1YHQF

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yhqF00
1X7OA 1VQ4F 1M1KH 2QI2A 1E7KA 3NK7A 3O85A 3E1YA 3SIVA 5EWRA 1VQ6F 4LCKA 1VQNF 3CPWF 3GYQA 3LWOC 1W41A 1GO1A 1VQ8F 3OBYA 3NMUC 2AIFA 1QVGF 2KG4A 1CK2A 2QA4F 1K8AH 3G6EF 4BW0B 3LWVC 5DCVA 2OTLF 3V7EA 2WALA 3CG6A 3N4ZA 1KQSF 4BY9D 1ZWZA 2BO1A 1YHQF 2CZWA 3HAXD 3HJWC 2VGNA 3CMAF 1X7PA 4X3MA 1JJ2F 1W42A 3J81M 5GIOC 3CMEF 5GAPK 3RA5A 2HVYD 5G4UC 1S72F 3G4SF 3CCVF 1YJ9F 2OHWA 3I56F 1VQ5F 1DT9A 2JNBA 1W3EX 3CCLF 1W40A 3ON1A 2VGMA 1T0KB 3CCJF 3PLAC 3CCEF 5G4VC 5GIPC 1VQMF 1YITF 5GANK 3VI6A 3LWQC 3JAMM 3CC4F 5IT9M 1W2BF 2ALEA 3NK6A 2I6DA 1IPAA 3N4YA 2OZBA 3LFOA 3CC7F 3OBWA 1KC8H 3JCMM 1RLGA 3CCUF 1Q7YH 4NUTA 3I55F 3CCQF 3OW2F 4X3LA 2OTJF 2KTVA 5EO3A 1PXWA 1Q86H 1Q81H 2QEXF 3RA6A 5FJ4C 4TZZA 1QVFF 3WXMB 3J80M 1YJNF 3CC2F 3V7QA 3NVIB 4C4WC 3PAFA 3VMFB 3CCSF 1NMUB 3AGKA 1H7MA 1KD1H 1M90H 2KTUA 3LWRC 1Q82H 5GINC 3J7AR 1GO0A 2LBWA 1RA4A 1CN7A 3E20B 1K9MH 3SIUA 1YJWF 3LWPC 5A2QM 3CXCF 3FFMA 1K73H 3CCMF 1XBIA 3CPQA 1NJIH 1GZ0A 5FLXM 1N8RH 1VQOF 3NVKE 3CD6F 3IR9A 1VQLF 2FC3A 1VQPF 1YI2F 1VQKF 1VQ7F 3MCAB 1VQ9F 1YIJF 1SDSA 1X52A 3CCRF 3G71F 2LBXA
chains in the Genus database with same CATH superfamily
1X7OA 3TD5A 2QI2A 1M1KH 3DDNA 4ZI7A 2CHTA 5EIBC 3E1YA 3I3FA 3SIVA 1VQ6F 5CA0B 5ITZA 1W41A 4I50A 1GO1A 1XHOA 3IKEA 1W5AA 3JAKA 2AIFA 3NMUC 1KNJA 2VAMA 2ZF8A 5J2TB 2QA4F 2I6RA 3G6EF 2HS3A 3S03A 4BW0B 3JAWA 5LOVB 2Z1UA 4IIJB 2R751 2BTUA 3ZO8A 1IV4A 1XRGA 5BMVA 2BO1A 2Z01A 5KX5B 3FBAA 3CMAF 3RYFB 2CVLA 1IV1A 3C8LA 1FSZA 3QUWA 3RYCA 1RQ7A 4G4YA 4ZHWA 3RYHB 3G4SF 1ODEA 3ESJA 4I55A 4BT6A 2OHWA 2W8BC 4C8IA 3WGMA 3N2KA 1W40A 5GONB 3K0TA 3FPIA 1T0KB 3BYQA 3ERNA 1NQ3A 3CCEF 3JARA 2ZAUA 5GANK 4X20A 5IT9M 4U3JB 4TV9B 1XV2A 4U39A 4WBNA 5C8YB 3D01A 2HP0B 3JCMM 4BT4A 4NUTA 4X1KA 2OTJF 1Q86H 1PXWA 3N2GA 4FFBB 2Z1FA 5FJ4C 3R0PA 2UZHA 3F0GA 4BVQA 3WXMB 5J2UB 1YJNF 1FFXA 4O2BB 3WJRA 4ZHVA 3M1XA 3CCSF 3HKDA 5LA6A 1H7MA 3S02A 5JVDB 1Q82H 3VCZA 3WGKA 1K9MH 1VQVA 3QTYA 1YJWF 3LWPC 3KHNA 3CYQA 4DXDA 3CCMF 