3IEWA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
b'SMDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3iewA00
3RE3A 1T0AA 1IV1A 1KNKA 1KNJA 3IEWA 3ERNA 3K2XA 3IEQA 3MBMA 3JVHA 5B8FA 2AMTA 1IV3A 1H47A 4C8GA 3K14A 3FBAA 1U3PA 1U40A 1GX1A 3ELCA 3F0FA 3IKFA 3QHDA 1JN1A 3F0DA 1VHAA 1YQNA 3FPIA 3B6NA 4C82A 1IV2A 1VH8A 3F0GA 3IKEA 3F0EA 1IV4A 1U43A 1U3LA 1W57A 2GZLA 3F6MA 3Q8HA 4C8IA 2UZHA 3EORA 4C8EA 3T80A 4C81A 3P10A 1W55A 1JY8A 3KE1A 1H48A 3ESJA 3P0ZA 3GHZA 2PMPA
chains in the Genus database with same CATH superfamily
1H7MA 1ODEA 3FFMA 5G4UC 2CWJA 3RA5A 2VGNA 5LOVA 2Q1XA 4R40B 1Z5WA 3CD6F 3O85A 5HY0A 4ZI7B 5LA6B 3CB2A 3AGKA 3PLAC 3HKCB 3LWRC 3VTIC 5LYJA 3ZP7A 1IV2A 3KJJA 1M90H 2OTJF 3LWOC 1TUBB 1DBFA 1JFFB 1OFUA 1U43A 1U3LA 3J80M 1K73H 3WGLA 2Z01A 4X1IA 3TD5A 5EZYA 4BY9D 2P6YA 3JAWB 4ZHYB 3J7AR 4WBNA 1W41A 2BTQB 1OAPA 3VOAA 2DT4A 3K2XA 4U3JA 3VOBA 5IJ9B 5KMGB 4F6RA 3NMUC 1KD1H 3ELCA 4X3MA 3LWQC 1FSZA 3IKFA 5ITZB 5LP6C 3P4EA 2HS4A 4PWTA 1Q81H 1QVFF 3N2KA 2GZLA 3TD4A 2VAPA 5KX5A 2LBWA 4B45A 3T80A 5JH7B 2QEXF 1H48A 3BYQA 3IEWA 3JCMM 2B33A 3E22A 2LBTA 4NWOB 1KC8H 3KHNA 1VQ7F 1VQ4F 3D00A 4RHAA 3HKDB 3QHDA 5C8YB 3CCUF 5HWEA 3IKEA 3IR9A 3LDTA 2VXYA 5CA0B 5G4VC 4YJ3B 2GVIA 4BT4A 3JAKB 2HS0A 5JVDB 2CHTA 2AIZP 3KE1A 4ZHVA 4C4WC 3ESJA 4HNAA 1PF5A 1SZQA 2I6DA 3CCJF 1E7KA 5HXUA 3M4SA 4LNUA 3S0YA 3ON1A 3NK7A 1U40A 2RHHA 1SA0A 1W5BA 4O2BB 1YJWF 1VHAA 4FFBB 4O4HB 4I55B 3VYTC 3JALB 2AIFA 3C8LA 3KJKA 4BVTA 2BTOA 1CN7A 2Z1TA 5GANK 1Q7YH 2HRYA 1J7HA 1FFXA 1W55A 2F9ZC 4X20A 1YIJF 3CCMF 3C9SA 2PMPA 3TD3A 3HKBB 3LFOA 2H8CA 3K0TA 4DRXB 1XBIA 3HAXD 3NVKE 2N48A 4ZOLB 1S72F 2NMUA 3ZP4A 5B8FA 3RYIA 5BMVB 2HQSC 4O4IA 4G4WA 2R6R1 3CMAF 3CC7F 2CHSA 4KWEA 3N4YA 4O2AA 3F0FA 3VMFB 4YJ2B 2IG8A 3F0DA 3JARA 5EAZA 3RYFB 3RYHB 2IAFA 4TV9A 1ONIA 4TUYA 1CLIA 3VI6A 3LWVC 1TVKA 1VK3A 3HJWC 2PHNA 5GIPC 3C9UA 2BO1A 4IIJB 4X1KA 1CK2A 3C9TA 2I6RA 5HY1A 2UYPA 5EYPB 3ZOPA 5LOVB 1QVGF 4E6EA 1W42A 3MCAB 1U3PA 4X3LA 3WJQA 1T0KB 1W5AA 3LYBA 4ZHQA 3FPIA 4C82A 5HP8A 3LMEA 2KTVA 5LYJB 3VO8A 1XV2A 1VQLF 3F6MA 