3IEWA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
SMDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3iewA00
4C8GA 1IV2A 1VHAA 1H48A 2PMPA 1U3PA 3Q8HA 1KNJA 2AMTA 1U40A 3B6NA 3IEWA 4C8EA 1KNKA 4C82A 3F0FA 1IV3A 1T0AA 3ESJA 1GX1A 3P0ZA 3F0EA 3RE3A 3T80A 1U43A 2GZLA 3K14A 1JY8A 3P10A 3FPIA 3FBAA 3K2XA 4C8IA 1JN1A 3F0GA 3GHZA 3MBMA 1VH8A 1W57A 3EORA 1YQNA 3ELCA 1IV4A 3IEQA 1U3LA 3KE1A 3F0DA 4C81A 3IKEA 2UZHA 1H47A 3JVHA 3ERNA 1IV1A 1W55A 3QHDA 3F6MA 5B8FA 3IKFA
chains in the Genus database with same CATH superfamily
1IV2A 3C9RA 3QUWA 5HP8A 4BW0B 3WJPA 4X1KB 5FLXM 3VYUC 1NMUB 3CYQA 3S0WA 1VQ5F 1DBFA 3NK7A 5JCOC 1FNKA 2RHHA 3I3FA 3RYHA 4U3JA 5EAZA 3HKBA 3LMEA 2OTJF 3MBMA 1FFXB 3ON1A 4IIJB 1W57A 1YIJF 3NMUC 4LCKA 1VQ6F 5CA1B 4X1YB 5A2QM 3VTIC 3NVKE 1UI9A 1GZ0A 3IKEA 3CC7F 1GO1A 1X25A 1FSZA 3HWUA 3N4ZA 5HY2A 3CCSF 1H48A 1XRGA 4NQ3A 3VI6A 1Q8RA 2HP3A 3DC2A 2ZODA 5JH7B 2UYNA 4ZI7A 4BT7A 1RLUA 3D01A 3D00A 3ESJA 3RE3A 3F0EA 4X1IB 1U43A 1JY8A 3OW2F 1W5AA 4BVSA 5KX5B 3LFOA 3I7TA 3V7EA 4BVQA 4G4VA 3TD3A 3N2GB 4I55A 1FNJA 2H8CA 1OAPA 1H47A 2JNBA 2QEXF 3F0FA 2CSLA 3LWOC 4ERHA 5CA0A 3L7QA 3N4YA 3UT5A 3JAKA 4WBNB 5EIBD 1Q81H 1QU9A 1U40A 4C8EA 5MN5A 5LYJB 4G4WA 5LP6A 4B46A 3JARA 4IHJA 3S02A 5IJ0A 3G71F 3LDTA 5J2UB 4TV8B 3P10A 1QD9A 4NUTA 4BT4A 4C8IA 5IJ9B 2RHOA 3HKDB 3ZO8A 3S03A 4O4IA 4DXDA 3VYSC 5EZYB 3MCAB 4O4LB 4DRXA 4ZOLB 5LOVA 3JALB 1M90H 4C8GA 3MDOA 3M4SA 4LNUB 3GYQA 4TV9A 3WJRA 3M84A 3P0ZA 3VMFB 2HQSC 3VYTC 2Z01A 1W42A 1K9MH 4X20B 2CHSA 4F6RB 3RA6A 2AIFA 3D54A 2UYJA 5MN6A 3SIVA 1W3EX 5JCOA 5HY1A 3RYCB 4E6EA 3HKEA 2ZVZA 5JVDB 1W55A 4EB6A 3JAWA 4ZHYB 3IKFA 1X7OA 5KMGA 2PMPA 1TUBB 1XBIA 4I50B 4R40B 5LA6B 4O2BB 3MCQA 1JFFB 3CMAF 1K73H 3JATB 3SIUA 3HTNA 1VQPF 5FNVB 2P6YA 1U3LA 5EYPA 3KE1A 3CPWF 4YJ2A 3P4EA 5HWEA 3JASB 4O4HB 3QHDA 1YJNF 2UYKA 3WGLA 2ALEA 2BTOA 4FFBA 5J2TB 2YYEA 2DYYA 2EWCA 3VO8A 2KTUA 3CCMF 4C4WC 3IR9A 2BO1A 3WGJA 3TD4A 4EI7A 3KHNA 1QAHA 1VQ7F 3I55F 5EB0A 1OFUA 4RHAA 1RQ2A 1VQ9F 4HNAB 3O85A 4X1YA 3RYHB 4U3JB 5IT9M 3HKBB 3B6NA 1S72F 5AVMA 2YXZA 3ZOPA 4ZK7A 4C82A 4EI9A 5FJ4C 1N8RH 5CB4B 2HX0A 4G4XA 3TD5A 3NVIB 3PAFA 2RB9A 1CK2A 3GHZA 3E20B 3CYPB 1W2BF 1CN7A 2UYNB 3HKCA 1W5FA 4G4ZA 3V4DA 4B62A 3N2GA 2IAFA 2I6RA 1NQ3A 4I4TB 3CD6F 1ODEA 2OZBA 5EWRA 3MQWA 5HXZA 4O4JA 5JQGA 3CXCF 3ZP4A 1TVKB 4I55B 3WPXA 4WBNA 4ZHQA 3K2XA 