3IEWA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
SMDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 50
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3iewA00
1VHAA 1KNKA 4C82A 2UZHA 4C8EA 3GHZA 3F0DA 3EORA 1H47A 1VH8A 1W57A 3F0GA 3IKFA 2AMTA 3MBMA 1IV2A 1T0AA 3IKEA 3ESJA 1U40A 1W55A 3F0FA 1H48A 3IEQA 3RE3A 1GX1A 1U3LA 3KE1A 5B8FA 2GZLA 1U3PA 3ELCA 3K14A 3FBAA 1U43A 3JVHA 1JY8A 1IV3A 3P10A 3QHDA 4C8GA 3ERNA 3IEWA 3B6NA 4C81A 3Q8HA 3F6MA 3P0ZA 1IV4A 1IV1A 3T80A 1KNJA 3K2XA 3F0EA 4C8IA 2PMPA 1YQNA 3FPIA 1JN1A
chains in the Genus database with same CATH superfamily
3S06A 1VHAA 3SIUA 1RLGA 3CPWF 3WGJA 4ZI7B 4BT5A 3JASA 2VGMA 4DRXB 1K9MH 5ITZB 1Q86H 4PWTA 5EAZA 1VQNF 3IEQA 5JCOC 2RB9A 1RQ7A 2QEXF 1KQSF 1M1KH 2FGYA 3KE1A 5B8FA 2FC3A 3CC7F 2CHSA 1U43A 4FFBB 2OTLF 2YXZA 3CCQF 4X1IB 4DRXA 2DT4A 2QA4F 1KD1H 5ITZA 5EO3A 4BT6A 3CYQA 1TVKB 4O2BB 1QAHA 3C9UA 3CC2F 1W59A 4FFBA 3P4EA 3WPWA 3S03A 3VCZA 3WJRA 5A2QM 3S0HA 4TZZA 4NWOB 2OTJF 5GIOC 3I7TA 1UI9A 4G4VA 2BO1A 1TVKA 4O2BA 2CZWA 2I6RA 3HKBB 5HXUA 2ZVYA 3ZO8A 1ZWZA 5JH7A 2P6YA 1XRGA 3CCEF 5JVDB 1IV1A 2V9YA 2UYKA 2WALA 3QTYA 3LYBA 1QVGF 4G88A 3LWVC 2UZHA 2VAMA 3EORA 2AIFA 3O85A 5GIPC 1TUBA 1K8AH 2HVYD 1VQ4F 3CD6F 3HKBA 1R1MA 1W5EA 3MCQA 5HY2A 2B33A 3JATB 5JVDA 3PAFA 1YGYA 4HNAB 3RYHB 1W3EX 1JFFB 3VYUC 1SA0B 2AIZP 3G6EF 2CHTA 3MCAB 4XCQA 5GANK 2I6DA 1OAPA 1YJNF 3JATA 2UYJA 2CWJA 3VYSC 1T0KB 3RYHA 4I4TB 5EWRA 4I50B 1JFFA 4X1KB 5LP6B 5HY4A 1SA0A 4B45A 3CCLF 1T0AA 4BVSA 1VQ9F 4B46A 3VO8A 4E6EA 3LMEA 4EB6B 1ONIA 1YI2F 3MQWA 2HS4A 1DT9A 3G71F 3ELCA 2ALEA 3C8LA 4I4TA 4I50A 1SDSA 4X1KA 5LP6A 2LBTA 2OHWA 4C8GA 2BTQB 2OTMA 3CMAF 5HY1A 3HKCA 1Z5VA 2N48A 4EB6A 4KWEA 2DYYA 3JARB 1KNKA 2PHNA 1VQ7F 1X7PA 3RYFB 5HWEA 1CN7A 2HP0B 4TV8B 3CCVF 3FD5A 3V4DA 5HXZA 1M90H 3U0OA 4I55B 1FNJA 2NMUA 3WPXA 1PXWA 4BVTA 1QVFF 4O4JA 2HQSC 3JARA 2HX0A 3CCUF 3K14A 2KG4A 2ZAUA 4YJ2B 3RYFA 3RYCB 3OBWA 4DXDA 2K1SA 4TV8A 1X52A 2ZODA 5EZYB 4ERHA 5LOVB 4I55A 3T80A 2GLZA 4BVQA 3TD4A 3JAMM 1W5BA 3FD6A 2RHJA 4X3MA 1COMA 1Q81H 3F0GA 4YJ2A 3WGKA 3CB2A 3LWOC 