4C8IA 3JATA 3UT5A 3VIUA 4C8EA 1YITF 2UYNA 2FGYA 4X1IB 4I50A 3P0ZA 5EZYB 5IYZA 2OTMA 1QU9A 3G71F 4WBNB 3ERNA 5CB4A 3I56F 3M84A 4U3JB 5LP6A 2KG4A 3VYSC 2K1SA 3RYCA 5EB1B 5CA1A 2ZVYA 1TUBA 4F6RB 1UFYA 3OONA 1NJIH 1W3EX 2FC3A 3N4ZA 1IV4A 1NQ3A 3Q8HA 4BT7A 1RLUA 5HP7A 3CC2F 3P10A 3S03A 5KX5B 1Q82H 3WJPA 5MN4A 5J2TA 1NMUB 3LWPC 4BW0B 5LXTB 1VQMF 2WALA 1DT9A 3E22B 3U0OA 5MN5A 4EB6A 2LBXA 3CPWF 4DXDA 1YJ9F 1GO0A 3F0GA 4O4LA 4TV8A 4U39A 3N2GA 5FLXM 1W59A 5FJ4C 2G9IA 3G6EF 5HY2A 2ZAUA 1IPAA 1W581 5JQGA 3JASB 2HP0A 2R751 5EWRA 2QI2A 5JCOC 4IHJA 1W40A 1T0AA 5FNVB 3G4SF 2QTPA 1RA4A 2RHOA 4I4TA 5MN6A 3VCZA 3PAFA 4LNUB 3OBWA 1GO1A 1SA0B 5GONA 5GIOC 2KGWA 1X52A 2CW4A 5A2QM 5GAPK 5JVDA 1VQVA 1ZWZA 2UYKA 2VAMA 4X1YA 1X25A 4B62A 3OBYA 1FFXB 4X20B 5HXZA 3RE3A 1Q86H 1KNKA 3R0PA 5J2UA 5IT9M 3CG6A 2YYEA 4G4XA 1VQ6F 3RYIB 3HKEA 4O4HA 4I55A 2RHJA 4O2AB 3WXMB 1JJ2F 3SIUA 3B6NA 4BVSA 3RA6A 2V9YA 3JARB 4EI8A 3D54A 1M1KH 1R1MA 4LCKA 3OW2F 2LCAA 4M8IA 4TUYB 2UZHA 3E20B 5HY4A 1GZ0A 1TVKB 4BT6A 4C81A 2HX0A 1FNKA 3HKBA 1QD9A 4BT5A 3V3TA 5GINC 1IV1A 3V4DA 3CCSF 3I55F 3WGMA 2HRUA 4X1KB 1YJNF 5DCVA 3HWUA 3RYFA 4ZK7A 5IJ0A 2CVLA 1VH8A 1VQ9F 4ZHQB 5EO3A 2RB9A 3ZO8A 3S0HA 3CYQA 1YGYA 4O4JA 3WPWA 4G4YA 2Z1EA 2OZBA 3JATB 3GYQA 1VQ5F 2BTUA 2UYNB 3S02A 1VQOF 2Z1UA 4I50B 5EYPA 3VYUC 5IYZB 3JVHA 1YI2F 4ZI7A 5LA6A 5CB4B 5AVMA 1H47A 3HKCA 2Q1YA 3FBAA 5LP6B 3RYCB 3FD6A 1VQ8F 4ZHWA 1Z5VA 5CA1B 3MDOA 2H6LA 3QTYA 1SDSA 3NVIB 1JFFA 3CMEF 1XRGA 3I3FA 3F0EA 2H8EA 4G4VA 1W57A 1W5EA 1K8AH 3N2KB 3WGJA 3JAWA 3CCRF 4EI9A 3WPXA 2L26A 2ZOVA 2JNBA 3MQWA 2VAWA 5J2TB 5IJ9A 2OHWA 2ZVZA 2W8BC 4B5CA 5KMGA 1IV3A 2HVYD 3CXCF 3S0WA 2EWCA 5ITZA 3IMPA 1X7PA 4EB6B 1RQ2A 2VGMA 2ZF8A 1Q8RA 1PXWA 5JCOA 4BT3A 1VQPF 4O4LB 4TV8B 3GTZA 3N2GB 4NQ3A 1FNJA 2HP3A 5JH7A 1XHOA 3EORA 2OTLF 1JY8A 5JQGB 5LXTA 2IQQA 2HP0B 4B46A 2Z1FA 3CCLF 3WGNA 4BVRA 2QA4F 4IHJB 3CCVF 4HNAB 3L7QA 3HTNA 1COMA 4BVQA 3HKDA 3D01A 5C8YA 4I4TB 3I7TA 3C9RA 1JN1A 5CA0A 1VQKF 4YJ3A 1KQSF 5GONB 3JASA 5EB0A 3JAKA 1YHQF 3NK6A 3CCEF 2DYYA 3CC4F 5FNVA 4X1YB 2RHLA 3SIVA 4G4ZA 