1YHQF

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yhqF00
1YHQF 3V7QA 2CZWA 5GANK 2BO1A 1VQPF 1QVFF 3ON1A 1W40A 3E20B 3SIVA 2KTUA 3LWRC 3AGKA 3OBWA 3CMAF 1VQMF 2VGNA 5GIPC 5FJ4C 1VQ7F 2KG4A 5FLXM 3J80M 3HAXD 1Q81H 1E7KA 1W42A 2QEXF 4BW0B 1T0KB 3VMFB 2OTJF 3IR9A 5G4VC 3SIUA 1DT9A 3LWQC 2QA4F 3CCVF 1KQSF 3CCSF 3PLAC 1H7MA 5DCVA 2I6DA 3LFOA 2OTLF 3V7EA 3G4SF 4LCKA 3NK6A 1Q7YH 1CK2A 1ZWZA 2FC3A 1VQ8F 5A2QM 3MCAB 3CCEF 3RA5A 3I55F 1Q82H 3CXCF 5EWRA 3CCLF 3OBYA 3CMEF 1NMUB 5IT9M 2OHWA 5GINC 2WALA 1K8AH 1JJ2F 3CCMF 3NVIB 4C4WC 3N4ZA 1VQ5F 1KC8H 5GAPK 3CG6A 1QVGF 3JCMM 4X3LA 3CC7F 1W2BF 4NUTA 1K9MH 1IPAA 1VQLF 3LWVC 2QI2A 2AIFA 3CD6F 3N4YA 3CC4F 1VQNF 1YJNF 1CN7A 3HJWC 1XBIA 1W3EX 3FFMA 3CPQA 5EO3A 1SDSA 1M1KH 3CCRF 3E1YA 1YJWF 3NK7A 1VQKF 2LBWA 5G4UC 3LWPC 1W41A 5GIOC 3NMUC 1YJ9F 1YITF 3G6EF 3G71F 2ALEA 2JNBA 2VGMA 4X3MA 3J7AR 1X7OA 1VQ4F 1RLGA 3CPWF 4BY9D 2LBXA 1NJIH 1RA4A 1M90H 2OZBA 1GZ0A 1K73H 3PAFA 1PXWA 3NVKE 3OW2F 1N8RH 1YI2F 1GO0A 3VI6A 3WXMB 3CCJF 1VQ9F 3CC2F 1S72F 3LWOC 3CCQF 2KTVA 2HVYD 3CCUF 1GO1A 3JAMM 3RA6A 1KD1H 3J81M 1VQOF 3GYQA 1YIJF 1X52A 3I56F 3O85A 1Q86H 1X7PA 1VQ6F 4TZZA
chains in the Genus database with same CATH superfamily
1YHQF 1QVFF 1W40A 3SIVA 2ZOVA 4LNUB 3TD4A 3OBWA 3E22B 3F6MA 3J80M 3HAXD 5EIBD 3QTYA 3VYUC 1E7KA 1W42A 2Z01A 3VYSC 4B5CA 1T0KB 3ERNA 4DRXB 5EZYB 2Z1UA 5ITZA 1U3PA 3KJKA 3LWQC 4BT7A 2LCAA 3CCSF 3PLAC 3DDNA 3LFOA 3S06A 1FNJA 1CK2A 1ZWZA 2FC3A 4B45A 4X20B 4ZK7A 5FNVA 4WBNA 2ZF8A 4HNAB 3L7QA 3HKCA 4ZI7B 2CVLA 3OBYA 5JH7B 5LP6C 2OHWA 5JVDB 4ZHYB 2K1SA 2LBTA 3FPIA 4C8EA 4G4YA 5IJ9A 5IYZB 1QVGF 4X3LA 3MDOA 4NUTA 4TUYA 3IEQA 4X1IB 4C81A 4G4XA 2OTMA 1VQLF 1JFFB 2AIFA 3JALA 4O4LA 5KMGB 4PWTA 1VQNF 1YJNF 1CN7A 4G4WA 3HJWC 3N2GB 4X1YB 4I55A 1FFXA 5EYPB 2VXYA 5HY2A 1VQKF 3LWPC 1J7HA 2HX0A 3Q8HA 2HP3A 5C8YA 4U3JA 3OONA 4YJ3B 1GX1A 1H47A 3ZOPA 3TD5A 1X7OA 3WGKA 1RLGA 5MN5A 3K0TA 3VYTC 2LBXA 1TVKB 1RLUA 1GZ0A 1PXWA 3OW2F 3HKDA 1W5EA 2ZVYA 5BMVB 3C9UA 2NMUA 5J2UA 3JATA 4TV9B 2HVYD 4ERHA 1KD1H 5JQGA 