3G4SF 2QTPA 3HWUA 3F0FA 5LOVA 3UT5B 5HY0A 1W40A 1W581 4BT2A 3V3TA 2KTUA 2HS0A 5IJ0B 3CCRF 2CVLA 3KHNA 3KJJA 3VIUA 3C9RA 2RHOA 4F6RB 1VQOF 5MN5A 2ZOVA 4ZHWA 4ZI7A 5FLXM 3WXMB 4O4IB 3UT5A 4ZHQB 3N2GB 2IQQA 3HKEB 5IJ0A 2AMTA 2Z1TA 4X1YB 4BT7A 1U40A 1RQ2A 4X1IA 5IJ9B 1XV2A 2VXYA 5J2TB 3JAKB 3D00A 5EB0A 4WBNB 3ZOPA 4O4IA 3HJWC 4ZHQA 4B62A 3LFOA 1U3LA 1CK2A 3N2GA 4NQ3A 4LNUB 3HKEA 3DC2A 4ZHYB 1RLUA 4O2AB 4NUTA 4X1YA 5EIBC 1ODEA 3F6MA 5IJ9A 3M84A 5J2TA 3NK6A 3JAKA 4WBNA 1VQKF 2F9ZC 4X20B 5G4UC 1FFXB 3GHZA 3CYPB 4LNUA 3VOAA 2Z1EA 1VQLF 3ESJA 4O2AA 5AVMA 1YITF 1W5FA 2MQEA 3RE3A 1Z5WA 2G9IA 4X20A 1Q7YH 4BY9D 3JVHA 5GONB 1NQ3A 1XHOA 3LDTA 5HP8A 3Q8HA 3P0ZA 3VMFB 1JD1A 4C4WC 4G4WA 1JJ2F 1W5AA 1YIJF 2H6LA 4HNAA 4U3JB 5HP7A 5GONA 4B5CA 2CW4A 4O4LB 5CB4B 5LYJB 2HRYA 3IR9A 1Q8RA 1GX1A 3LWQC 3HAXD 1GZ0A 1X25A 1H7MA 3I55F 1YJWF 1U3PA 2CSLA 1OFUA 5KX5B 2Z1FA 1GO0A 3WGNA 2R6R1 3CMEF 4BVRA 4O4LA 1NMUB 5C8YB 2ZF8A 5CB4A 5LYJA 1X7OA 3OBYA 3FPIA 4C82A 2Q1YA 2UYNB 1PF5A 3IKFA 4YJ3B 5KX5A 1E7KA 5FJ4C 5JCOA 5C8YA 3TD5A 3PLAC 1Q82H 1VQ6F 5GINC 4IHJB 2GVIA 4ZHVA 2UYNA 1QD9A 1JY8A 2ZVZA 3P10A 4YJ3A 2HP0A 2HP3A 3QHDA 1QU9A 4G4XA 4C81A 2VGNA 5EIBD 1VQMF 5IYZB 2IAFA 4C8EA 3CC4F 5CA0B 5GAPK 4IHJA 5LA6B 3F0DA 1W57A 2RHHA 1DBFA 3E22B 3RYCA 5EZYA 3V7EA 3M1XA 2YYEA 5IYZA 3J80M 5CA0A 5LA6A 4O4HB 3R0PA 1YHQF 1IV3A 3E22A 5LP6C 3C9SA 3CPQA 3NMUC 2LCAA 2UYPA 1YJ9F 2RHLA 3CCJF 5J2UB 3NVKE 5G4VC 2EWCA 1GO1A 3FFMA 3WGMA 4O4HA 3OONA 3MBMA 4F6RA 3IKEA 3D54A 4EI8A 2Z01A 3GYQA 3VOBA 3E20B 3RYIB 3WJQA 2GZLA 5J2UA 1N8RH 4EI9A 2Z1UA 4RQOA 4RHAA 1KC8H 1IV4A 5FNVB 4C8IA 4TV9B 1JN1A 1W42A 3IMPA 2H8CA 3RYIA 3K12A 1SZQA 5JH7B 1W55A 5EYPB 3I3FA 3CXCF 2QI2A 3M4SA 3V7QA 5FNVA 5EB1B 3S0YA 4TV9A 1TUBB 3LWPC 3CG6A 1FFXA 4M8IA 3VYTC 3JAWB 3ERNA 3JCMM 3HTNA 2BTOA 1W2BF 2R751 5EYPA 1KNJA 5BMVB 4ZOLB 3F0EA 4BT4A 3NK7A 3LWRC 4U39A 2KTVA 1FSZA 4ZK7A 5DCVA 1K73H 4TUYB 1VQPF 2L26A 1H47A 3SIVA 3QUWA 3CCMF 3WJPA 3JAWA 1VQ5F 3GTZA 4EI7A 3ZP4A 3KJKA 3N4YA 5BMVA 4ZOLA 5IT9M 1RA4A 3VI6A 1NJIH 3J7AR 3D01A 4TUYA 3BYQA 4U3JA 5JQGB 3IEWA 4R40B 4IIJB 