1KNJA 3IEQA 4RQOA 1JD1A 5J2UB 3MCQA 2AMTA 2MQEA 4C8GA 3K14A 4O2BA 4ERHA 1GX1A 4FFBA 2ZODA 1N8RH 4O4IB 3HKEB 3DC2A 3JALA 3CPQA 2YXZA 3J81M 3K12A 3V7EA 3JAMM 1W2BF 2UYJA 3CYPB 4TV9B 1VQNF 1X7OA 5EIBC 4G88A 1RLGA 4EI7A 2CZWA 2GLZA 4DRXA 3DDNA 4ZOLA 5BMVA 3WJRA 3MBMA 3KIZA 2KTUA 5EIBD 3CCQF 4YJ2A 1W5FA 3E1YA 3M1XA 3RYHA 1QAHA 1RQ7A 1YQNA 2ALEA 5IJ0B 4TZZA 1UI9A 2CSLA 4BT2A 4NUTA 1K9MH 2HS3A 3WGKA 3QUWA 3V7QA 4O4JB 4XCQA 4IIJA 3UT5B 3GHZA 3FD5A 3S06A
chains in the Genus database with same CATH topology
3RE3A 1T0AA 1IV1A 1KNKA 1KNJA 3IEWA 3ERNA 3K2XA 3IEQA 3MBMA 3JVHA 5B8FA 2AMTA 1IV3A 1H47A 4C8GA 3K14A 3FBAA 1U3PA 1U40A 1GX1A 3ELCA 3F0FA 3IKFA 3QHDA 1JN1A 3F0DA 1VHAA 1YQNA 3FPIA 3B6NA 4C82A 1IV2A 1VH8A 3F0GA 3IKEA 3F0EA 1IV4A 1U43A 1U3LA 1W57A 2GZLA 3F6MA 3Q8HA 4C8IA 2UZHA 3EORA 4C8EA 3T80A 4C81A 3P10A 1W55A 1JY8A 3KE1A 1H48A 3ESJA 3P0ZA 3GHZA 2PMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RE3 A;  1T0A A;  1IV1 A;  1KNK A;  1KNJ A;  3IEW A;  3ERN A;  3K2X A;  3IEQ A;  3MBM A;  3JVH A;  5B8F A;  2AMT A;  1IV3 A;  1H47 A;  4C8G A;  3K14 A;  3FBA A;  1U3P A;  1U40 A;  1GX1 A;  3ELC A;  3F0F A;  3IKF A;  3QHD A;  1JN1 A;  3F0D A;  1VHA A;  1YQN A;  3FPI A;  3B6N A;  4C82 A;  1IV2 A;  1VH8 A;  3F0G A;  3IKE A;  3F0E A;  1IV4 A;  1U43 A;  1U3L A;  1W57 A;  2GZL A;  3F6M A;  3Q8H A;  4C8I A;  2UZH A;  3EOR A;  4C8E A;  3T80 A;  4C81 A;  3P10 A;  1W55 A;  1JY8 A;  3KE1 A;  1H48 A;  3ESJ A;  3P0Z A;  3GHZ A;  2PMP A; 
#chains in the Genus database with same CATH topology
 1H7M A;  1ODE A;  3FFM A;  5G4U C;  2CWJ A;  3RA5 A;  2VGN A;  5LOV A;  2Q1X A;  4R40 B;  1Z5W A;  3CD6 F;  3O85 A;  5HY0 A;  4ZI7 B;  5LA6 B;  3CB2 A;  3AGK A;  3PLA C;  3HKC B;  3LWR C;  3VTI C;  5LYJ A;  3ZP7 A;  1IV2 A;  3KJJ A;  1M90 H;  2OTJ F;  3LWO C;  1TUB B;  1DBF A;  1JFF B;  1OFU A;  1U43 A;  1U3L A;  3J80 M;  1K73 H;  3WGL A;  2Z01 A;  4X1I A;  3TD5 A;  5EZY A;  4BY9 D;  2P6Y A;  3JAW B;  4ZHY B;  3J7A R;  4WBN A;  1W41 A;  2BTQ B;  1OAP A;  3VOA A;  2DT4 A;  3K2X A;  4U3J A;  3VOB A;  