1YHQF

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yhqF00
2LBWA 3CCEF 3CCUF 1VQ5F 1ZWZA 1Q81H 3CCJF 1M1KH 1YIJF 4NUTA 1Q82H 3CMAF 1X7PA 1X52A 1GO0A 3OBWA 1YITF 3E20B 2KTVA 3J81M 1E7KA 3OBYA 1NMUB 3G6EF 3CC7F 2JNBA 1PXWA 5GINC 2KG4A 1IPAA 1YJ9F 3CCSF 1JJ2F 1XBIA 1YHQF 3HJWC 4X3MA 3HAXD 2FC3A 2OHWA 3CCVF 1YI2F 3AGKA 3N4YA 1VQ8F 1KC8H 1VQNF 2OTJF 4TZZA 5FLXM 2WALA 5GANK 3CC4F 1VQ6F 3V7EA 1W2BF 3NK7A 1VQ9F 5GIPC 2LBXA 3G4SF 5EWRA 3LWRC 3WXMB 1Q7YH 1CN7A 3J80M 1QVFF 3ON1A 1GO1A 1RLGA 1W42A 4X3LA 1KQSF 3I56F 1S72F 3CC2F 3CCRF 1DT9A 1VQOF 5EO3A 5GIOC 5G4UC 2KTUA 3MCAB 5DCVA 1NJIH 2VGMA 3O85A 3LWOC 3CPQA 3RA5A 1GZ0A 2ALEA 1SDSA 1W41A 1VQLF 2BO1A 3VMFB 3CD6F 4BY9D 3NK6A 1VQ7F 5G4VC 3CCMF 1Q86H 3NVIB 1KD1H 3CG6A 3VI6A 3CXCF 3LWQC 3JAMM 1VQ4F 1VQMF 3J7AR 3JCMM 3LWVC 3E1YA 3PLAC 1K9MH 1YJWF 2QA4F 3FFMA 1YJNF 1N8RH 3N4ZA 2OZBA 1QVGF 3SIUA 5IT9M 1VQKF 1VQPF 3IR9A 2AIFA 1K8AH 2HVYD 3CCLF 1X7OA 2QEXF 3CPWF 4LCKA 2VGNA 3G71F 1CK2A 3NVKE 3CCQF 2I6DA 3NMUC 3GYQA 2CZWA 3PAFA 1H7MA 2QI2A 1K73H 3LFOA 3RA6A 3LWPC 3SIVA 5FJ4C 3CMEF 1W3EX 3OW2F 1M90H 3V7QA 4BW0B 1T0KB 3I55F 2OTLF 5A2QM 4C4WC 1W40A 1RA4A 5GAPK
chains in the Genus database with same CATH superfamily
5EIBD 2LBWA 3CCEF 2H6LA 3HKEA 1Q81H 1YIJF 2L26A 2GZLA 5HP7A 4TUYB 2VXYA 1X7PA 2HX0A 1XV2A 3QUWA 1KNKA 4O2AB 2DYYA 4BVTA 1GO0A 4ZHQA 3E20B 1CLIA 2AMTA 3HKBB 1E7KA 3OBYA 4X1KA 3VCZA 5MN5A 2YYEA 2ZOVA 4HNAB 4ZHVA 5BMVB 1PXWA 5GINC 2KG4A 3JASA 3MCQA 4O4HA 4O4JA 3FPIA 4G4VA 4O4LA 3CCVF 4C8IA 3N4YA 2OTJF 3ESJA 5GANK 3V7EA 3Q8HA 1W2BF 1QAHA 1W5EA 2G9IA 3N2GB 4O2AA 1W581 2UYJA 5EWRA 3LWRC 3WXMB 3F0FA 5FNVA 3J80M 4HNAA 5HY1A 1ODEA 3P4EA 1GO1A 5LYJB 3S0WA 5CA0A 3MQWA 4I50A 1KQSF 3CC2F 3WPXA 4C81A 5GIOC 3CYQA 1FFXB 2KTUA 5EAZA 3MCAB 5LXTB 5DCVA 3O85A 3TD4A 4IIJB 3P0ZA 2BO1A 3VMFB 4BVQA 1W5FA 3CCMF 1JD1A 3NVIB 1KD1H 4LNUB 4ZHWA 2CSLA 1VH8A 3CXCF 5HY2A 3HKDA 3JAMM 4R40B 4TV8B 3JCMM 1FFXA 1K9MH 4NQ3A 3IKFA 3N4ZA 2HS0A 4X1IB 5C8YA 5LA6B 5IT9M 3E22B 3IR9A 1K8AH 3C9TA 3F0EA 2HS4A 1SA0A 2B33A 2IQQA 