B 2ADQB 2YR0A 2AG6A 1IHPA 4BVFA 5BR1A 1XC7A 3AI1A 1TADA 2DW4A 1UBKS 1KVTA 1ETUA 4IHJF 5A6SB 4F5DA 4UOZA 1YJXA 3C15C 2QMQA 2XAFA 2AQIA 1SBYA 1V3TA 2G6TA 2V7VA 3GDFA 4K26A 2ZPTX 4PZZA 2YRWA 1A82A 4RK6A 2OBLA 3VJMA 5B55A 4KXRA 1RHJA 2GTHA 4G0PA 4IDPA 2X9GA 2ODEA 1FXHA 5BNFA 5I7VA 1J8FA 1ZZEA 1TM3E 3HLTA 2Z1MA 2IY8A 1BU5A 1D6JA 3N2LA 1U2GC 1ZUQA 4KKVA 2IIPA 3WGUA 5HW0A 3U40A 3ZG6A 2PUSA 2AJDA 1YCDA 4O4JB 1BEUB 1YUMA 3RIEA 3A6EA 2QBYA 2EULA 4JOSA 4E4YA 1ZM7A 5BYJA 2GAJA 3GGCA 3JTMA 4LF4O 3RRZA 1LW7A 3LT0A 4AZ3B 5ALJA 4YPOA 3R0JA 5LQJA 2FK7A 3AP3A 4A0SA 4N5HX 5I7FA 5ADVA 1V11B 1UC4B 2QRVB 1V54B 4TYMA 1JDSA 1DJPA 1UKCA 2GCNA 4IIYA 2Q9LA 1XZQA 2N47A 2Y77A 1Q1ZA 1DHRA 1R8XA 2B21A 3PUIA 3OLQA 4OHXA 4PU0A 1JHMA 5CX1B 1KGSA 4DCGA 3V2IA 1VQMF 5JS8A 1SWWA 2HCRA 3FMOB 2IZ5A 1K9SA 2PX2A 3DZIA 3ANSA 3IH5A 1FFAA 2FHPA 4JYCA 3A11A 3SZ3A 3I1JA 3RK0A 3A9UA 5EQFA 7ADHA 1MOZA 1NNLA 2DHEA 2YIVX 5I9SA 1NH2D 2YHUA 3SDSA 1OCCC 5FB3A 2NVOA 1TCAA 2IYOA 2WHQA 4ML3A 4TV9B 1ZHHA 4ZC8A 1CG6A 3VTIC 3J80N 1I2ZA 1WSAA 5AKIA 4BO7A 2Y92A 4CG2A 1A9TA 1XR3A 4CZ2A 1TUBB 3KHUA 1ISPA 4RESA 3MLAA 3Q9NA 2IQQA 1BFUA 2I2DA 5CU7A 5T3UA 5GZ1A 2Y76A 4JJAA 4G09A 3EXFA 1QQ7A 1MFZA 2XVYA 1PGNA 1XA3A 2BOBC 3DO5A 3GBSA 1PWEA 2PSJA 1VI5A 3MIIA 1ZESA 2Y4OA 2D1YA 4GQBA 4LE0A 1H2LA 3THOA 4NBRA 1MFPA 2X76A 1KY3A 4EEXA 1MQ8B 4ZEVA 4JASA 1V4BA 2GAIA 3LPAA 1NP7A 1W87A 1SVUA 2Q6KA 1EFPB 1EJ0A 4QTXA 3LDEA 3KEOA 4C88A 3CHXA 1W57A 5TMBA 1JA0A 1UAGA 3AUFA 3APOA 5E95A 1FK8A 4RBNA 2MSCB 2GVIA 3ONNA 3PVSA 5BV1A 4Y1RB 4TKUA 2Q6LA 3AK3A 3C16C 3C6MA 3K0AB 1O4VA 1UADA 2Y2VA 3K53A 3FBGA 4J0KA 5BXYA 3EUFA 3M6LA 4JI7O 3VR5D 4BQPA 4NABA 4JI3O 2GLXA 3HZZA 3E1YA 3UG7A 3FGZA 3CCRV 1C7RA 2DBQA 3PNVA 4QG3A 1E7SA 1LRJA 3K0CA 2XXAB 3QVLA 4HXEB 1C7ZA 1JH9A 1VKOA 1M7HA 2OCAA 4M9CA 5BN1A 3THXB 1M5RA 3S44A 2H3EA 3W34A 3DP9A 1RWVA 3ET5A 4TV8A 3H6KA 4Z1MG 1BYUA 4FIPC 