3K2XA 2LCAA 4TV8B 2Z1TA 1W5FA 2N48A 3MCQA 3F6MA 5LYJA 4YJ2A 1VQOF 3CD6F 1VK3A 4F6RA 2ZOVA 3VO8A 3GHZA 5LP6A 1TUBA 4O2AB 4DRXB 1W57A 3VYUC 2F9ZC 1YIJF 5JQGB 4O4LB 3HKCB 3I7TA 3UT5B 3S0HA 1YQNA 4O4JA 4X1IB 1RQ2A 4TUYB 3LDTA 2IG8A 5CB4A 4ZOLA 5EWRA 4LCKA 5KMGA 3CPWF 3GYQA 3KE1A 3S0YA 1VQ8F 3RE3A 5EZYB 5IJ0B 3OONA 1QVGF 1CK2A 1K8AH 5MN5A 1U3LA 2OTLF 2QTPA 3ZOPA 3V3TA 3JATA 3HWUA 3U0OA 5EYPA 4IHJA 2YXZA 5LXTB 3HAXD 1W581 3P0ZA 3HTNA 1X7PA 4X3MA 1COMA 4RHAA 3J81M 2L26A 3JASB 3M84A 5GAPK 2HVYD 5G4UC 1JFFB 4X1YB 1S72F 4C81A 2BTQB 4C82A 3FD6A 1QU9A 3B6NA 4O4HB 1T0AA 3WPWA 1VQ5F 1DT9A 2RHLA 2LBTA 1H47A 4ZI7B 2H8CA 2VXYA 3K12A 2BTOA 3EORA 5ITZB 4I50B 5G4VC 1VQMF 3JAKB 3C9RA 5HY2A 2CW4A 4BVSA 1UFYA 3JAMM 2I6DA 1IPAA 3JAWB 4BVRA 3LFOA 3C9TA 5B8FA 2UYNA 1Q7YH 5BMVB 4X3LA 2KTVA 5HP8A 1Q81H 2QEXF 3RA6A 2OTMA 5HP7A 1W5BA 3RYCB 1QVFF 3K14A 3CC2F 3PAFA 5JH7A 1NMUB 4I55B 1VHAA 1M90H 1Q8RA 3HKEA 3S0WA 5GINC 5HXUA 1SA0A 3N2KB 1UI9A 2GLZA 3E20B 2AIZP 3Q8HA 4BT3A 3CXCF 3FFMA 5IJ9A 3JARB 4YJ3A 5FLXM 1GX1A 5IYZA 4X20B 4RQOA 3ELCA 2FC3A 2AMTA 4WBNB 4LNUA 2HX0A 1VQ9F 4X1KB 3VYSC 1X52A 3M4SA 3N2GB 2Q1YA 3WPXA 5LP6C 3D00A 3NK7A 1J7HA 5HWEA 1FFXB 1VQNF 3IEWA 2P6YA 3HKDB 5LA6B 3LYBA 3CYPB 4ZHQA 5EB1B 4NWOB 3MBMA 5DCVA 2G9IA 3L7QA 3HKBA 2WALA 4HNAA 4EI9A 3CG6A 3N4ZA 2YYEA 4BY9D 3VTIC 5HY4A 2ZODA 2UYKA 5FNVA 3HJWC 4XCQA 2UYJA 1FNJA 4YJ2B 5LYJB 1W42A 1QAHA 2RHHA 4F6RB 4BT5A 3RA5A 5CA1A 5LP6B 1QD9A 1TUBB 5EB0A 3CCVF 4PWTA 1YGYA 3WGNA 5JCOA 5HY0A 3I56F 1IV2A 3TD3A 4KWEA 2DT4A 2JNBA 4O4JB 1W5EA 5CB4B 3ON1A 4ZOLB 3FD5A 1CLIA 3JALA 5KMGB 1TVKA 3VIUA 3KIZA 3RYIA 5GIPC 1YITF 4I4TA 2FGYA 1JY8A 5EAZA 3CC4F 4O4IA 1W2BF 2ALEA 3NK6A 2B33A 2OZBA 3OBWA 3JATB 1KC8H 2HP3A 3E22A 3CCUF 5EYPB 1U3PA 4IHJB 5HY1A 2Q1XA 2HRYA 4C8GA 3WGLA 4EB6A 1DBFA 1JN1A 4TZZA 3S06A 5HXZA 1PF5A 1H48A 3IEQA 3J80M 4C4WC 5CA0A 3GTZA 3VMFB 4BT7A 1X25A 2Z1EA 5J2TA 1U40A 3LWRC 3JVHA 3J7AR 5LOVA 4IIJA 3WJPA 1ONIA 2IQQA 1CN7A 3T80A 3IKFA 3SIUA 4ZK7A 2PHNA 1XBIA 2CSLA 4M8IA 3V4DA 1OAPA 5KX5A 1NJIH 1JD1A 3RYFA 