5IJ9 B;  5KMG B;  4F6R A;  3NMU C;  1KD1 H;  3ELC A;  4X3M A;  3LWQ C;  1FSZ A;  3IKF A;  5ITZ B;  5LP6 C;  3P4E A;  2HS4 A;  4PWT A;  1Q81 H;  1QVF F;  3N2K A;  2GZL A;  3TD4 A;  2VAP A;  5KX5 A;  2LBW A;  4B45 A;  3T80 A;  5JH7 B;  2QEX F;  1H48 A;  3BYQ A;  3IEW A;  3JCM M;  2B33 A;  3E22 A;  2LBT A;  4NWO B;  1KC8 H;  3KHN A;  1VQ7 F;  1VQ4 F;  3D00 A;  4RHA A;  3HKD B;  3QHD A;  5C8Y B;  3CCU F;  5HWE A;  3IKE A;  3IR9 A;  3LDT A;  2VXY A;  5CA0 B;  5G4V C;  4YJ3 B;  2GVI A;  4BT4 A;  3JAK B;  2HS0 A;  5JVD B;  2CHT A;  2AIZ P;  3KE1 A;  4ZHV A;  4C4W C;  3ESJ A;  4HNA A;  1PF5 A;  1SZQ A;  2I6D A;  3CCJ F;  1E7K A;  5HXU A;  3M4S A;  4LNU A;  3S0Y A;  3ON1 A;  3NK7 A;  1U40 A;  2RHH A;  1SA0 A;  1W5B A;  4O2B B;  1YJW F;  1VHA A;  4FFB B;  4O4H B;  4I55 B;  3VYT C;  3JAL B;  2AIF A;  3C8L A;  3KJK A;  4BVT A;  2BTO A;  1CN7 A;  2Z1T A;  5GAN K;  1Q7Y H;  2HRY A;  1J7H A;  1FFX A;  1W55 A;  2F9Z C;  4X20 A;  1YIJ F;  3CCM F;  3C9S A;  2PMP A;  3TD3 A;  3HKB B;  3LFO A;  2H8C A;  3K0T A;  4DRX B;  1XBI A;  3HAX D;  3NVK E;  2N48 A;  4ZOL B;  1S72 F;  2NMU A;  3ZP4 A;  5B8F A;  3RYI A;  5BMV B;  2HQS C;  4O4I A;  4G4W A;  2R6R 1;  3CMA F;  3CC7 F;  2CHS A;  4KWE A;  3N4Y A;  4O2A A;  3F0F A;  3VMF B;  4YJ2 B;  2IG8 A;  3F0D A;  3JAR A;  5EAZ A;  3RYF B;  3RYH B;  2IAF A;  4TV9 A;  1ONI A;  4TUY A;  1CLI A;  3VI6 A;  3LWV C;  1TVK A;  1VK3 A;  3HJW C;  2PHN A;  5GIP C;  3C9U A;  2BO1 A;  4IIJ B;  4X1K A;  1CK2 A;  3C9T A;  2I6R A;  5HY1 A;  2UYP A;  5EYP B;  3ZOP A;  5LOV B;  1QVG F;  4E6E A;  1W42 A;  3MCA B;  1U3P A;  4X3L A;  3WJQ A;  1T0K B;  1W5A A;  3LYB A;  4ZHQ A;  3FPI A;  4C82 A;  5HP8 A;  3LME A;  2KTV A;  5LYJ B;  3VO8 A;  1XV2 A;  1VQL F;  3F6M A;  4C8I A;  3JAT A;  3UT5 A;  3VIU A;  4C8E A;  1YIT F;  2UYN A;  2FGY A;  4X1I B;  4I50 A;  3P0Z A;  5EZY B;  5IYZ A;  2OTM A;  1QU9 A;  3G71 F;  4WBN B;  3ERN A;  5CB4 A;  3I56 F;  3M84 A;  4U3J B;  5LP6 A;  2KG4 A;  3VYS C;  2K1S A;  3RYC A;  5EB1 B;  5CA1 A;  2ZVY A;  1TUB A;  4F6R B;  1UFY A;  3OON A;  