4IHJB 5KX5B 3U0OA 4O4JB 2HRUA 3GTZA 5JCOA 5LXTB 3C9RA 5HY0A 3MBMA 2IQQA 5GANK 3FD5A 1VQPF 2ZAUA 2KTUA 3JAKA 2PHNA 5HXZA 3F0EA 4I4TB 3AGKA 4BT4A 3ELCA 2Z1TA 4O4IA 5FJ4C 3RYFA 5CA1B 2DT4A 4R40B 1IV1A 5HP8A 4BT5A 2V9YA 4BT6A 2VAPA 4BVSA 3VMFB 2FGYA 3RYIA 5G4VC 2R751 1OFUA 5MN6A 2GVIA 5DCVA 5GONB 4EB6B 3G4SF 2H6LA 5HP7A 4LCKA 5IJ0B 1U3LA 3UT5B 1W59A 3DC2A 3QUWA 4U39A 3I55F 3D01A 3RYCB 5EWRA 4O2AA 3JARA 5EB0A 4G4VA 3B6NA 4ZHQB 4BT2A 5EB1B 1NMUB 1NQ3A 5GINC 1JJ2F 2ZVZA 3NVIB 4C4WC 3E22A 3HKBA 1TUBA 3JVHA 2HQSC 3IEWA 4EI9A 3JCMM 3VIUA 2RHOA 2B33A 3JASA 5CA0A 2P6YA 1IPAA 1PF5A 3WGLA 3LWVC 1VQVA 4O2BA 3KHNA 4EI8A 2GZLA 3N4YA 3VCZA 3CC4F 1R1MA 4YJ2A 1XBIA 2HRYA 1W3EX 3FFMA 5ITZB 4I50A 5EO3A 2QTPA 3E1YA 2RHLA 3N2KB 3P10A 4TV8A 5HY1A 1FSZA 3D54A 5CB4B 1YJ9F 1X25A 4HNAA 2VAMA 2ALEA 2JNBA 5FNVB 3J7AR 4WBNB 1VQ4F 2YXZA 3CPWF 3P4EA 4BY9D 2HP0A 3HKCB 3C9SA 1RA4A 2OZBA 1VK3A 3I3FA 3QHDA 2W8BC 1N8RH 1GO0A 5EAZA 1QD9A 1VQ9F 3K14A 5B8FA 3CC2F 4G88A 5LOVB 4X1KB 3ZO8A 1JFFA 3MQWA 3EORA 2KTVA 2RB9A 4TUYB 3C8LA 2UYNA 3CCUF 1GO1A 3RA6A 3J81M 5HXUA 1X52A 3I56F 3S0WA 1KNJA 2KGWA 3O85A 2N48A 1IV2A 4C8IA 4I55B 3CYPB 2DYYA 1X7PA 3C9TA 2CZWA 4YJ3A 2BO1A 3M4SA 3GHZA 3LWRC 5C8YB 3KIZA 4O4HA 4U3JB 3CMAF 4FFBA 3RYHA 2IG8A 3JAWA 2KG4A 5FLXM 4BVQA 1Q81H 1CLIA 4F6RA 2QEXF 2UZHA 4BW0B 3IR9A 1RQ2A 3CCVF 3ZP4A 4ZOLA 2H8CA 1H7MA 2I6DA 1U40A 4IIJA 4RQOA 4XCQA 3V7EA 1QAHA 2CW4A 5J2UB 3JATB 4C82A 4IHJA 1W57A 4BT3A 2HS4A 2I6RA 1W55A 5A2QM 2UYKA 3MCAB 5JQGB 3CCEF 3RA5A 3RE3A 1Q82H 3HKEB 3FD6A 4DXDA 3CCLF 2BTUA 3CMEF 2WALA 1K8AH 4I4TA 3CCMF 2HS3A 5J2TA 3HTNA 1KC8H 3V3TA 3JAKB 3CC7F 1T0AA 1YGYA 4BVTA 1K9MH 1SA0A 5AVMA 1ODEA 3RYFB 2RHJA 1VHAA 3S03A 2QI2A 2AMTA 2F9ZC 5LP6A 5HWEA 3CD6F 2Z1FA 2CHTA 1W5FA 5LYJA 3RYIB 3F0GA 2Q1XA 1SDSA 3WPWA 5LA6B 3T80A 3F0DA 1UI9A 2YYEA 1FNKA 1W41A 3WJRA 4LNUA 3RYCA 3G71F 1W5AA 3HWUA 4O2AB 3JARB 3WGJA 4B46A 1NJIH 4DRXA 4C8GA 1K73H 3PAFA 5EZYA 3NVKE 4ZHWA 1YI2F 3WXMB 4ZHVA 1U43A 3HKBB 1TUBB 1YQNA 3LWOC 5JCOC 1UFYA 3MCQA 1XRGA 3JASB 5CA0B 2CWJA 3JAMM 