1EYZA 3FHOA 3DM5A 3UXEA 2Y0PA 1G2PA 3TK1A 1EVLA 2CDNA 2E5LO 2WZQA 1G5QA 2PZMA 3AESB 3C5VA 3D4IA 2EEPA 4FDAA 4JC0A 1FFXA 2I29A 2D4HA 4F4HA 4QJ4A 5EIBC 1C7QA 2B61A 2UVPA 2XWJI 4BKUA 4ZDKA 2IYAA 3E0XA 3GJQA 4PBSA 4C2BA 1NI8A 4CM8B 1YQNA 3EIHA 3MILA 3IR6A 5CLGA 2PUCA 4MQEA 2Z4SA 4JQZA 1JJVA 3WGNA 1Z4NA 1E77A 3C41J 4TTIA 3R4VA 3EJ6A 4WXPA 2NPFA 1CP3A 1SOMA 3DZFA 1XEFA 4R81A 2DWCA 2XADA 2Q6IA 3EISA 4N8SA 1AV6A 3IEXA 1NVBA 1L6RA 2GT1A 5TQ0A 3BD9A 1KQOA 2OCKA 2QKYA 3VSBA 1NW4A 1PQPA 2X3YA 1PFGA 4EARA 2GEVA 4UV9A 2NAPA 3KLNA 1TJNA 1QFYA 2VDWB 4MWTA 2DJIA 1QHTA 4CEHA 4IR7A 2BKLA 3QFRA 1A2OA 3G2NA 2XVZA 5MHTA 3FOFC 2QX9A 2BZ1A 1KBOA 1U1FA 3SPXA 5HZGA 4KFUA 3ZDFA 3PFWO 4B9AA 2VBGA 3QKTA 4BGEA 2WOOA 3SX4A 3NX4A 1Y6FA 1K7EB 1US8A 9GPBA 3ABKC 2VNAA 4OX9O 1HYEA 3FROA 3FVVA 3BRWA 4H3VA 4LHVA 5J1TB 1QV9A 4BNMA 4D3XA 5KOHA 3WNBA 5JSUA 1UM8A 3O03A 4UNSA 4KPFC 4BMCA 3NTRA 2Q3LA 5GV7A 3C98A 2Y67A 3ZW7A 3K0KA 5L3GA 5EYPB 1BRMA 3EOZA 1NVPD 4MJLA 4B3MB 2LPMA 3KXLA 3N0RA 5BWNA 1DCKA 3AUJB 4ROSA 2FQWA 1ZHOA 3NPMA 4E1VA 3D7LA 3G8DA 3FFWA 2CNBA 3IIIA 4HNTA 1LTKA 1DNPA 1QVGU 1QS0B 2QTBA 3DEIA 3VOTA 3X1KA 4YXWA 1WDKA 3ZDDA 1ZUHA 2J0UA 4WLUA 1O89A 2GD6A 3EXFB 1NYTA 1LI7A 2GKOA 2Q9AA 1K63A 2BP7A 3Q4HA 3LH5A 3UV7A 4R84A 2OIGA 2P78A 5CJJA 3LUJA 5JD5A 2GDJA 3GLUA 4MGYR 1N5RA 1R74A 4AJLA 3T5MA 1TYZA 3C24A 3C2QA 3OU6A 4LJ6A 5KHOC 3O82A 1Y9JA 4UNIA 2JDID 5CVTA 3MCAB 1COZA 2C3PA 2Z57A 5CGQB 4B48A 3M9WA 4P0PB 3SX0A 5EC8A 3ADCA 1OX4B 3U3DA 4A3SA 4PI2A 1QV7A 1RTKA 1P44A 4OL0A 1ZVVA 2ODTX 4BAGA 3JVUA 3TE6A 3KCQA 5JZVA 3MUNA 3FB5C 3R2JA 4LMBA 3FWPA 1ML4A 2J0VA 4F6LA 2BM8A 5HKLA 4YV7A 2MYTA 1UKVY 2CGOA 3FVRA 2OM6A 3W6NA 2H7XA 2QT9A 1W93A 1XDWA 2V7QA 3GHYA 3GJ4A 1GADO 3DXFA 1O8BA 1OWNA 3KKMA 5TT1A 1DP4A 1BQ0A 3O90A 4FLWA 1XL0A 2G7ZA 3WDMA 1M90H 3OIVA 5DMHA 3TI7A 4C4RA 5A2GA 4BO4A 3UT5A 1JJOA 1IY2A 5HRAA 2PXXA 3B20A 3LOPA 