1N8RH 2R6R1 2ZVYA 3IR9A 4B46A 1VQPF 1KNKA 1YI2F 2HRUA 3RYHA 1VQKF 2UYNB 3MCAB 3MQWA 5MN4A 2GVIA 3G71F 2LBXA 1RLUA 2KGWA 3I55F 1VQ4F 3P10A 3KJJA 4EI7A 1E7KA 5GONA 3O85A 3LMEA 3LWOC 5JH7B 3OBYA 3C9SA 2KG4A 2VAWA 1Z5WA 3HKEB 4U3JA 4TV9A 3LWVC 1SA0B 3ZP7A 5C8YA 2K1SA 3V7EA 2HP0A 1W55A 3F0FA 3QHDA 1KQSF 2VAPA 3VOBA 1ZWZA 5IJ9B 1YHQF 2CZWA 2RHJA 2VGNA 4FFBA 4YJ3B 2CHSA 5MN6A 1JJ2F 5IYZB 2CWJA 5GIOC 3CMEF 2ZVZA 3F0DA 2HQSC 4LNUB 5J2UA 4O2BA 2UYPA 4G4ZA 1YJ9F 3CB2A 5JVDA 4EI8A 4ERHA 1W3EX 3CCLF 5EIBD 2IAFA 2VGMA 5JCOC 3CCJF 4BVTA 3D54A 4E6EA 3PLAC 4R40B 1W59A 4TV8A 3KJKA 4ZHQB 3VI6A 3LWQC 1U43A 2V9YA 1OFUA 3VOAA 3TD4A 4B5CA 1SZQA 3MDOA 3N4YA 3P4EA 3CC7F 3HKBB 1RLGA 4HNAB 2RHOA 4O2AA 4DRXA 3CCQF 3DC2A 5JQGA 4O4LA 3OW2F 1VH8A 3HKCA 5EO3A 5FNVB 3UT5A 2HS4A 3C9UA 3WGJA 4G4XA 4X1IA 4TUYA 2PMPA 2DYYA 4NQ3A 2RB9A 5CA1B 3NVIB 3V7QA 5AVMA 2EWCA 2NMUA 3AGKA 5EZYA 2GZLA 4BT2A 5IJ0A 1KD1H 2KTUA 4G4VA 4G88A 1GO0A 2LBWA 2MQEA 1RA4A 4G4WA 4B45A 3JALB 5A2QM 1K73H 1TVKB 2HS0A 3RYIB 5LXTA 3CPQA 1GZ0A 4I4TB 3ZP4A 2H6LA 3NVKE 4C8EA 4O4IB 1Z5VA 3JASA 1VQLF 1IV3A 3WJQA 3F0EA 1JFFA 4X1YA 1VQ7F 3E22B 4B62A 3IMPA 4ZHYB 1SDSA 1R1MA 4O4HA 1FNKA 2H8EA 3CCRF 3VYTC 4EB6B
chains in the Genus database with same CATH topology
1X7OA 1VQ4F 1M1KH 2QI2A 3D00A 4EI7A 1E7KA 3NK7A 3O85A 3E1YA 5HWEA 5EWRA 3SIVA 1VQ6F 4LCKA 1VQNF 3CPWF 3GYQA 3LWOC 1W41A 1GO1A 1VQ8F 3OBYA 3NMUC 2AIFA 1QVGF 2KG4A 1CK2A 2QA4F 1K8AH 3G6EF 4BW0B 3LWVC 5DCVA 2OTLF 3V3TA 2WALA 3V7EA 4EI9A 3CG6A 3N4ZA 1KQSF 4BY9D 1ZWZA 2BO1A 5HY4A 1YHQF 2CZWA 3HAXD 3HJWC 2VGNA 4XCQA 3CMAF 1X7PA 4X3MA 1JJ2F 1W42A 3J81M 5GIOC 3CMEF 5GAPK 3RA5A 2HVYD 5G4UC 1S72F 3G4SF 3CCVF 1YJ9F 2OHWA 5HY0A 3I56F 1VQ5F 1DT9A 2JNBA 4EI8A 1W3EX 3CCLF 1W40A 3ON1A 2VGMA 1T0KB 3CCJF 4BVTA 3PLAC 3CCEF 5G4VC 5GIPC 1VQMF 5HY2A 4BVSA 5GANK 3VI6A 3LWQC 1YITF 2FGYA 3JAMM 3CC4F 5IT9M 1W2BF 2ALEA 3NK6A 2I6DA 1IPAA 3N4YA 2OZBA 4BVRA 3LFOA 3CC7F 3OBWA 1KC8H 3JCMM 1RLGA 3CCUF 1Q7YH 4NUTA 3I55F 3CCQF 3OW2F 4X3LA 5HY1A 2OTJF 2KTVA 5EO3A 1PXWA 1Q86H 