4X20A 2IAFA 4O2BB 1VQOF 3VOAA 3GYQA 1QU9A 4YJ2B 2UYJA 4ZI7A 3N2KA 3VOBA 5JH7A 1Q86H 4KWEA 4I50B 5CB4A 3FBAA 1VQ6F 1JY8A 4G4ZA 5JVDA 3V7QA 4TV8B 3LYBA 3ON1A 3E20B 3ESJA 5IYZA 2PMPA 2L26A 3WGMA 2GLZA 1VQMF 2G9IA 4X1IA 2VGNA 3K2XA 5GIPC 5IJ9B 1VQ7F 2HP0B 5KMGA 3CB2A 1IV4A 1W581 3BYQA 2OTJF 3N2GA 4X1YA 5LOVA 3JALB 4O4LB 4X1KA 3SIUA 1DT9A 2QA4F 1KQSF 2AIZP 5EYPA 1JN1A 2EWCA 2CHSA 2Z1EA 2ZODA 2OTLF 3IMPA 3S0HA 1FFXB 3NK6A 2UYNB 1Q7YH 2CSLA 3ZP7A 1XHOA 3VTIC 3F0FA 3WJQA 3S0YA 1VQ8F 1SZQA 1Z5VA 3CXCF 1XV2A 2HS0A 2BTQB 1OAPA 3K12A 1RQ7A 1TVKA 3KJJA 5IT9M 3LDTA 1W5BA 3N4ZA 1VQ5F 5BMVA 5GAPK 5EIBC 3CG6A 2BTOA 3HKDB 4O4HB 4TV9A 1IV3A 1W2BF 4FFBB 3RYHB 3JAWB 1H48A 1COMA 4F6RB 2Q1YA 2UYPA 5KX5A 2RHHA 2MQEA 3D00A 3V4DA 4O4JA 3CPQA 3WGNA 5LXTA 1M1KH 3CCRF 1YJWF 3NK7A 4ZOLB 2LBWA 4IIJB 5G4UC 2H8EA 5GIOC 3NMUC 5MN4A 1YITF 3WPXA 3HKEA 3G6EF 3CYQA 4M8IA 4X3MA 1ONIA 2VGMA 1KNKA 5CA1A 3LMEA 4O4IB 1VH8A 1M90H 4NQ3A 3KE1A 3M1XA 4NWOB 3I7TA 3VI6A 5J2TB 1Z5WA 3CCJF 5GONA 2VAWA 3WJPA 1S72F 4E6EA 4BVRA 4EB6A 3S02A 3CCQF 3VO8A 1SA0B 3R0PA 5IJ0A 3UT5A 4EI7A 1Q8RA 3IKEA 3M84A 5LP6B 3IKFA 2R6R1 3TD3A 5HY4A 1YIJF 4RHAA 5LA6A 1JD1A 5LYJB 3P0ZA 4ZHQA 1DBFA 4B62A 4TZZA
chains in the Genus database with same CATH topology
1YHQF 5HY0A 3V7QA 2CZWA 5GANK 2BO1A 1VQPF 1QVFF 3ON1A 1W40A 3E20B 3SIVA 2KTUA 3LWRC 5HXZA 2GLZA 3AGKA 3OBWA 3CMAF 1VQMF 2VGNA 5GIPC 5FJ4C 1VQ7F 2KG4A 5FLXM 3J80M 4BVQA 3HAXD 1Q81H 1E7KA 1W42A 4BVSA 2QEXF 4BW0B 1T0KB 3VMFB 2OTJF 2FGYA 3IR9A 5G4VC 3SIUA 1DT9A 3LWQC 2QA4F 3CCVF 1KQSF 3CCSF 3PLAC 1H7MA 5DCVA 2I6DA 3LFOA 4XCQA 2OTLF 3V7EA 3G4SF 4LCKA 3NK6A 1Q7YH 1CK2A 1ZWZA 2FC3A 1VQ8F 5A2QM 3MCAB 3CCEF 3RA5A 3I55F 1Q82H 3CXCF 5EWRA 3CCLF 3OBYA 3CMEF 1NMUB 5IT9M 2OHWA 5GINC 2WALA 1K8AH 1JJ2F 3CCMF 3NVIB 4C4WC 3N4ZA 1VQ5F 4EI9A 1KC8H 3V3TA 5GAPK 3CG6A 1QVGF 3JCMM 4X3LA 3CC7F 1W2BF 4BVTA 4NUTA 1K9MH 1IPAA 1VQLF 3LWVC 2QI2A 2F9ZC 2AIFA 4EI8A 5HWEA 3CD6F 3N4YA 3CC4F 1VQNF 1YJNF 1CN7A 3D00A 3HJWC 1XBIA 1W3EX 3FFMA 3CPQA 5EO3A 1SDSA 1M1KH 3CCRF 3E1YA 5HY2A 