5MN6A 5CA1B 3J81M 1YQNA 2VAPA 4LCKA 1VQ8F 3S0WA 2HS3A 4BT3A 3DDNA 1W41A 3E1YA 3CCSF 3HKCB 5JQGA 3MDOA 3N2KB 4IIJA 5CA1A 5KMGB 3RA5A 2VAWA 3JALB 3VTIC 3C9TA 3TD3A 2KGWA 4X3LA 2LBWA 3RA6A 1CLIA 5MN4A 1VK3A 3N4ZA 1S72F 3NVIB 3K0TA 3B6NA 2BTUA 2LBXA 2W8BC 3HKDB 3N2KA 4G4YA 3K2XA 4O4JB 5KMGA 2JNBA 2HRUA 3KIZA 5LXTB 2Q1XA 3JALA 1VH8A 3I56F 3WGLA 1IV2A 1FNKA 1H48A 3HKDA 3OW2F 1J7HA 1XBIA 3AGKA 5LXTA 2H8EA 3FBAA 3JASB 2IG8A 3ZP7A 4G4ZA 2OZBA 1VQVA 1IPAA 1UFYA 3ON1A 3S02A 4BW0B 2PMPA 3L7QA
chains in the Genus database with same CATH topology
1VHAA 1KNKA 4C82A 2UZHA 4C8EA 3GHZA 3F0DA 3EORA 1H47A 1VH8A 1W57A 3F0GA 3IKFA 2AMTA 3MBMA 1IV2A 1T0AA 3IKEA 3ESJA 1U40A 1W55A 3F0FA 1H48A 3IEQA 3RE3A 1GX1A 1U3LA 3KE1A 5B8FA 2GZLA 1U3PA 3ELCA 3K14A 3FBAA 1U43A 3JVHA 1JY8A 1IV3A 3P10A 3QHDA 4C8GA 3ERNA 3IEWA 3B6NA 4C81A 3Q8HA 3F6MA 3P0ZA 1IV4A 1IV1A 3T80A 1KNJA 3K2XA 3F0EA 4C8IA 2PMPA 1YQNA 3FPIA 1JN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHA A;  1KNK A;  4C82 A;  2UZH A;  4C8E A;  3GHZ A;  3F0D A;  3EOR A;  1H47 A;  1VH8 A;  1W57 A;  3F0G A;  3IKF A;  2AMT A;  3MBM A;  1IV2 A;  1T0A A;  3IKE A;  3ESJ A;  1U40 A;  1W55 A;  3F0F A;  1H48 A;  3IEQ A;  3RE3 A;  1GX1 A;  1U3L A;  3KE1 A;  5B8F A;  2GZL A;  1U3P A;  3ELC A;  3K14 A;  3FBA A;  1U43 A;  3JVH A;  1JY8 A;  1IV3 A;  3P10 A;  3QHD A;  4C8G A;  3ERN A;  3IEW A;  3B6N A;  4C81 A;  3Q8H A;  3F6M A;  3P0Z A;  1IV4 A;  1IV1 A;  3T80 A;  1KNJ A;  3K2X A;  3F0E A;  4C8I A;  2PMP A;  1YQN A;  3FPI A;  1JN1 A; 
#chains in the Genus database with same CATH topology
 3S06 A;  1VHA A;  3SIU A;  1RLG A;  3CPW F;  3WGJ A;  4ZI7 B;  4BT5 A;  3JAS A;  2VGM A;  4DRX B;  1K9M H;  5ITZ B;  1Q86 H;  4PWT A;  5EAZ A;  1VQN F;  3IEQ A;  5JCO C;  2RB9 A;  1RQ7 A;  2QEX F;  1KQS F;  1M1K H;  2FGY A;  3KE1 A;  5B8F A;  2FC3 A;  3CC7 F;  2CHS A;  1U43 A;  4FFB B;  2OTL F;  2YXZ A;  3CCQ F;  4X1I B;  4DRX A;  2DT4 A;  2QA4 F;  1KD1 H;  5ITZ A;  5EO3 A;  4BT6 A;  3CYQ A;  1TVK B;  4O2B B;  1QAH A;  3C9U A;  3CC2 F;  1W59 A;  4FFB A;  3P4E A;  3WPW A;  