3ZP4A 2VGNA 3RYIB 5HXZA 5IYZA 3DC2A 1JFFB 3LWPC 3VO8A 5LP6A 5IJ9B 3HKCB 4NWOB 2CHTA 4EI8A 2I6RA 3E22A 4YJ3B 3JARA 4BT2A 5ITZA 5CA1B 1ZWZA 3F6MA 2HRUA 1M1KH 3N2KB 3VYSC 1IV2A 3VYUC 2PHNA 3WJPA 3CMAF 4O4IB 1YITF 3VOAA 3JAKB 1W5AA 2VAPA 3C9RA 2BTOA 4C8EA 4PWTA 1U40A 3G6EF 3CC7F 4ZI7B 2JNBA 3IEQA 4BT4A 3B6NA 5J2TB 1U3PA 1IPAA 3CCSF 2DT4A 1XBIA 2Q1XA 1JJ2F 2FC3A 4YJ3A 3AGKA 4DXDA 5CA1A 3BYQA 1VQNF 2Z1TA 3JAWA 3FD6A 1W59A 2VAWA 3RYCB 1VQ6F 4BT7A 5HXUA 1VQ9F 1FNJA 3M4SA 2LBXA 3G4SF 3DDNA 1Q7YH 3HTNA 1R1MA 4TV9B 4ZI7A 5J2TA 2HP0A 5LOVB 3L7QA 5HY4A 4BT6A 1W42A 1OAPA 3I56F 2KGWA 5JCOC 5EO3A 3EORA 5J2UB 5G4UC 2ZAUA 5KMGB 5IJ0B 3VIUA 3UT5B 1NJIH 1KNJA 1H48A 2VGMA 3KE1A 4IHJB 4TUYA 2NMUA 3RA5A 1GZ0A 3ERNA 1W41A 4X1YB 1YGYA 3HKBA 1QU9A 4BY9D 3NK6A 1YQNA 3LMEA 3FBAA 3RYFB 3WJQA 3WGLA 2MQEA 3I7TA 5BMVA 5HY0A 2RHJA 5JH7B 3OONA 2Z1UA 2H8CA 2HQSC 1GX1A 1VQMF 3J7AR 1TVKB 3E1YA 3R0PA 2OTMA 1YJNF 5IJ0A 5EB0A 3UT5A 4IHJA 2HS3A 3N2GA 3SIUA 1VQKF 1OFUA 4BT3A 4X1YA 2F9ZC 3IMPA 3CCLF 3CPWF 1IV3A 2QEXF 4G4WA 1CK2A 2PMPA 3LDTA 5LYJA 3C9UA 3PAFA 3ELCA 5EYPB 5JH7A 3HWUA 4M8IA 1W57A 1FSZA 1TVKA 2UYKA 3SIVA 3CB2A 2RHLA 1W3EX 3VTIC 3I3FA 3QTYA 5JQGB 3JALB 5AVMA 3V7QA 1M90H 4YJ2B 3I55F 5A2QM 3WJRA 5LXTA 4G4YA 4ZOLB 3CCUF 4FFBB 3CCJF 4ZK7A 4IIJA 1X52A 2BTQB 2R6R1 4LNUA 2CWJA 2KTVA 3WGNA 3WPWA 2RHHA 4TV8A 2IAFA 4U3JB 5LP6C 3JATB 1TUBB 1YJ9F 3HJWC 3HAXD 2OHWA 2VAMA 1XHOA 2HRYA 1VQ8F 4X1IA 1KC8H 4ZOLA 2AIZP 2Z01A 4BVRA 5LA6A 2WALA 5HP8A 3CC4F 5MN4A 3NK7A 2ZVYA 3IEWA 2IG8A 5GIPC 3RYIA 1QD9A 2FGYA 4G4ZA 2Z1EA 5B8FA 5GONB 2N48A 1Q8RA 1QVFF 1XRGA 1JFFA 4F6RB 3ON1A 3TD3A 2W8BC 1W55A 4U3JA 1TUBA 2RB9A 3F0GA 3U0OA 3V3TA 4X3LA 3T80A 2P6YA 5IJ9A 3HKCA 3C8LA 1S72F 1DT9A 1H47A 4EB6B 3VOBA 5JVDB 1ONIA 3S0HA 4O2BB 3N2KA 3KHNA 5EB1B 5GONA 4O4IA 4ERHA 3S03A 2GVIA 3D01A 4F6RA 3WGJA 4KWEA 3JAKA 2CHSA 3CD6F 4BT5A 1VQ7F 4ZHQB 1VQVA 1NQ3A 3VI6A 3MBMA 3LWQC 1VQ4F 1IV4A 5JVDA 3PLAC 1U3LA 1JY8A 3D54A 1YJWF 1N8RH 1W5BA 3VYTC 3RYCA 3MDOA 3S06A 2OZBA 4B62A 1QVGF 1DBFA 3M84A 1VQPF 3KJJA 2AIFA 