1NJI H;  1W3E X;  2FC3 A;  3N4Z A;  1IV4 A;  1NQ3 A;  3Q8H A;  4BT7 A;  1RLU A;  5HP7 A;  3CC2 F;  3P10 A;  3S03 A;  5KX5 B;  1Q82 H;  3WJP A;  5MN4 A;  5J2T A;  1NMU B;  3LWP C;  4BW0 B;  5LXT B;  1VQM F;  2WAL A;  1DT9 A;  3E22 B;  3U0O A;  5MN5 A;  4EB6 A;  2LBX A;  3CPW F;  4DXD A;  1YJ9 F;  1GO0 A;  3F0G A;  4O4L A;  4TV8 A;  4U39 A;  3N2G A;  5FLX M;  1W59 A;  5FJ4 C;  2G9I A;  3G6E F;  5HY2 A;  2ZAU A;  1IPA A;  1W58 1;  5JQG A;  3JAS B;  2HP0 A;  2R75 1;  5EWR A;  2QI2 A;  5JCO C;  4IHJ A;  1W40 A;  1T0A A;  5FNV B;  3G4S F;  2QTP A;  1RA4 A;  2RHO A;  4I4T A;  5MN6 A;  3VCZ A;  3PAF A;  4LNU B;  3OBW A;  1GO1 A;  1SA0 B;  5GON A;  5GIO C;  2KGW A;  1X52 A;  2CW4 A;  5A2Q M;  5GAP K;  5JVD A;  1VQV A;  1ZWZ A;  2UYK A;  2VAM A;  4X1Y A;  1X25 A;  4B62 A;  3OBY A;  1FFX B;  4X20 B;  5HXZ A;  3RE3 A;  1Q86 H;  1KNK A;  3R0P A;  5J2U A;  5IT9 M;  3CG6 A;  2YYE A;  4G4X A;  1VQ6 F;  3RYI B;  3HKE A;  4O4H A;  4I55 A;  2RHJ A;  4O2A B;  3WXM B;  1JJ2 F;  3SIU A;  3B6N A;  4BVS A;  3RA6 A;  2V9Y A;  3JAR B;  4EI8 A;  3D54 A;  1M1K H;  1R1M A;  4LCK A;  3OW2 F;  2LCA A;  4M8I A;  4TUY B;  2UZH A;  3E20 B;  5HY4 A;  1GZ0 A;  1TVK B;  4BT6 A;  4C81 A;  2HX0 A;  1FNK A;  3HKB A;  1QD9 A;  4BT5 A;  3V3T A;  5GIN C;  1IV1 A;  3V4D A;  3CCS F;  3I55 F;  3WGM A;  2HRU A;  4X1K B;  1YJN F;  5DCV A;  3HWU A;  3RYF A;  4ZK7 A;  5IJ0 A;  2CVL A;  1VH8 A;  1VQ9 F;  4ZHQ B;  5EO3 A;  2RB9 A;  3ZO8 A;  3S0H A;  3CYQ A;  1YGY A;  4O4J A;  3WPW A;  4G4Y A;  2Z1E A;  2OZB A;  3JAT B;  3GYQ A;  1VQ5 F;  2BTU A;  2UYN B;  3S02 A;  1VQO F;  2Z1U A;  4I50 B;  5EYP A;  3VYU C;  5IYZ B;  3JVH A;  1YI2 F;  4ZI7 A;  5LA6 A;  5CB4 B;  5AVM A;  1H47 A;  3HKC A;  2Q1Y A;  3FBA A;  5LP6 B;  3RYC B;  3FD6 A;  1VQ8 F;  4ZHW A;  1Z5V A;  5CA1 B;  3MDO A;  2H6L A;  3QTY A;  1SDS A;  3NVI B;  1JFF A;  3CME F;  1XRG A;  3I3F A;  3F0E A;  2H8E A;  4G4V A;  1W57 A;  1W5E A;  1K8A H;  3N2K B;  3WGJ A;  3JAW A;  3CCR F;  4EI9 A;  3WPX A;  2L26 A;  2ZOV A;  2JNB A;  3MQW A;  2VAW A;  5J2T B;  5IJ9 A;  