3S03 A;  3VCZ A;  3WJR A;  5A2Q M;  3S0H A;  4TZZ A;  4NWO B;  2OTJ F;  5GIO C;  3I7T A;  1UI9 A;  4G4V A;  2BO1 A;  1TVK A;  4O2B A;  2CZW A;  2I6R A;  3HKB B;  5HXU A;  2ZVY A;  3ZO8 A;  1ZWZ A;  5JH7 A;  2P6Y A;  1XRG A;  3CCE F;  5JVD B;  1IV1 A;  2V9Y A;  2UYK A;  2WAL A;  3QTY A;  3LYB A;  1QVG F;  4G88 A;  3LWV C;  2UZH A;  2VAM A;  3EOR A;  2AIF A;  3O85 A;  5GIP C;  1TUB A;  1K8A H;  2HVY D;  1VQ4 F;  3CD6 F;  3HKB A;  1R1M A;  1W5E A;  3MCQ A;  5HY2 A;  2B33 A;  3JAT B;  5JVD A;  3PAF A;  1YGY A;  4HNA B;  3RYH B;  1W3E X;  1JFF B;  3VYU C;  1SA0 B;  2AIZ P;  3G6E F;  2CHT A;  3MCA B;  4XCQ A;  5GAN K;  2I6D A;  1OAP A;  1YJN F;  3JAT A;  2UYJ A;  2CWJ A;  3VYS C;  1T0K B;  3RYH A;  4I4T B;  5EWR A;  4I50 B;  1JFF A;  4X1K B;  5LP6 B;  5HY4 A;  1SA0 A;  4B45 A;  3CCL F;  1T0A A;  4BVS A;  1VQ9 F;  4B46 A;  3VO8 A;  4E6E A;  3LME A;  4EB6 B;  1ONI A;  1YI2 F;  3MQW A;  2HS4 A;  1DT9 A;  3G71 F;  3ELC A;  2ALE A;  3C8L A;  4I4T A;  4I50 A;  1SDS A;  4X1K A;  5LP6 A;  2LBT A;  2OHW A;  4C8G A;  2BTQ B;  2OTM A;  3CMA F;  5HY1 A;  3HKC A;  1Z5V A;  2N48 A;  4EB6 A;  4KWE A;  2DYY A;  3JAR B;  1KNK A;  2PHN A;  1VQ7 F;  1X7P A;  3RYF B;  5HWE A;  1CN7 A;  2HP0 B;  4TV8 B;  3CCV F;  3FD5 A;  3V4D A;  5HXZ A;  1M90 H;  3U0O A;  4I55 B;  1FNJ A;  2NMU A;  3WPX A;  1PXW A;  4BVT A;  1QVF F;  4O4J A;  2HQS C;  3JAR A;  2HX0 A;  3CCU F;  3K14 A;  2KG4 A;  2ZAU A;  4YJ2 B;  3RYF A;  3RYC B;  3OBW A;  4DXD A;  2K1S A;  4TV8 A;  1X52 A;  2ZOD A;  5EZY B;  4ERH A;  5LOV B;  4I55 A;  3T80 A;  2GLZ A;  4BVQ A;  3TD4 A;  3JAM M;  1W5B A;  3FD6 A;  2RHJ A;  4X3M A;  1COM A;  1Q81 H;  3F0G A;  4YJ2 A;  3WGK A;  3CB2 A;  3LWO C;  3G4S F;  2QTP A;  3HWU A;  3F0F A;  5LOV A;  3UT5 B;  5HY0 A;  1W40 A;  1W58 1;  4BT2 A;  3V3T A;  2KTU A;  2HS0 A;  5IJ0 B;  3CCR F;  2CVL A;  3KHN A;  3KJJ A;  3VIU A;  3C9R A;  2RHO A;  4F6R B;  1VQO F;  5MN5 A;  2ZOV A;  4ZHW A;  4ZI7 A;  5FLX M;  3WXM B;  4O4I B;  3UT5 A;  4ZHQ B;  3N2G B;  2IQQ A;  3HKE B;  5IJ0 A;  2AMT A;  2Z1T A;  4X1Y B;  4BT7 A;  