2HVYD 1VHAA 4G4XA 1X7OA 4X20B 2CVLA 4LCKA 4B46A 3G71F 4TV9A 3NVKE 3CCQF 5EIBC 2I6DA 3KIZA 4U39A 2LCAA 3GYQA 1Z5VA 2CZWA 5FNVB 4XCQA 5LOVA 1UI9A 4BVSA 2UYNB 3LFOA 3RA6A 5CA0B 2BTUA 3CMEF 4I50B 2HP3A 3K0TA 4WBNB 4EI9A 5J2UA 1T0KB 4BW0B 5JCOA 2OTLF 1J7HA 5KMGA 1JN1A 1RA4A 5FJ4C 4X20A 3K12A 1VQ5F 3M1XA 1PF5A 1X25A 4E6EA 4NUTA 2Z1FA 1RQ7A 2QTPA 3S0YA 1Q82H 3RYFA 3OBWA 3J81M 5KX5B 2UYNA 1NMUB 3C9SA 2EWCA 3LYBA 5MN6A 4WBNA 1YHQF 4X3MA 2V9YA 3HKDB 1YI2F 1U43A 3GHZA 3K2XA 4B45A 4C82A 5FLXM 4TZZA 3P10A 2LBTA 3F0DA 3JVHA 3KJKA 1RQ2A 4I55B 5C8YB 3TD5A 2RHOA 4DRXB 4EI7A 5CB4B 2CW4A 2GLZA 1SA0B 5KX5A 2ZVZA 1CN7A 5EYPA 5EZYB 1RLGA 5IYZB 1Z5WA 3RE3A 3ZO8A 5JQGA 3JALA 3QHDA 2K1SA 3WGMA 3S02A 4YJ2A 3CCRF 1VQOF 5LP6B 4I55A 4C8GA 4FFBA 2Q1YA 3JARB 4DRXA 5CB4A 1FNKA 5ITZB 2ZODA 3LWOC 3CPQA 4I4TB 2ALEA 1SDSA 4ZHYB 1T0AA 1VQLF 5EZYA 2H8EA 2UZHA 5G4VC 1Q86H 3IKEA 3CG6A 3RYHB 2UYPA 3JATA 2ZF8A 3LWVC 2QA4F 3FFMA 3ZP7A 3D00A 3JAWB 4I4TA 1COMA 4RQOA 3WGKA 4RHAA 3HKEB 1IV1A 3CYPB 3NMUC 3RYHA 1VK3A 1UFYA 1H7MA 5HWEA 3FD5A 3K14A 3V4DA 4X1KB 2HP0B 2QI2A 1K73H 2YXZA 4G88A 4B5CA 3GTZA 3OW2F 1SZQA 4EB6A 2R751 3ZOPA 3JASB 4O4HB 1RLUA 1W40A 4O4JB 4C4WC 4O4LB 4O2BA 5GAPK
chains in the Genus database with same CATH topology
2LBWA 3CCEF 3CCUF 1VQ5F 1ZWZA 1Q81H 3CCJF 1M1KH 1YIJF 4NUTA 1Q82H 3CMAF 1X7PA 1X52A 1GO0A 4BVTA 3OBWA 1YITF 3E20B 2KTVA 3J81M 1E7KA 3OBYA 1NMUB 3G6EF 3CC7F 2JNBA 1PXWA 5GINC 2KG4A 1IPAA 1YJ9F 3CCSF 1JJ2F 1XBIA 1YHQF 3HJWC 4X3MA 3HAXD 2FC3A 2OHWA 3CCVF 1YI2F 3AGKA 3N4YA 1VQ8F 1KC8H 4BVRA 1VQNF 2OTJF 4TZZA 5FLXM 2WALA 5GANK 3CC4F 1VQ6F 3V7EA 1W2BF 3NK7A 5HXUA 1VQ9F 5GIPC 2LBXA 4EI7A 3G4SF 2FGYA 5EWRA 3LWRC 2GLZA 3WXMB 1Q7YH 1CN7A 3J80M 1QVFF 5HY1A 3ON1A 1GO1A 1RLGA 5HY4A 1W42A 3V3TA 4X3LA 1KQSF 3I56F 1S72F 3CC2F 3CCRF 1DT9A 1VQOF 5EO3A 5GIOC 5G4UC 2KTUA 3MCAB 5DCVA 1NJIH 2VGMA 3O85A 3LWOC 3CPQA 3RA5A 1GZ0A 2ALEA 1SDSA 1W41A 1VQLF 2BO1A 3VMFB 4BVQA 3CD6F 4BY9D 3NK6A 1VQ7F 5G4VC 3CCMF 1Q86H 3NVIB 1KD1H 3CG6A 3VI6A 5HY0A 3CXCF 5HY2A 3LWQC 3JAMM 1VQ4F 