1Q81H 2QEXF 3RA6A 5FJ4C 4TZZA 5HXZA 1QVFF 4NQ3A 4BVQA 3WXMB 3J80M 1YJNF 3CC2F 3V7QA 3NVIB 4C4WC 3PAFA 3VMFB 3CCSF 1NMUB 3AGKA 1H7MA 1KD1H 1M90H 2KTUA 3LWRC 1Q82H 5GINC 5HXUA 3J7AR 1GO0A 2LBWA 1RA4A 2GLZA 1CN7A 3E20B 1K9MH 3SIUA 1YJWF 3LWPC 5A2QM 3CXCF 3FFMA 1K73H 3CCMF 1XBIA 3CPQA 1NJIH 1GZ0A 5FLXM 1N8RH 1VQOF 3NVKE 3CD6F 3IR9A 1VQLF 2FC3A 1VQPF 1YI2F 1VQKF 1VQ7F 3MCAB 1VQ9F 2F9ZC 1YIJF 1SDSA 1X52A 3CCRF 3G71F 2LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  1VQ4 F;  1M1K H;  2QI2 A;  1E7K A;  3NK7 A;  3O85 A;  3E1Y A;  3SIV A;  5EWR A;  1VQ6 F;  4LCK A;  1VQN F;  3CPW F;  3GYQ A;  3LWO C;  1W41 A;  1GO1 A;  1VQ8 F;  3OBY A;  3NMU C;  2AIF A;  1QVG F;  2KG4 A;  1CK2 A;  2QA4 F;  1K8A H;  3G6E F;  4BW0 B;  3LWV C;  5DCV A;  2OTL F;  3V7E A;  2WAL A;  3CG6 A;  3N4Z A;  1KQS F;  4BY9 D;  1ZWZ A;  2BO1 A;  1YHQ F;  2CZW A;  3HAX D;  3HJW C;  2VGN A;  3CMA F;  1X7P A;  4X3M A;  1JJ2 F;  1W42 A;  3J81 M;  5GIO C;  3CME F;  5GAP K;  3RA5 A;  2HVY D;  5G4U C;  1S72 F;  3G4S F;  3CCV F;  1YJ9 F;  2OHW A;  3I56 F;  1VQ5 F;  1DT9 A;  2JNB A;  1W3E X;  3CCL F;  1W40 A;  3ON1 A;  2VGM A;  1T0K B;  3CCJ F;  3PLA C;  3CCE F;  5G4V C;  5GIP C;  1VQM F;  1YIT F;  5GAN K;  3VI6 A;  3LWQ C;  3JAM M;  3CC4 F;  5IT9 M;  1W2B F;  2ALE A;  3NK6 A;  2I6D A;  1IPA A;  3N4Y A;  2OZB A;  3LFO A;  3CC7 F;  3OBW A;  1KC8 H;  3JCM M;  1RLG A;  3CCU F;  1Q7Y H;  4NUT A;  3I55 F;  3CCQ F;  3OW2 F;  4X3L A;  2OTJ F;  2KTV A;  5EO3 A;  1PXW A;  1Q86 H;  1Q81 H;  2QEX F;  3RA6 A;  5FJ4 C;  4TZZ A;  1QVF F;  3WXM B;  3J80 M;  1YJN F;  3CC2 F;  3V7Q A;  3NVI B;  4C4W C;  3PAF A;  3VMF B;  3CCS F;  1NMU B;  3AGK A;  1H7M A;  1KD1 H;  1M90 H;  2KTU A;  3LWR C;  1Q82 H;  5GIN C;  3J7A R;  1GO0 A;  2LBW A;  1RA4 A;  1CN7 A;  3E20 B;  1K9M H;  3SIU A;  1YJW F;  3LWP C;  5A2Q M;  3CXC F;  3FFM A;  1K73 H;  3CCM F;  1XBI A;  3CPQ A;  1NJI H;  1GZ0 A;  5FLX M;  1N8R H;  1VQO F;  3NVK E;  3CD6 F;  3IR9 A;  1VQL F;  2FC3 A;  1VQP F;  1YI2 F;  1VQK F;  1VQ7 F;  3MCA B;  1VQ9 F;  1YIJ F;  1SDS A;  1X52 A;  3CCR F;  3G71 F;  2LBX A; 