3NK7A 1YJWF 1VQKF 2LBWA 5G4UC 5HY1A 3LWPC 1W41A 5GIOC 3NMUC 1YJ9F 1YITF 3G6EF 3G71F 2ALEA 2JNBA 2VGMA 4X3MA 3J7AR 1X7OA 1VQ4F 1RLGA 3CPWF 4BY9D 2LBXA 1NJIH 1RA4A 1M90H 2OZBA 1GZ0A 1K73H 3PAFA 4NQ3A 1PXWA 3NVKE 3OW2F 1N8RH 1YI2F 1GO0A 3VI6A 3WXMB 3CCJF 1VQ9F 3CC2F 1S72F 4BVRA 3LWOC 3CCQF 2KTVA 2HVYD 3CCUF 1GO1A 4EI7A 3JAMM 3RA6A 1KD1H 3J81M 5HXUA 1VQOF 3GYQA 5HY4A 1YIJF 1X52A 3I56F 3O85A 1Q86H 1X7PA 1VQ6F 4TZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ F;  3V7Q A;  2CZW A;  5GAN K;  2BO1 A;  1VQP F;  1QVF F;  3ON1 A;  1W40 A;  3E20 B;  3SIV A;  2KTU A;  3LWR C;  3AGK A;  3OBW A;  3CMA F;  1VQM F;  2VGN A;  5GIP C;  5FJ4 C;  1VQ7 F;  2KG4 A;  5FLX M;  3J80 M;  3HAX D;  1Q81 H;  1E7K A;  1W42 A;  2QEX F;  4BW0 B;  1T0K B;  3VMF B;  2OTJ F;  3IR9 A;  5G4V C;  3SIU A;  1DT9 A;  3LWQ C;  2QA4 F;  3CCV F;  1KQS F;  3CCS F;  3PLA C;  1H7M A;  5DCV A;  2I6D A;  3LFO A;  2OTL F;  3V7E A;  3G4S F;  4LCK A;  3NK6 A;  1Q7Y H;  1CK2 A;  1ZWZ A;  2FC3 A;  1VQ8 F;  5A2Q M;  3MCA B;  3CCE F;  3RA5 A;  3I55 F;  1Q82 H;  3CXC F;  5EWR A;  3CCL F;  3OBY A;  3CME F;  1NMU B;  5IT9 M;  2OHW A;  5GIN C;  2WAL A;  1K8A H;  1JJ2 F;  3CCM F;  3NVI B;  4C4W C;  3N4Z A;  1VQ5 F;  1KC8 H;  5GAP K;  3CG6 A;  1QVG F;  3JCM M;  4X3L A;  3CC7 F;  1W2B F;  4NUT A;  1K9M H;  1IPA A;  1VQL F;  3LWV C;  2QI2 A;  2AIF A;  3CD6 F;  3N4Y A;  3CC4 F;  1VQN F;  1YJN F;  1CN7 A;  3HJW C;  1XBI A;  1W3E X;  3FFM A;  3CPQ A;  5EO3 A;  1SDS A;  1M1K H;  3CCR F;  3E1Y A;  1YJW F;  3NK7 A;  1VQK F;  2LBW A;  5G4U C;  3LWP C;  1W41 A;  5GIO C;  3NMU C;  1YJ9 F;  1YIT F;  3G6E F;  3G71 F;  2ALE A;  2JNB A;  2VGM A;  4X3M A;  3J7A R;  1X7O A;  1VQ4 F;  1RLG A;  3CPW F;  4BY9 D;  2LBX A;  1NJI H;  1RA4 A;  1M90 H;  2OZB A;  1GZ0 A;  1K73 H;  3PAF A;  1PXW A;  3NVK E;  3OW2 F;  1N8R H;  1YI2 F;  1GO0 A;  3VI6 A;  3WXM B;  3CCJ F;  1VQ9 F;  3CC2 F;  1S72 F;  3LWO C;  3CCQ F;  2KTV A;  2HVY D;  3CCU F;  1GO1 A;  3JAM M;  3RA6 A;  1KD1 H;  3J81 M;  1VQO F;  3GYQ A;  1YIJ F;  1X52 A;  3I56 F;  3O85 A;  1Q86 H;  1X7P A;  1VQ6 F;  4TZZ A; 