1VQMF 3J7AR 3JCMM 3LWVC 3E1YA 3PLAC 1K9MH 1YJWF 4NQ3A 3FFMA 2QA4F 1YJNF 1N8RH 3N4ZA 2OZBA 1QVGF 3D00A 3SIUA 5IT9M 1VQKF 1VQPF 3IR9A 2AIFA 1K8AH 2HVYD 2F9ZC 3CCLF 1X7OA 2QEXF 3CPWF 4LCKA 2VGNA 3G71F 1CK2A 3NVKE 3CCQF 2I6DA 5HXZA 3NMUC 3GYQA 2CZWA 3PAFA 4XCQA 1H7MA 5HWEA 2QI2A 4BVSA 1K73H 3LFOA 3RA6A 3LWPC 3SIVA 5FJ4C 3CMEF 1W3EX 3OW2F 4EI9A 4EI8A 3V7QA 4BW0B 1M90H 1T0KB 3I55F 2OTLF 5A2QM 4C4WC 1W40A 1RA4A 5GAPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBW A;  3CCE F;  3CCU F;  1VQ5 F;  1ZWZ A;  1Q81 H;  3CCJ F;  1M1K H;  1YIJ F;  4NUT A;  1Q82 H;  3CMA F;  1X7P A;  1X52 A;  1GO0 A;  3OBW A;  1YIT F;  3E20 B;  2KTV A;  3J81 M;  1E7K A;  3OBY A;  1NMU B;  3G6E F;  3CC7 F;  2JNB A;  1PXW A;  5GIN C;  2KG4 A;  1IPA A;  1YJ9 F;  3CCS F;  1JJ2 F;  1XBI A;  1YHQ F;  3HJW C;  4X3M A;  3HAX D;  2FC3 A;  2OHW A;  3CCV F;  1YI2 F;  3AGK A;  3N4Y A;  1VQ8 F;  1KC8 H;  1VQN F;  2OTJ F;  4TZZ A;  5FLX M;  2WAL A;  5GAN K;  3CC4 F;  1VQ6 F;  3V7E A;  1W2B F;  3NK7 A;  1VQ9 F;  5GIP C;  2LBX A;  3G4S F;  5EWR A;  3LWR C;  3WXM B;  1Q7Y H;  1CN7 A;  3J80 M;  1QVF F;  3ON1 A;  1GO1 A;  1RLG A;  1W42 A;  4X3L A;  1KQS F;  3I56 F;  1S72 F;  3CC2 F;  3CCR F;  1DT9 A;  1VQO F;  5EO3 A;  5GIO C;  5G4U C;  2KTU A;  3MCA B;  5DCV A;  1NJI H;  2VGM A;  3O85 A;  3LWO C;  3CPQ A;  3RA5 A;  1GZ0 A;  2ALE A;  1SDS A;  1W41 A;  1VQL F;  2BO1 A;  3VMF B;  3CD6 F;  4BY9 D;  3NK6 A;  1VQ7 F;  5G4V C;  3CCM F;  1Q86 H;  3NVI B;  1KD1 H;  3CG6 A;  3VI6 A;  3CXC F;  3LWQ C;  3JAM M;  1VQ4 F;  1VQM F;  3J7A R;  3JCM M;  3LWV C;  3E1Y A;  3PLA C;  1K9M H;  1YJW F;  2QA4 F;  3FFM A;  1YJN F;  1N8R H;  3N4Z A;  2OZB A;  1QVG F;  3SIU A;  5IT9 M;  1VQK F;  1VQP F;  3IR9 A;  2AIF A;  1K8A H;  2HVY D;  3CCL F;  1X7O A;  2QEX F;  3CPW F;  4LCK A;  2VGN A;  3G71 F;  1CK2 A;  3NVK E;  3CCQ F;  2I6D A;  3NMU C;  3GYQ A;  2CZW A;  3PAF A;  1H7M A;  2QI2 A;  1K73 H;  3LFO A;  3RA6 A;  3LWP C;  3SIV A;  5FJ4 C;  3CME F;  1W3E X;  3OW2 F;  1M90 H;  3V7Q A;  4BW0 B;  1T0K B;  3I55 F;  2OTL F;  5A2Q M;  4C4W C;  1W40 A;  1RA4 A;  5GAP K; 