#chains in the Genus database with same CATH topology
 1X7O A;  3TD5 A;  2QI2 A;  1M1K H;  3DDN A;  4ZI7 A;  2CHT A;  5EIB C;  3E1Y A;  3I3F A;  3SIV A;  1VQ6 F;  5CA0 B;  5ITZ A;  1W41 A;  4I50 A;  1GO1 A;  1XHO A;  3IKE A;  1W5A A;  3JAK A;  2AIF A;  3NMU C;  1KNJ A;  2VAM A;  2ZF8 A;  5J2T B;  2QA4 F;  2I6R A;  3G6E F;  2HS3 A;  3S03 A;  4BW0 B;  3JAW A;  5LOV B;  2Z1U A;  4IIJ B;  2R75 1;  2BTU A;  3ZO8 A;  1IV4 A;  1XRG A;  5BMV A;  2BO1 A;  2Z01 A;  5KX5 B;  3FBA A;  3CMA F;  3RYF B;  2CVL A;  1IV1 A;  3C8L A;  1FSZ A;  3QUW A;  3RYC A;  1RQ7 A;  4G4Y A;  4ZHW A;  3RYH B;  3G4S F;  1ODE A;  3ESJ A;  4I55 A;  4BT6 A;  2OHW A;  2W8B C;  4C8I A;  3WGM A;  3N2K A;  1W40 A;  5GON B;  3K0T A;  3FPI A;  1T0K B;  3BYQ A;  3ERN A;  1NQ3 A;  3CCE F;  3JAR A;  2ZAU A;  5GAN K;  4X20 A;  5IT9 M;  4U3J B;  4TV9 B;  1XV2 A;  4U39 A;  4WBN A;  5C8Y B;  3D01 A;  2HP0 B;  3JCM M;  4BT4 A;  4NUT A;  4X1K A;  2OTJ F;  1Q86 H;  1PXW A;  3N2G A;  4FFB B;  2Z1F A;  5FJ4 C;  3R0P A;  2UZH A;  3F0G A;  4BVQ A;  3WXM B;  5J2U B;  1YJN F;  1FFX A;  4O2B B;  3WJR A;  4ZHV A;  3M1X A;  3CCS F;  3HKD A;  5LA6 A;  1H7M A;  3S02 A;  5JVD B;  1Q82 H;  3VCZ A;  3WGK A;  1K9M H;  1VQV A;  3QTY A;  1YJW F;  3LWP C;  3KHN A;  3CYQ A;  4DXD A;  3CCM F;  3K2X A;  2LCA A;  4TV8 B;  2Z1T A;  1W5F A;  2N48 A;  3MCQ A;  3F6M A;  5LYJ A;  4YJ2 A;  1VQO F;  3CD6 F;  1VK3 A;  4F6R A;  2ZOV A;  3VO8 A;  3GHZ A;  5LP6 A;  1TUB A;  4O2A B;  4DRX B;  1W57 A;  3VYU C;  2F9Z C;  1YIJ F;  5JQG B;  4O4L B;  3HKC B;  3I7T A;  3UT5 B;  3S0H A;  1YQN A;  4O4J A;  4X1I B;  1RQ2 A;  4TUY B;  3LDT A;  2IG8 A;  5CB4 A;  4ZOL A;  5EWR A;  4LCK A;  5KMG A;  3CPW F;  3GYQ A;  3KE1 A;  3S0Y A;  1VQ8 F;  3RE3 A;  5EZY B;  5IJ0 B;  3OON A;  1QVG F;  1CK2 A;  1K8A H;  5MN5 A;  1U3L A;  2OTL F;  2QTP A;  3ZOP A;  3V3T A;  3JAT A;  3HWU A;  3U0O A;  5EYP A;  4IHJ A;  2YXZ A;  5LXT B;  3HAX D;  1W58 1;  3P0Z A;  3HTN A;  1X7P