2OHW A;  2ZVZ A;  2W8B C;  4B5C A;  5KMG A;  1IV3 A;  2HVY D;  3CXC F;  3S0W A;  2EWC A;  5ITZ A;  3IMP A;  1X7P A;  4EB6 B;  1RQ2 A;  2VGM A;  2ZF8 A;  1Q8R A;  1PXW A;  5JCO A;  4BT3 A;  1VQP F;  4O4L B;  4TV8 B;  3GTZ A;  3N2G B;  4NQ3 A;  1FNJ A;  2HP3 A;  5JH7 A;  1XHO A;  3EOR A;  2OTL F;  1JY8 A;  5JQG B;  5LXT A;  2IQQ A;  2HP0 B;  4B46 A;  2Z1F A;  3CCL F;  3WGN A;  4BVR A;  2QA4 F;  4IHJ B;  3CCV F;  4HNA B;  3L7Q A;  3HTN A;  1COM A;  4BVQ A;  3HKD A;  3D01 A;  5C8Y A;  4I4T B;  3I7T A;  3C9R A;  1JN1 A;  5CA0 A;  1VQK F;  4YJ3 A;  1KQS F;  5GON B;  3JAS A;  5EB0 A;  3JAK A;  1YHQ F;  3NK6 A;  3CCE F;  2DYY A;  3CC4 F;  5FNV A;  4X1Y B;  2RHL A;  3SIV A;  4G4Z A;  1KNJ A;  3IEQ A;  4RQO A;  1JD1 A;  5J2U B;  3MCQ A;  2AMT A;  2MQE A;  4C8G A;  3K14 A;  4O2B A;  4ERH A;  1GX1 A;  4FFB A;  2ZOD A;  1N8R H;  4O4I B;  3HKE B;  3DC2 A;  3JAL A;  3CPQ A;  2YXZ A;  3J81 M;  3K12 A;  3V7E A;  3JAM M;  1W2B F;  2UYJ A;  3CYP B;  4TV9 B;  1VQN F;  1X7O A;  5EIB C;  4G88 A;  1RLG A;  4EI7 A;  2CZW A;  2GLZ A;  4DRX A;  3DDN A;  4ZOL A;  5BMV A;  3WJR A;  3MBM A;  3KIZ A;  2KTU A;  5EIB D;  3CCQ F;  4YJ2 A;  1W5F A;  3E1Y A;  3M1X A;  3RYH A;  1QAH A;  1RQ7 A;  1YQN A;  2ALE A;  5IJ0 B;  4TZZ A;  1UI9 A;  2CSL A;  4BT2 A;  4NUT A;  1K9M H;  2HS3 A;  3WGK A;  3QUW A;  3V7Q A;  4O4J B;  4XCQ A;  4IIJ A;  3UT5 B;  3GHZ A;  3FD5 A;  3S06 A; 
#chains in the Genus database with same CATH homology
 3RE3 A;  1T0A A;  1IV1 A;  1KNK A;  1KNJ A;  3IEW A;  3ERN A;  3K2X A;  3IEQ A;  3MBM A;  3JVH A;  5B8F A;  2AMT A;  1IV3 A;  1H47 A;  4C8G A;  3K14 A;  3FBA A;  1U3P A;  1U40 A;  1GX1 A;  3ELC A;  3F0F A;  3IKF A;  3QHD A;  1JN1 A;  3F0D A;  1VHA A;  1YQN A;  3FPI A;  3B6N A;  4C82 A;  1IV2 A;  1VH8 A;  3F0G A;  3IKE A;  3F0E A;  1IV4 A;  1U43 A;  1U3L A;  1W57 A;  2GZL A;  3F6M A;  3Q8H A;  4C8I A;  2UZH A;  3EOR A;  4C8E A;  3T80 A;  4C81 A;  3P10 A;  1W55 A;  1JY8 A;  3KE1 A;  1H48 A;  3ESJ A;  3P0Z A;  3GHZ A;  2PMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...