#chains in the Genus database with same CATH topology
 5EIB D;  2LBW A;  3CCE F;  2H6L A;  3HKE A;  1Q81 H;  1YIJ F;  2L26 A;  2GZL A;  5HP7 A;  4TUY B;  2VXY A;  1X7P A;  2HX0 A;  1XV2 A;  3QUW A;  1KNK A;  4O2A B;  2DYY A;  4BVT A;  1GO0 A;  4ZHQ A;  3E20 B;  1CLI A;  2AMT A;  3HKB B;  1E7K A;  3OBY A;  4X1K A;  3VCZ A;  5MN5 A;  2YYE A;  2ZOV A;  4HNA B;  4ZHV A;  5BMV B;  1PXW A;  5GIN C;  2KG4 A;  3JAS A;  3MCQ A;  4O4H A;  4O4J A;  3FPI A;  4G4V A;  4O4L A;  3CCV F;  4C8I A;  3N4Y A;  2OTJ F;  3ESJ A;  5GAN K;  3V7E A;  3Q8H A;  1W2B F;  1QAH A;  1W5E A;  2G9I A;  3N2G B;  4O2A A;  1W58 1;  2UYJ A;  5EWR A;  3LWR C;  3WXM B;  3F0F A;  5FNV A;  3J80 M;  4HNA A;  5HY1 A;  1ODE A;  3P4E A;  1GO1 A;  5LYJ B;  3S0W A;  5CA0 A;  3MQW A;  4I50 A;  1KQS F;  3CC2 F;  3WPX A;  4C81 A;  5GIO C;  3CYQ A;  1FFX B;  2KTU A;  5EAZ A;  3MCA B;  5LXT B;  5DCV A;  3O85 A;  3TD4 A;  4IIJ B;  3P0Z A;  2BO1 A;  3VMF B;  4BVQ A;  1W5F A;  3CCM F;  1JD1 A;  3NVI B;  1KD1 H;  4LNU B;  4ZHW A;  2CSL A;  1VH8 A;  3CXC F;  5HY2 A;  3HKD A;  3JAM M;  4R40 B;  4TV8 B;  3JCM M;  1FFX A;  1K9M H;  4NQ3 A;  3IKF A;  3N4Z A;  2HS0 A;  4X1I B;  5C8Y A;  5LA6 B;  5IT9 M;  3E22 B;  3IR9 A;  1K8A H;  3C9T A;  3F0E A;  2HS4 A;  1SA0 A;  2B33 A;  2IQQ A;  3ZP4 A;  2VGN A;  3RYI B;  5HXZ A;  5IYZ A;  3DC2 A;  1JFF B;  3LWP C;  3VO8 A;  5LP6 A;  5IJ9 B;  3HKC B;  4NWO B;  2CHT A;  4EI8 A;  2I6R A;  3E22 A;  4YJ3 B;  3JAR A;  4BT2 A;  5ITZ A;  5CA1 B;  1ZWZ A;  3F6M A;  2HRU A;  1M1K H;  3N2K B;  3VYS C;  1IV2 A;  3VYU C;  2PHN A;  3WJP A;  3CMA F;  4O4I B;  1YIT F;  3VOA A;  3JAK B;  1W5A A;  2VAP A;  3C9R A;  2BTO A;  4C8E A;  4PWT A;  1U40 A;  3G6E F;  3CC7 F;  4ZI7 B;  2JNB A;  3IEQ A;  4BT4 A;  3B6N A;  5J2T B;  1U3P A;  1IPA A;  3CCS F;  2DT4 A;  1XBI A;  2Q1X A;  1JJ2 F;  2FC3 A;  4YJ3 A;  3AGK A;  4DXD A;  5CA1 A;  3BYQ A;  1VQN F;  2Z1T A;  3JAW A;  3FD6 A;  1W59 A;  2VAW A;  3RYC B;  