A;  4X3M A;  1COM A;  4RHA A;  3J81 M;  2L26 A;  3JAS B;  3M84 A;  5GAP K;  2HVY D;  5G4U C;  1JFF B;  4X1Y B;  1S72 F;  4C81 A;  2BTQ B;  4C82 A;  3FD6 A;  1QU9 A;  3B6N A;  4O4H B;  1T0A A;  3WPW A;  1VQ5 F;  1DT9 A;  2RHL A;  2LBT A;  1H47 A;  4ZI7 B;  2H8C A;  2VXY A;  3K12 A;  2BTO A;  3EOR A;  5ITZ B;  4I50 B;  5G4V C;  1VQM F;  3JAK B;  3C9R A;  5HY2 A;  2CW4 A;  4BVS A;  1UFY A;  3JAM M;  2I6D A;  1IPA A;  3JAW B;  4BVR A;  3LFO A;  3C9T A;  5B8F A;  2UYN A;  1Q7Y H;  5BMV B;  4X3L A;  2KTV A;  5HP8 A;  1Q81 H;  2QEX F;  3RA6 A;  2OTM A;  5HP7 A;  1W5B A;  3RYC B;  1QVF F;  3K14 A;  3CC2 F;  3PAF A;  5JH7 A;  1NMU B;  4I55 B;  1VHA A;  1M90 H;  1Q8R A;  3HKE A;  3S0W A;  5GIN C;  5HXU A;  1SA0 A;  3N2K B;  1UI9 A;  2GLZ A;  3E20 B;  2AIZ P;  3Q8H A;  4BT3 A;  3CXC F;  3FFM A;  5IJ9 A;  3JAR B;  4YJ3 A;  5FLX M;  1GX1 A;  5IYZ A;  4X20 B;  4RQO A;  3ELC A;  2FC3 A;  2AMT A;  4WBN B;  4LNU A;  2HX0 A;  1VQ9 F;  4X1K B;  3VYS C;  1X52 A;  3M4S A;  3N2G B;  2Q1Y A;  3WPX A;  5LP6 C;  3D00 A;  3NK7 A;  1J7H A;  5HWE A;  1FFX B;  1VQN F;  3IEW A;  2P6Y A;  3HKD B;  5LA6 B;  3LYB A;  3CYP B;  4ZHQ A;  5EB1 B;  4NWO B;  3MBM A;  5DCV A;  2G9I A;  3L7Q A;  3HKB A;  2WAL A;  4HNA A;  4EI9 A;  3CG6 A;  3N4Z A;  2YYE A;  4BY9 D;  3VTI C;  5HY4 A;  2ZOD A;  2UYK A;  5FNV A;  3HJW C;  4XCQ A;  2UYJ A;  1FNJ A;  4YJ2 B;  5LYJ B;  1W42 A;  1QAH A;  2RHH A;  4F6R B;  4BT5 A;  3RA5 A;  5CA1 A;  5LP6 B;  1QD9 A;  1TUB B;  5EB0 A;  3CCV F;  4PWT A;  1YGY A;  3WGN A;  5JCO A;  5HY0 A;  3I56 F;  1IV2 A;  3TD3 A;  4KWE A;  2DT4 A;  2JNB A;  4O4J B;  1W5E A;  5CB4 B;  3ON1 A;  4ZOL B;  3FD5 A;  1CLI A;  3JAL A;  5KMG B;  1TVK A;  3VIU A;  3KIZ A;  3RYI A;  5GIP C;  1YIT F;  4I4T A;  2FGY A;  1JY8 A;  5EAZ A;  3CC4 F;  4O4I A;  1W2B F;  2ALE A;  3NK6 A;  2B33 A;  2OZB A;  3OBW A;  3JAT B;  1KC8 H;  2HP3 A;  3E22 A;  3CCU F;  5EYP B;  1U3P A;  4IHJ B;  5HY1 A;  2Q1X A;  2HRY A;  4C8G A;  3WGL A;  4EB6 A;  1DBF A;  1JN1 A;  4TZZ A;  3S06 A;  