#chains in the Genus database with same CATH topology
 1YHQ F;  1QVF F;  1W40 A;  3SIV A;  2ZOV A;  4LNU B;  3TD4 A;  3OBW A;  3E22 B;  3F6M A;  3J80 M;  3HAX D;  5EIB D;  3QTY A;  3VYU C;  1E7K A;  1W42 A;  2Z01 A;  3VYS C;  4B5C A;  1T0K B;  3ERN A;  4DRX B;  5EZY B;  2Z1U A;  5ITZ A;  1U3P A;  3KJK A;  3LWQ C;  4BT7 A;  2LCA A;  3CCS F;  3PLA C;  3DDN A;  3LFO A;  3S06 A;  1FNJ A;  1CK2 A;  1ZWZ A;  2FC3 A;  4B45 A;  4X20 B;  4ZK7 A;  5FNV A;  4WBN A;  2ZF8 A;  4HNA B;  3L7Q A;  3HKC A;  4ZI7 B;  2CVL A;  3OBY A;  5JH7 B;  5LP6 C;  2OHW A;  5JVD B;  4ZHY B;  2K1S A;  2LBT A;  3FPI A;  4C8E A;  4G4Y A;  5IJ9 A;  5IYZ B;  1QVG F;  4X3L A;  3MDO A;  4NUT A;  4TUY A;  3IEQ A;  4X1I B;  4C81 A;  4G4X A;  2OTM A;  1VQL F;  1JFF B;  2AIF A;  3JAL A;  4O4L A;  5KMG B;  4PWT A;  1VQN F;  1YJN F;  1CN7 A;  4G4W A;  3HJW C;  3N2G B;  4X1Y B;  4I55 A;  1FFX A;  5EYP B;  2VXY A;  5HY2 A;  1VQK F;  3LWP C;  1J7H A;  2HX0 A;  3Q8H A;  2HP3 A;  5C8Y A;  4U3J A;  3OON A;  4YJ3 B;  1GX1 A;  1H47 A;  3ZOP A;  3TD5 A;  1X7O A;  3WGK A;  1RLG A;  5MN5 A;  3K0T A;  3VYT C;  2LBX A;  1TVK B;  1RLU A;  1GZ0 A;  1PXW A;  3OW2 F;  3HKD A;  1W5E A;  2ZVY A;  5BMV B;  3C9U A;  2NMU A;  5J2U A;  3JAT A;  4TV9 B;  2HVY D;  4ERH A;  1KD1 H;  5JQG A;  4IHJ B;  5KX5 B;  3U0O A;  4O4J B;  2HRU A;  3GTZ A;  5JCO A;  5LXT B;  3C9R A;  5HY0 A;  3MBM A;  2IQQ A;  5GAN K;  3FD5 A;  1VQP F;  2ZAU A;  2KTU A;  3JAK A;  2PHN A;  5HXZ A;  3F0E A;  4I4T B;  3AGK A;  4BT4 A;  3ELC A;  2Z1T A;  4O4I A;  5FJ4 C;  3RYF A;  5CA1 B;  2DT4 A;  4R40 B;  1IV1 A;  5HP8 A;  4BT5 A;  2V9Y A;  4BT6 A;  2VAP A;  4BVS A;  3VMF B;  2FGY A;  3RYI A;  5G4V C;  2R75 1;  1OFU A;  5MN6 A;  2GVI A;  5DCV A;  5GON B;  4EB6 B;  3G4S F;  2H6L A;  5HP7 A;  4LCK A;  5IJ0 B;  1U3L A;  3UT5 B;  1W59 A;  3DC2 A;  3QUW A;  4U39 A;  3I55 F;  3D01 A;  3RYC B;  5EWR A;  4O2A A;  3JAR A;  5EB0 A;  4G4V A;  3B6N A;  4ZHQ B;  4BT2 A;  