1VQ6 F;  4BT7 A;  5HXU A;  1VQ9 F;  1FNJ A;  3M4S A;  2LBX A;  3G4S F;  3DDN A;  1Q7Y H;  3HTN A;  1R1M A;  4TV9 B;  4ZI7 A;  5J2T A;  2HP0 A;  5LOV B;  3L7Q A;  5HY4 A;  4BT6 A;  1W42 A;  1OAP A;  3I56 F;  2KGW A;  5JCO C;  5EO3 A;  3EOR A;  5J2U B;  5G4U C;  2ZAU A;  5KMG B;  5IJ0 B;  3VIU A;  3UT5 B;  1NJI H;  1KNJ A;  1H48 A;  2VGM A;  3KE1 A;  4IHJ B;  4TUY A;  2NMU A;  3RA5 A;  1GZ0 A;  3ERN A;  1W41 A;  4X1Y B;  1YGY A;  3HKB A;  1QU9 A;  4BY9 D;  3NK6 A;  1YQN A;  3LME A;  3FBA A;  3RYF B;  3WJQ A;  3WGL A;  2MQE A;  3I7T A;  5BMV A;  5HY0 A;  2RHJ A;  5JH7 B;  3OON A;  2Z1U A;  2H8C A;  2HQS C;  1GX1 A;  1VQM F;  3J7A R;  1TVK B;  3E1Y A;  3R0P A;  2OTM A;  1YJN F;  5IJ0 A;  5EB0 A;  3UT5 A;  4IHJ A;  2HS3 A;  3N2G A;  3SIU A;  1VQK F;  1OFU A;  4BT3 A;  4X1Y A;  2F9Z C;  3IMP A;  3CCL F;  3CPW F;  1IV3 A;  2QEX F;  4G4W A;  1CK2 A;  2PMP A;  3LDT A;  5LYJ A;  3C9U A;  3PAF A;  3ELC A;  5EYP B;  5JH7 A;  3HWU A;  4M8I A;  1W57 A;  1FSZ A;  1TVK A;  2UYK A;  3SIV A;  3CB2 A;  2RHL A;  1W3E X;  3VTI C;  3I3F A;  3QTY A;  5JQG B;  3JAL B;  5AVM A;  3V7Q A;  1M90 H;  4YJ2 B;  3I55 F;  5A2Q M;  3WJR A;  5LXT A;  4G4Y A;  4ZOL B;  3CCU F;  4FFB B;  3CCJ F;  4ZK7 A;  4IIJ A;  1X52 A;  2BTQ B;  2R6R 1;  4LNU A;  2CWJ A;  2KTV A;  3WGN A;  3WPW A;  2RHH A;  4TV8 A;  2IAF A;  4U3J B;  5LP6 C;  3JAT B;  1TUB B;  1YJ9 F;  3HJW C;  3HAX D;  2OHW A;  2VAM A;  1XHO A;  2HRY A;  1VQ8 F;  4X1I A;  1KC8 H;  4ZOL A;  2AIZ P;  2Z01 A;  4BVR A;  5LA6 A;  2WAL A;  5HP8 A;  3CC4 F;  5MN4 A;  3NK7 A;  2ZVY A;  3IEW A;  2IG8 A;  5GIP C;  3RYI A;  1QD9 A;  2FGY A;  4G4Z A;  2Z1E A;  5B8F A;  5GON B;  2N48 A;  1Q8R A;  1QVF F;  1XRG A;  1JFF A;  4F6R B;  3ON1 A;  3TD3 A;  2W8B C;  1W55 A;  4U3J A;  1TUB A;  2RB9 A;  3F0G A;  3U0O A;  3V3T A;  4X3L A;  3T80 A;  2P6Y A;  5IJ9 A;  3HKC A;  3C8L A;  1S72 F;  1DT9 A;  1H47 A;  4EB6 B;  3VOB A;  5JVD B;  1ONI A;  3S0H A;  4O2B B;  3N2K A;  3KHN A;  5EB1 B;  5GON A;  4O4I A;  4ERH A;  3S03 A;  2GVI A;  