5HXZ A;  1PF5 A;  1H48 A;  3IEQ A;  3J80 M;  4C4W C;  5CA0 A;  3GTZ A;  3VMF B;  4BT7 A;  1X25 A;  2Z1E A;  5J2T A;  1U40 A;  3LWR C;  3JVH A;  3J7A R;  5LOV A;  4IIJ A;  3WJP A;  1ONI A;  2IQQ A;  1CN7 A;  3T80 A;  3IKF A;  3SIU A;  4ZK7 A;  2PHN A;  1XBI A;  2CSL A;  4M8I A;  3V4D A;  1OAP A;  5KX5 A;  1NJI H;  1JD1 A;  3RYF A;  1N8R H;  2R6R 1;  2ZVY A;  3IR9 A;  4B46 A;  1VQP F;  1KNK A;  1YI2 F;  2HRU A;  3RYH A;  1VQK F;  2UYN B;  3MCA B;  3MQW A;  5MN4 A;  2GVI A;  3G71 F;  2LBX A;  1RLU A;  2KGW A;  3I55 F;  1VQ4 F;  3P10 A;  3KJJ A;  4EI7 A;  1E7K A;  5GON A;  3O85 A;  3LME A;  3LWO C;  5JH7 B;  3OBY A;  3C9S A;  2KG4 A;  2VAW A;  1Z5W A;  3HKE B;  4U3J A;  4TV9 A;  3LWV C;  1SA0 B;  3ZP7 A;  5C8Y A;  2K1S A;  3V7E A;  2HP0 A;  1W55 A;  3F0F A;  3QHD A;  1KQS F;  2VAP A;  3VOB A;  1ZWZ A;  5IJ9 B;  1YHQ F;  2CZW A;  2RHJ A;  2VGN A;  4FFB A;  4YJ3 B;  2CHS A;  5MN6 A;  1JJ2 F;  5IYZ B;  2CWJ A;  5GIO C;  3CME F;  2ZVZ A;  3F0D A;  2HQS C;  4LNU B;  5J2U A;  4O2B A;  2UYP A;  4G4Z A;  1YJ9 F;  3CB2 A;  5JVD A;  4EI8 A;  4ERH A;  1W3E X;  3CCL F;  5EIB D;  2IAF A;  2VGM A;  5JCO C;  3CCJ F;  4BVT A;  3D54 A;  4E6E A;  3PLA C;  4R40 B;  1W59 A;  4TV8 A;  3KJK A;  4ZHQ B;  3VI6 A;  3LWQ C;  1U43 A;  2V9Y A;  1OFU A;  3VOA A;  3TD4 A;  4B5C A;  1SZQ A;  3MDO A;  3N4Y A;  3P4E A;  3CC7 F;  3HKB B;  1RLG A;  4HNA B;  2RHO A;  4O2A A;  4DRX A;  3CCQ F;  3DC2 A;  5JQG A;  4O4L A;  3OW2 F;  1VH8 A;  3HKC A;  5EO3 A;  5FNV B;  3UT5 A;  2HS4 A;  3C9U A;  3WGJ A;  4G4X A;  4X1I A;  4TUY A;  2PMP A;  2DYY A;  4NQ3 A;  2RB9 A;  5CA1 B;  3NVI B;  3V7Q A;  5AVM A;  2EWC A;  2NMU A;  3AGK A;  5EZY A;  2GZL A;  4BT2 A;  5IJ0 A;  1KD1 H;  2KTU A;  4G4V A;  4G88 A;  1GO0 A;  2LBW A;  2MQE A;  1RA4 A;  4G4W A;  4B45 A;  3JAL B;  5A2Q M;  1K73 H;  1TVK B;  2HS0 A;  3RYI B;  5LXT A;  3CPQ A;  1GZ0 A;  4I4T B;  3ZP4 A;  2H6L A;  3NVK E;  4C8E A;  4O4I B;  1Z5V A;  3JAS A;  1VQL F;  1IV3 A;  3WJQ A;  3F0E A;  1JFF A;  4X1Y A;  1VQ7 F;  3E22 B;  4B62 A;  3IMP A;  4ZHY B;  1SDS A;  1R1M A;  4O4H A;  1FNK A;  2H8E A;  3CCR F;  3VYT C;  4EB6 B; 