5EB1 B;  1NMU B;  1NQ3 A;  5GIN C;  1JJ2 F;  2ZVZ A;  3NVI B;  4C4W C;  3E22 A;  3HKB A;  1TUB A;  3JVH A;  2HQS C;  3IEW A;  4EI9 A;  3JCM M;  3VIU A;  2RHO A;  2B33 A;  3JAS A;  5CA0 A;  2P6Y A;  1IPA A;  1PF5 A;  3WGL A;  3LWV C;  1VQV A;  4O2B A;  3KHN A;  4EI8 A;  2GZL A;  3N4Y A;  3VCZ A;  3CC4 F;  1R1M A;  4YJ2 A;  1XBI A;  2HRY A;  1W3E X;  3FFM A;  5ITZ B;  4I50 A;  5EO3 A;  2QTP A;  3E1Y A;  2RHL A;  3N2K B;  3P10 A;  4TV8 A;  5HY1 A;  1FSZ A;  3D54 A;  5CB4 B;  1YJ9 F;  1X25 A;  4HNA A;  2VAM A;  2ALE A;  2JNB A;  5FNV B;  3J7A R;  4WBN B;  1VQ4 F;  2YXZ A;  3CPW F;  3P4E A;  4BY9 D;  2HP0 A;  3HKC B;  3C9S A;  1RA4 A;  2OZB A;  1VK3 A;  3I3F A;  3QHD A;  2W8B C;  1N8R H;  1GO0 A;  5EAZ A;  1QD9 A;  1VQ9 F;  3K14 A;  5B8F A;  3CC2 F;  4G88 A;  5LOV B;  4X1K B;  3ZO8 A;  1JFF A;  3MQW A;  3EOR A;  2KTV A;  2RB9 A;  4TUY B;  3C8L A;  2UYN A;  3CCU F;  1GO1 A;  3RA6 A;  3J81 M;  5HXU A;  1X52 A;  3I56 F;  3S0W A;  1KNJ A;  2KGW A;  3O85 A;  2N48 A;  1IV2 A;  4C8I A;  4I55 B;  3CYP B;  2DYY A;  1X7P A;  3C9T A;  2CZW A;  4YJ3 A;  2BO1 A;  3M4S A;  3GHZ A;  3LWR C;  5C8Y B;  3KIZ A;  4O4H A;  4U3J B;  3CMA F;  4FFB A;  3RYH A;  2IG8 A;  3JAW A;  2KG4 A;  5FLX M;  4BVQ A;  1Q81 H;  1CLI A;  4F6R A;  2QEX F;  2UZH A;  4BW0 B;  3IR9 A;  1RQ2 A;  3CCV F;  3ZP4 A;  4ZOL A;  2H8C A;  1H7M A;  2I6D A;  1U40 A;  4IIJ A;  4RQO A;  4XCQ A;  3V7E A;  1QAH A;  2CW4 A;  5J2U B;  3JAT B;  4C82 A;  4IHJ A;  1W57 A;  4BT3 A;  2HS4 A;  2I6R A;  1W55 A;  5A2Q M;  2UYK A;  3MCA B;  5JQG B;  3CCE F;  3RA5 A;  3RE3 A;  1Q82 H;  3HKE B;  3FD6 A;  4DXD A;  3CCL F;  2BTU A;  3CME F;  2WAL A;  1K8A H;  4I4T A;  3CCM F;  2HS3 A;  5J2T A;  3HTN A;  1KC8 H;  3V3T A;  3JAK B;  3CC7 F;  1T0A A;  1YGY A;  4BVT A;  1K9M H;  1SA0 A;  5AVM A;  1ODE A;  3RYF B;  2RHJ A;  1VHA A;  3S03 A;  2QI2 A;  2AMT A;  2F9Z C;  5LP6 A;  5HWE A;  3CD6 F;  2Z1F A;  2CHT A;  1W5F A;  5LYJ A;  3RYI B;  3F0G A;  2Q1X A;  1SDS A;  3WPW A;  5LA6 B;  3T80 A;  3F0D A;  1UI9 A;  