3D01 A;  4F6R A;  3WGJ A;  4KWE A;  3JAK A;  2CHS A;  3CD6 F;  4BT5 A;  1VQ7 F;  4ZHQ B;  1VQV A;  1NQ3 A;  3VI6 A;  3MBM A;  3LWQ C;  1VQ4 F;  1IV4 A;  5JVD A;  3PLA C;  1U3L A;  1JY8 A;  3D54 A;  1YJW F;  1N8R H;  1W5B A;  3VYT C;  3RYC A;  3MDO A;  3S06 A;  2OZB A;  4B62 A;  1QVG F;  1DBF A;  3M84 A;  1VQP F;  3KJJ A;  2AIF A;  2HVY D;  1VHA A;  4G4X A;  1X7O A;  4X20 B;  2CVL A;  4LCK A;  4B46 A;  3G71 F;  4TV9 A;  3NVK E;  3CCQ F;  5EIB C;  2I6D A;  3KIZ A;  4U39 A;  2LCA A;  3GYQ A;  1Z5V A;  2CZW A;  5FNV B;  4XCQ A;  5LOV A;  1UI9 A;  4BVS A;  2UYN B;  3LFO A;  3RA6 A;  5CA0 B;  2BTU A;  3CME F;  4I50 B;  2HP3 A;  3K0T A;  4WBN B;  4EI9 A;  5J2U A;  1T0K B;  4BW0 B;  5JCO A;  2OTL F;  1J7H A;  5KMG A;  1JN1 A;  1RA4 A;  5FJ4 C;  4X20 A;  3K12 A;  1VQ5 F;  3M1X A;  1PF5 A;  1X25 A;  4E6E A;  4NUT A;  2Z1F A;  1RQ7 A;  2QTP A;  3S0Y A;  1Q82 H;  3RYF A;  3OBW A;  3J81 M;  5KX5 B;  2UYN A;  1NMU B;  3C9S A;  2EWC A;  3LYB A;  5MN6 A;  4WBN A;  1YHQ F;  4X3M A;  2V9Y A;  3HKD B;  1YI2 F;  1U43 A;  3GHZ A;  3K2X A;  4B45 A;  4C82 A;  5FLX M;  4TZZ A;  3P10 A;  2LBT A;  3F0D A;  3JVH A;  3KJK A;  1RQ2 A;  4I55 B;  5C8Y B;  3TD5 A;  2RHO A;  4DRX B;  4EI7 A;  5CB4 B;  2CW4 A;  2GLZ A;  1SA0 B;  5KX5 A;  2ZVZ A;  1CN7 A;  5EYP A;  5EZY B;  1RLG A;  5IYZ B;  1Z5W A;  3RE3 A;  3ZO8 A;  5JQG A;  3JAL A;  3QHD A;  2K1S A;  3WGM A;  3S02 A;  4YJ2 A;  3CCR F;  1VQO F;  5LP6 B;  4I55 A;  4C8G A;  4FFB A;  2Q1Y A;  3JAR B;  4DRX A;  5CB4 A;  1FNK A;  5ITZ B;  2ZOD A;  3LWO C;  3CPQ A;  4I4T B;  2ALE A;  1SDS A;  4ZHY B;  1T0A A;  1VQL F;  5EZY A;  2H8E A;  2UZH A;  5G4V C;  1Q86 H;  3IKE A;  3CG6 A;  3RYH B;  2UYP A;  3JAT A;  2ZF8 A;  3LWV C;  2QA4 F;  3FFM A;  3ZP7 A;  3D00 A;  3JAW B;  4I4T A;  1COM A;  4RQO A;  3WGK A;  4RHA A;  3HKE B;  1IV1 A;  3CYP B;  3NMU C;  3RYH A;  1VK3 A;  1UFY A;  1H7M A;  5HWE A;  3FD5 A;  3K14 A;  3V4D A;  4X1K B;  2HP0 B;  2QI2 A;  1K73 H;  2YXZ A;  4G88 A;  4B5C A;  3GTZ A;  3OW2 F;  1SZQ A;  4EB6 A;  2R75 1;  3ZOP A;  3JAS B;  4O4H B;  1RLU A;  1W40 A;  4O4J B;  4C4W C;  4O4L B;  4O2B A;  5GAP K; 