1U40 A;  1RQ2 A;  4X1I A;  5IJ9 B;  1XV2 A;  2VXY A;  5J2T B;  3JAK B;  3D00 A;  5EB0 A;  4WBN B;  3ZOP A;  4O4I A;  3HJW C;  4ZHQ A;  4B62 A;  3LFO A;  1U3L A;  1CK2 A;  3N2G A;  4NQ3 A;  4LNU B;  3HKE A;  3DC2 A;  4ZHY B;  1RLU A;  4O2A B;  4NUT A;  4X1Y A;  5EIB C;  1ODE A;  3F6M A;  5IJ9 A;  3M84 A;  5J2T A;  3NK6 A;  3JAK A;  4WBN A;  1VQK F;  2F9Z C;  4X20 B;  5G4U C;  1FFX B;  3GHZ A;  3CYP B;  4LNU A;  3VOA A;  2Z1E A;  1VQL F;  3ESJ A;  4O2A A;  5AVM A;  1YIT F;  1W5F A;  2MQE A;  3RE3 A;  1Z5W A;  2G9I A;  4X20 A;  1Q7Y H;  4BY9 D;  3JVH A;  5GON B;  1NQ3 A;  1XHO A;  3LDT A;  5HP8 A;  3Q8H A;  3P0Z A;  3VMF B;  1JD1 A;  4C4W C;  4G4W A;  1JJ2 F;  1W5A A;  1YIJ F;  2H6L A;  4HNA A;  4U3J B;  5HP7 A;  5GON A;  4B5C A;  2CW4 A;  4O4L B;  5CB4 B;  5LYJ B;  2HRY A;  3IR9 A;  1Q8R A;  1GX1 A;  3LWQ C;  3HAX D;  1GZ0 A;  1X25 A;  1H7M A;  3I55 F;  1YJW F;  1U3P A;  2CSL A;  1OFU A;  5KX5 B;  2Z1F A;  1GO0 A;  3WGN A;  2R6R 1;  3CME F;  4BVR A;  4O4L A;  1NMU B;  5C8Y B;  2ZF8 A;  5CB4 A;  5LYJ A;  1X7O A;  3OBY A;  3FPI A;  4C82 A;  2Q1Y A;  2UYN B;  1PF5 A;  3IKF A;  4YJ3 B;  5KX5 A;  1E7K A;  5FJ4 C;  5JCO A;  5C8Y A;  3TD5 A;  3PLA C;  1Q82 H;  1VQ6 F;  5GIN C;  4IHJ B;  2GVI A;  4ZHV A;  2UYN A;  1QD9 A;  1JY8 A;  2ZVZ A;  3P10 A;  4YJ3 A;  2HP0 A;  2HP3 A;  3QHD A;  1QU9 A;  4G4X A;  4C81 A;  2VGN A;  5EIB D;  1VQM F;  5IYZ B;  2IAF A;  4C8E A;  3CC4 F;  5CA0 B;  5GAP K;  4IHJ A;  5LA6 B;  3F0D A;  1W57 A;  2RHH A;  1DBF A;  3E22 B;  3RYC A;  5EZY A;  3V7E A;  3M1X A;  2YYE A;  5IYZ A;  3J80 M;  5CA0 A;  5LA6 A;  4O4H B;  3R0P A;  1YHQ F;  1IV3 A;  3E22 A;  5LP6 C;  3C9S A;  3CPQ A;  3NMU C;  2LCA A;  2UYP A;  1YJ9 F;  2RHL A;  3CCJ F;  5J2U B;  3NVK E;  5G4V C;  2EWC A;  1GO1 A;  3FFM A;  3WGM A;  4O4H A;  3OON A;  3MBM A;  4F6R A;  3IKE A;  3D54 A;  4EI8 A;  2Z01 A;  3GYQ A;  3VOB A;  3E20 B;  3RYI B;  3WJQ A;  2GZL A;  5J2U A;  1N8R H;  4EI9 A;  2Z1U A;  4RQO A;  4RHA A;  1KC8 H;  1IV4 A;  5FNV B;  4C8I A;  4TV9 B;  1JN1 A;  1W42 A;  3IMP A;  2H8C A;  3RYI A;  