2YYE A;  1FNK A;  1W41 A;  3WJR A;  4LNU A;  3RYC A;  3G71 F;  1W5A A;  3HWU A;  4O2A B;  3JAR B;  3WGJ A;  4B46 A;  1NJI H;  4DRX A;  4C8G A;  1K73 H;  3PAF A;  5EZY A;  3NVK E;  4ZHW A;  1YI2 F;  3WXM B;  4ZHV A;  1U43 A;  3HKB B;  1TUB B;  1YQN A;  3LWO C;  5JCO C;  1UFY A;  3MCQ A;  1XRG A;  3JAS B;  5CA0 B;  2CWJ A;  3JAM M;  4X20 A;  2IAF A;  4O2B B;  1VQO F;  3VOA A;  3GYQ A;  1QU9 A;  4YJ2 B;  2UYJ A;  4ZI7 A;  3N2K A;  3VOB A;  5JH7 A;  1Q86 H;  4KWE A;  4I50 B;  5CB4 A;  3FBA A;  1VQ6 F;  1JY8 A;  4G4Z A;  5JVD A;  3V7Q A;  4TV8 B;  3LYB A;  3ON1 A;  3E20 B;  3ESJ A;  5IYZ A;  2PMP A;  2L26 A;  3WGM A;  2GLZ A;  1VQM F;  2G9I A;  4X1I A;  2VGN A;  3K2X A;  5GIP C;  5IJ9 B;  1VQ7 F;  2HP0 B;  5KMG A;  3CB2 A;  1IV4 A;  1W58 1;  3BYQ A;  2OTJ F;  3N2G A;  4X1Y A;  5LOV A;  3JAL B;  4O4L B;  4X1K A;  3SIU A;  1DT9 A;  2QA4 F;  1KQS F;  2AIZ P;  5EYP A;  1JN1 A;  2EWC A;  2CHS A;  2Z1E A;  2ZOD A;  2OTL F;  3IMP A;  3S0H A;  1FFX B;  3NK6 A;  2UYN B;  1Q7Y H;  2CSL A;  3ZP7 A;  1XHO A;  3VTI C;  3F0F A;  3WJQ A;  3S0Y A;  1VQ8 F;  1SZQ A;  1Z5V A;  3CXC F;  1XV2 A;  2HS0 A;  2BTQ B;  1OAP A;  3K12 A;  1RQ7 A;  1TVK A;  3KJJ A;  5IT9 M;  3LDT A;  1W5B A;  3N4Z A;  1VQ5 F;  5BMV A;  5GAP K;  5EIB C;  3CG6 A;  2BTO A;  3HKD B;  4O4H B;  4TV9 A;  1IV3 A;  1W2B F;  4FFB B;  3RYH B;  3JAW B;  1H48 A;  1COM A;  4F6R B;  2Q1Y A;  2UYP A;  5KX5 A;  2RHH A;  2MQE A;  3D00 A;  3V4D A;  4O4J A;  3CPQ A;  3WGN A;  5LXT A;  1M1K H;  3CCR F;  1YJW F;  3NK7 A;  4ZOL B;  2LBW A;  4IIJ B;  5G4U C;  2H8E A;  5GIO C;  3NMU C;  5MN4 A;  1YIT F;  3WPX A;  3HKE A;  3G6E F;  3CYQ A;  4M8I A;  4X3M A;  1ONI A;  2VGM A;  1KNK A;  5CA1 A;  3LME A;  4O4I B;  1VH8 A;  1M90 H;  4NQ3 A;  3KE1 A;  3M1X A;  4NWO B;  3I7T A;  3VI6 A;  5J2T B;  1Z5W A;  3CCJ F;  5GON A;  2VAW A;  3WJP A;  1S72 F;  4E6E A;  4BVR A;  4EB6 A;  3S02 A;  3CCQ F;  3VO8 A;  1SA0 B;  3R0P A;  5IJ0 A;  3UT5 A;  4EI7 A;  1Q8R A;  3IKE A;  3M84 A;  5LP6 B;  3IKF A;  2R6R 1;  3TD3 A;  5HY4 A;  1YIJ F;  4RHA A;  5LA6 A;  1JD1 A;  5LYJ B;  3P0Z A;  4ZHQ A;  1DBF A;  4B62 A;  4TZZ A; 