#chains in the Genus database with same CATH homology
 1X7O A;  1VQ4 F;  1M1K H;  2QI2 A;  3D00 A;  4EI7 A;  1E7K A;  3NK7 A;  3O85 A;  3E1Y A;  5HWE A;  5EWR A;  3SIV A;  1VQ6 F;  4LCK A;  1VQN F;  3CPW F;  3GYQ A;  3LWO C;  1W41 A;  1GO1 A;  1VQ8 F;  3OBY A;  3NMU C;  2AIF A;  1QVG F;  2KG4 A;  1CK2 A;  2QA4 F;  1K8A H;  3G6E F;  4BW0 B;  3LWV C;  5DCV A;  2OTL F;  3V3T A;  2WAL A;  3V7E A;  4EI9 A;  3CG6 A;  3N4Z A;  1KQS F;  4BY9 D;  1ZWZ A;  2BO1 A;  5HY4 A;  1YHQ F;  2CZW A;  3HAX D;  3HJW C;  2VGN A;  4XCQ A;  3CMA F;  1X7P A;  4X3M A;  1JJ2 F;  1W42 A;  3J81 M;  5GIO C;  3CME F;  5GAP K;  3RA5 A;  2HVY D;  5G4U C;  1S72 F;  3G4S F;  3CCV F;  1YJ9 F;  2OHW A;  5HY0 A;  3I56 F;  1VQ5 F;  1DT9 A;  2JNB A;  4EI8 A;  1W3E X;  3CCL F;  1W40 A;  3ON1 A;  2VGM A;  1T0K B;  3CCJ F;  4BVT A;  3PLA C;  3CCE F;  5G4V C;  5GIP C;  1VQM F;  5HY2 A;  4BVS A;  5GAN K;  3VI6 A;  3LWQ C;  1YIT F;  2FGY A;  3JAM M;  3CC4 F;  5IT9 M;  1W2B F;  2ALE A;  3NK6 A;  2I6D A;  1IPA A;  3N4Y A;  2OZB A;  4BVR A;  3LFO A;  3CC7 F;  3OBW A;  1KC8 H;  3JCM M;  1RLG A;  3CCU F;  1Q7Y H;  4NUT A;  3I55 F;  3CCQ F;  3OW2 F;  4X3L A;  5HY1 A;  2OTJ F;  2KTV A;  5EO3 A;  1PXW A;  1Q86 H;  1Q81 H;  2QEX F;  3RA6 A;  5FJ4 C;  4TZZ A;  5HXZ A;  1QVF F;  4NQ3 A;  4BVQ A;  3WXM B;  3J80 M;  1YJN F;  3CC2 F;  3V7Q A;  3NVI B;  4C4W C;  3PAF A;  3VMF B;  3CCS F;  1NMU B;  3AGK A;  1H7M A;  1KD1 H;  1M90 H;  2KTU A;  3LWR C;  1Q82 H;  5GIN C;  5HXU A;  3J7A R;  1GO0 A;  2LBW A;  1RA4 A;  2GLZ A;  1CN7 A;  3E20 B;  1K9M H;  3SIU A;  1YJW F;  3LWP C;  5A2Q M;  3CXC F;  3FFM A;  1K73 H;  3CCM F;  1XBI A;  3CPQ A;  1NJI H;  1GZ0 A;  5FLX M;  1N8R H;  1VQO F;  3NVK E;  3CD6 F;  3IR9 A;  1VQL F;  2FC3 A;  1VQP F;  1YI2 F;  1VQK F;  1VQ7 F;  3MCA B;  1VQ9 F;  2F9Z C;  1YIJ F;  1SDS A;  1X52 A;  3CCR F;  3G71 F;  2LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...