#chains in the Genus database with same CATH homology
 2LBW A;  3CCE F;  3CCU F;  1VQ5 F;  1ZWZ A;  1Q81 H;  3CCJ F;  1M1K H;  1YIJ F;  4NUT A;  1Q82 H;  3CMA F;  1X7P A;  1X52 A;  1GO0 A;  4BVT A;  3OBW A;  1YIT F;  3E20 B;  2KTV A;  3J81 M;  1E7K A;  3OBY A;  1NMU B;  3G6E F;  3CC7 F;  2JNB A;  1PXW A;  5GIN C;  2KG4 A;  1IPA A;  1YJ9 F;  3CCS F;  1JJ2 F;  1XBI A;  1YHQ F;  3HJW C;  4X3M A;  3HAX D;  2FC3 A;  2OHW A;  3CCV F;  1YI2 F;  3AGK A;  3N4Y A;  1VQ8 F;  1KC8 H;  4BVR A;  1VQN F;  2OTJ F;  4TZZ A;  5FLX M;  2WAL A;  5GAN K;  3CC4 F;  1VQ6 F;  3V7E A;  1W2B F;  3NK7 A;  5HXU A;  1VQ9 F;  5GIP C;  2LBX A;  4EI7 A;  3G4S F;  2FGY A;  5EWR A;  3LWR C;  2GLZ A;  3WXM B;  1Q7Y H;  1CN7 A;  3J80 M;  1QVF F;  5HY1 A;  3ON1 A;  1GO1 A;  1RLG A;  5HY4 A;  1W42 A;  3V3T A;  4X3L A;  1KQS F;  3I56 F;  1S72 F;  3CC2 F;  3CCR F;  1DT9 A;  1VQO F;  5EO3 A;  5GIO C;  5G4U C;  2KTU A;  3MCA B;  5DCV A;  1NJI H;  2VGM A;  3O85 A;  3LWO C;  3CPQ A;  3RA5 A;  1GZ0 A;  2ALE A;  1SDS A;  1W41 A;  1VQL F;  2BO1 A;  3VMF B;  4BVQ A;  3CD6 F;  4BY9 D;  3NK6 A;  1VQ7 F;  5G4V C;  3CCM F;  1Q86 H;  3NVI B;  1KD1 H;  3CG6 A;  3VI6 A;  5HY0 A;  3CXC F;  5HY2 A;  3LWQ C;  3JAM M;  1VQ4 F;  1VQM F;  3J7A R;  3JCM M;  3LWV C;  3E1Y A;  3PLA C;  1K9M H;  1YJW F;  4NQ3 A;  3FFM A;  2QA4 F;  1YJN F;  1N8R H;  3N4Z A;  2OZB A;  1QVG F;  3D00 A;  3SIU A;  5IT9 M;  1VQK F;  1VQP F;  3IR9 A;  2AIF A;  1K8A H;  2HVY D;  2F9Z C;  3CCL F;  1X7O A;  2QEX F;  3CPW F;  4LCK A;  2VGN A;  3G71 F;  1CK2 A;  3NVK E;  3CCQ F;  2I6D A;  5HXZ A;  3NMU C;  3GYQ A;  2CZW A;  3PAF A;  4XCQ A;  1H7M A;  5HWE A;  2QI2 A;  4BVS A;  1K73 H;  3LFO A;  3RA6 A;  3LWP C;  3SIV A;  5FJ4 C;  3CME F;  1W3E X;  3OW2 F;  4EI9 A;  4EI8 A;  3V7Q A;  4BW0 B;  1M90 H;  1T0K B;  3I55 F;  2OTL F;  5A2Q M;  4C4W C;  1W40 A;  1RA4 A;  5GAP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...