#chains in the Genus database with same CATH homology
 1YHQ F;  5HY0 A;  3V7Q A;  2CZW A;  5GAN K;  2BO1 A;  1VQP F;  1QVF F;  3ON1 A;  1W40 A;  3E20 B;  3SIV A;  2KTU A;  3LWR C;  5HXZ A;  2GLZ A;  3AGK A;  3OBW A;  3CMA F;  1VQM F;  2VGN A;  5GIP C;  5FJ4 C;  1VQ7 F;  2KG4 A;  5FLX M;  3J80 M;  4BVQ A;  3HAX D;  1Q81 H;  1E7K A;  1W42 A;  4BVS A;  2QEX F;  4BW0 B;  1T0K B;  3VMF B;  2OTJ F;  2FGY A;  3IR9 A;  5G4V C;  3SIU A;  1DT9 A;  3LWQ C;  2QA4 F;  3CCV F;  1KQS F;  3CCS F;  3PLA C;  1H7M A;  5DCV A;  2I6D A;  3LFO A;  4XCQ A;  2OTL F;  3V7E A;  3G4S F;  4LCK A;  3NK6 A;  1Q7Y H;  1CK2 A;  1ZWZ A;  2FC3 A;  1VQ8 F;  5A2Q M;  3MCA B;  3CCE F;  3RA5 A;  3I55 F;  1Q82 H;  3CXC F;  5EWR A;  3CCL F;  3OBY A;  3CME F;  1NMU B;  5IT9 M;  2OHW A;  5GIN C;  2WAL A;  1K8A H;  1JJ2 F;  3CCM F;  3NVI B;  4C4W C;  3N4Z A;  1VQ5 F;  4EI9 A;  1KC8 H;  3V3T A;  5GAP K;  3CG6 A;  1QVG F;  3JCM M;  4X3L A;  3CC7 F;  1W2B F;  4BVT A;  4NUT A;  1K9M H;  1IPA A;  1VQL F;  3LWV C;  2QI2 A;  2F9Z C;  2AIF A;  4EI8 A;  5HWE A;  3CD6 F;  3N4Y A;  3CC4 F;  1VQN F;  1YJN F;  1CN7 A;  3D00 A;  3HJW C;  1XBI A;  1W3E X;  3FFM A;  3CPQ A;  5EO3 A;  1SDS A;  1M1K H;  3CCR F;  3E1Y A;  5HY2 A;  3NK7 A;  1YJW F;  1VQK F;  2LBW A;  5G4U C;  5HY1 A;  3LWP C;  1W41 A;  5GIO C;  3NMU C;  1YJ9 F;  1YIT F;  3G6E F;  3G71 F;  2ALE A;  2JNB A;  2VGM A;  4X3M A;  3J7A R;  1X7O A;  1VQ4 F;  1RLG A;  3CPW F;  4BY9 D;  2LBX A;  1NJI H;  1RA4 A;  1M90 H;  2OZB A;  1GZ0 A;  1K73 H;  3PAF A;  4NQ3 A;  1PXW A;  3NVK E;  3OW2 F;  1N8R H;  1YI2 F;  1GO0 A;  3VI6 A;  3WXM B;  3CCJ F;  1VQ9 F;  3CC2 F;  1S72 F;  4BVR A;  3LWO C;  3CCQ F;  2KTV A;  2HVY D;  3CCU F;  1GO1 A;  4EI7 A;  3JAM M;  3RA6 A;  1KD1 H;  3J81 M;  5HXU A;  1VQO F;  3GYQ A;  5HY4 A;  1YIJ F;  1X52 A;  3I56 F;  3O85 A;  1Q86 H;  1X7P A;  1VQ6 F;  4TZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...