4BKOA 3ZDAA 5DSTA 1J5PA 5LXTF 1OOEA 4FPPA 2NO5A 2E5LB 3HNOA 4EMTA 1GY8A 1KO1A 3D4OA 5K0ZA 2IVZA 3OPNA 4HWKA 4B31A 1XUQA 3ROFA 3LUDA 4LEIA 4C87A 3VVMA 1HDYA 4P4GA 1FRQA 1QVGF 4UVDA 1KJIA 1EQ2A 1Z68A 1WMSA 3G4SV 3OOSA 4QYSA 4EGSA 4B3CA 1EFCA 5KQGA 4K6MA 1J39A 1N36O 4GEGA 3CX8A 4IOLA 4POAA 4NVRA 1C1YA 4ASUD 4ZYWA 5FUMA 4YHHO 2Z2YA 5AI6A 4I3GA 2IUFA 1NX6A 2A88A 4JELA 1R3UA 4ZRNA 4UBOA 2J3LA 4UFPA 2B78A 4QGAA 3LWBA 3RBAA 4FEEA 4Z6KA 3KXKA 4S1OA 3NTUA 4TLLB 2GPWA 2F1MA 2ADPA 3KB8A 1KEUA 2RD2A 1N2CE 3KD2A 1TO6A 1JVNA 1U2GA 2Q49A 4HNUA 1T0KB 4LVNA 4U9HS 1Q1NA 4I50F 2HV9A 3O8LA 4P4SB 1NUPA 3HR8A 2OXTA 2QMUA 1CW2B 1RLJA 4PLCA 3OR6C 1MDBA 5FLYA 3TOXA 2F3PA 4ZK2A 2FN4A 2W83A 4U3JB 4GPAA 2RI1A 3RAPR 4ZU6X 3E9DA 4QGBA 3FD8A 3KTOA 4O1MA 3WRXC 1FXUA 2ZBQA 1SIUA 4KMSA 1W4ZA 2F17A 3NWOA 3PNBA 1M93A 3EW7A 2VQFB 5HY2A 1ENPA 4OOEA 1HDXA 1Y5LA 5I4KA 1BGWA 1D0VA 2UVQA 3RSLA 1JT9A 3CPQA 2FP4A 2ID4A 3UATA 1G291 4LI0A 3WA6A 1B2LA 2VWJA 2A0WA 3MCWA 5C8ZA 1SQVH 1IBKB 2IU4A 3IAS6 2J46A 3R23A 5B2ZA 5DDIP 3OQ6A 2B20A 3T7KA 4V2IA 1XMJA 1HMYA 2ZAOA 5CDHA 3W5DA 1ZOOA 4HZUA 4RJJA 2CEKA 2QAGC 4MAMA 4RETA 2NOAA 4BVKA 4NARA 1DO8A 4HX9A 5B7GA 3TW8A 2O2XA 5B4TA 2QR4A 5AM3A 1UBFA 3FLMA 2XQGA 3TFOA 3NR7A 2J3IA 1HZZC 2P67A 1X7WB 1MV5A 3M1AA 4OUKX 2FUKA 1W49A 1EK6A 4BVLA 1D2NA 2AK2A 1DTOA 4GLJA 3T4ZA 3LNCA 4KQXA 1JJ2F 1P5RA 1XJQA 3AESA 4MP8A 4NZNA 2X22A 3HFGA 3MQ2A 1YFLA 3MUFA 3HEAA 4OATA 3CN9A 1DBPA 3P45A 3BBPA 3I04A 4TZTA 1BL8A 1W1WA 3I3SR 3TL2A 4LF4B 2I6QA 1HZJA 2PO7A 3H9EO 1Y66A 5B3KA 2FSIA 5EA2A 1Y4AE 4UVIA 2XMBA 1BCCH 4CM4A 3A0RB 1M6NA 2FFJA 2VWQA 1NS1A 4KRXA 3IQIX 3H1AA 1IZ9A 2OECA 2PQ0A 5JD4A 3RFTA 5DOVA 3K0AA 4TL8A 2GHIA 1KJWA 2G8NA 3JU3A 1CUZA 3OOYA 1NVAA 3BPSA 4EF4A 4WNYA 4GUNA 3KKLA 1YRYE 2WVJA 4B6JA 3KDAA 2QRLA 1C7EA 4DN6A 5CLQA 2F4VB 1SIBE 2X5JO 3DD1A 4FFPA 3SR4A 3TBKA 3R3YA 2OE2A 2XZTA 3IVMA 4UE2A 4UBKA