3K12 A;  1SZQ A;  5JH7 B;  1W55 A;  5EYP B;  3I3F A;  3CXC F;  2QI2 A;  3M4S A;  3V7Q A;  5FNV A;  5EB1 B;  3S0Y A;  4TV9 A;  1TUB B;  3LWP C;  3CG6 A;  1FFX A;  4M8I A;  3VYT C;  3JAW B;  3ERN A;  3JCM M;  3HTN A;  2BTO A;  1W2B F;  2R75 1;  5EYP A;  1KNJ A;  5BMV B;  4ZOL B;  3F0E A;  4BT4 A;  3NK7 A;  3LWR C;  4U39 A;  2KTV A;  1FSZ A;  4ZK7 A;  5DCV A;  1K73 H;  4TUY B;  1VQP F;  2L26 A;  1H47 A;  3SIV A;  3QUW A;  3CCM F;  3WJP A;  3JAW A;  1VQ5 F;  3GTZ A;  4EI7 A;  3ZP4 A;  3KJK A;  3N4Y A;  5BMV A;  4ZOL A;  5IT9 M;  1RA4 A;  3VI6 A;  1NJI H;  3J7A R;  3D01 A;  4TUY A;  3BYQ A;  4U3J A;  5JQG B;  3IEW A;  4R40 B;  4IIJ B;  5MN6 A;  5CA1 B;  3J81 M;  1YQN A;  2VAP A;  4LCK A;  1VQ8 F;  3S0W A;  2HS3 A;  4BT3 A;  3DDN A;  1W41 A;  3E1Y A;  3CCS F;  3HKC B;  5JQG A;  3MDO A;  3N2K B;  4IIJ A;  5CA1 A;  5KMG B;  3RA5 A;  2VAW A;  3JAL B;  3VTI C;  3C9T A;  3TD3 A;  2KGW A;  4X3L A;  2LBW A;  3RA6 A;  1CLI A;  5MN4 A;  1VK3 A;  3N4Z A;  1S72 F;  3NVI B;  3K0T A;  3B6N A;  2BTU A;  2LBX A;  2W8B C;  3HKD B;  3N2K A;  4G4Y A;  3K2X A;  4O4J B;  5KMG A;  2JNB A;  2HRU A;  3KIZ A;  5LXT B;  2Q1X A;  3JAL A;  1VH8 A;  3I56 F;  3WGL A;  1IV2 A;  1FNK A;  1H48 A;  3HKD A;  3OW2 F;  1J7H A;  1XBI A;  3AGK A;  5LXT A;  2H8E A;  3FBA A;  3JAS B;  2IG8 A;  3ZP7 A;  4G4Z A;  2OZB A;  1VQV A;  1IPA A;  1UFY A;  3ON1 A;  3S02 A;  4BW0 B;  2PMP A;  3L7Q A; 
#chains in the Genus database with same CATH homology
 1VHA A;  1KNK A;  4C82 A;  2UZH A;  4C8E A;  3GHZ A;  3F0D A;  3EOR A;  1H47 A;  1VH8 A;  1W57 A;  3F0G A;  3IKF A;  2AMT A;  3MBM A;  1IV2 A;  1T0A A;  3IKE A;  3ESJ A;  1U40 A;  1W55 A;  3F0F A;  1H48 A;  3IEQ A;  3RE3 A;  1GX1 A;  1U3L A;  3KE1 A;  5B8F A;  2GZL A;  1U3P A;  3ELC A;  3K14 A;  3FBA A;  1U43 A;  3JVH A;  1JY8 A;  1IV3 A;  3P10 A;  3QHD A;  4C8G A;  3ERN A;  3IEW A;  3B6N A;  4C81 A;  3Q8H A;  3F6M A;  3P0Z A;  1IV4 A;  1IV1 A;  3T80 A;  1KNJ A;  3K2X A;  3F0E A;  4C8I A;  2PMP A;  1YQN A;  3FPI A;  1JN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...