4BT2A 5LYJA 1VQMF 3JCMM 1M1KH 5C8YA 1YQNA 3PLAC 4TV8A 3JAKB 3IEQA 3CMEF 3LWQC 5LP6B 5IJ9A 2UZHA 3JARB 1Z5VA 3HKDA 2L26A 1IV1A 3CG6A 1PXWA 4BT6A 2VAWA 5LXTA 5EZYA 3N2KA 5GAPK 5ITZB 5GONB 3RYFB 3CCQF 1GO0A 1KNJA 1W40A 4YJ3A 4BT3A 3LWPC 4O4IB 3C9UA 5EIBC 3K12A 1YJ9F 2N48A 3ZP7A 4DRXB 1VQKF 2RHLA 3FBAA 5LOVB 2VGNA 1RA4A 2BTQB 4LNUA 3CCEF 3F0GA 5BMVA 5G4UC 3C9SA 2R6R1 3KIZA 2AIZP 1SDSA 5EO3A 1W581 2QTPA 4M8IA 2HS3A 2ZVYA 3WXMB 4X20A 5EB1B 3WGNA 4TUYA 1NJIH 3RYIA 3OONA 1W41A 3RYCA 3S0YA 1KD1H 4O2AA 4ZHWA 2HP0B 1IV3A 1T0AA 1T0KB 1SA0B 2CWJA 2GVIA 4XCQA 3QTYA 4I50A 3E22A 2FGYA 4O2BA 4B5CA 4EB6B 5KMGB 2VAMA 3ELCA 3LWVC 2G9IA 2CVLA 5LP6C 2OHWA 1CLIA 5MN4A 2QI2A 1KC8H 5FNVA 1H7MA 2ZAUA 1YITF 2AMTA 5IYZA 3FD6A 3JASA 1X7PA 4KWEA 1SZQA 1GX1A 3WGMA 4YJ2B 3K14A 3CC4F 3FPIA 4X1KA 1J7HA 1JN1A 2KGWA 1VH8A 5GIPC 1ONIA 2NMUA 2Z1UA 4C81A 1VQ4F 2Q1XA 1VQVA 4FFBB 1UFYA 3G4SF 3JAMM 1FFXA 4IIJA 3CCUF 5CA1A 5GANK 2KG4A 1U3PA 1ZWZA 3CB2A 1Q82H 3K0TA 2RHJA 4B45A 2CHTA 5G4VC 1DT9A 4HNAA 2R751 1X52A 1W5EA 2GZLA 2W8BC 4PWTA 1VQOF 5JH7A 1W59A 3V3TA 3G6EF 3S0HA 3VCZA 2VXYA 2VGMA 3OBYA 5CB4A 4X1IA 2BTUA 4BY9D 3CCRF 3CPQA 3HAXD 5HY4A 3VOAA 2HS0A 5KX5A 1E7KA 4ZI7B 5HY0A 3ERNA 1RLGA 3F6MA 2HVYD 1QVGF 4X3MA 1YGYA 3KJJA 5HP7A 1Q7YH 3IEWA 3LYBA 3VIUA 3I56F 2WALA 2Z1FA 4I4TA 3HKCB 2H8EA 1YI2F 3IMPA 1JD1A 1QVFF 2B33A 1VQ8F 1XHOA 3VOBA 1TVKA 3J81M 1K8AH 1KQSF 3UT5B 5CA0B 5J2UA 3FFMA 1PF5A 4O4JB 3AGKA 3M1XA 4IHJB 5JQGB 5IJ0B 4G4YA 2K1SA 3KJKA 3NK6A 3S06A 1RQ7A 3J7AR 4ZHQB 1YHQF 4O4LA 3LWRC 4ZOLA 2GLZA 5C8YB 3HJWC 3JALA 1IPAA 3FD5A 2HS4A 3DDNA 2LBWA 5HXUA 2V9YA 2MQEA 5GONA 3RYFA 5ITZA 1COMA 2VAPA 2DT4A 2HRUA 2IG8A 2IQQA 3EORA 5LXTB 3E1YA 3N2KB 3CC2F 1VQNF 2LCAA 4YJ3B 4BVTA 4TV9B 4F6RA 4X3LA 2I6DA 5B8FA 4BVRA 1VK3A 1VHAA 3Q8HA 3C8LA 5BMVB 2ZF8A 1Z5WA 1KNKA 4G88A 5JVDA 5GINC 3T80A 3R0PA 3GTZA 3J80M 3RA5A 2H6LA 3HKEB 3WGKA 1YJWF 4RQOA 1TUBA 4TUYB 4ZHVA 2HP0A 3RYIB 3CCVF 1XV2A 5LA6A 3JAWB 4TZZA 2Q1YA 2LBXA 2ZOVA 1SA0A 1JFFA 3OBWA 3WPWA 1Q86H 3CCJF 4O2AB 2CW4A 2UYPA 3JATA 3WJQA 2Z1EA 3JVHA 3V7QA 1W5BA 5DCVA 4U39A 1VQLF 2HRYA 2OTMA 3E22B 2PHNA 1R1MA 1JJ2F 4NWOB 2LBTA 4BT5A 4O4HA 5GIOC 2QA4F 5EYPB 3U0OA 2KTVA 2CZWA 5J2TA 2Z1TA 2FC3A 1IV4A 3BYQA 2F9ZC 3CCLF 3F0DA 5IYZB 2OTLF 3C9TA 4EI8A
chains in the Genus database with same CATH topology
4C8GA 1IV2A 1VHAA 1H48A 2PMPA 1U3PA 3Q8HA 1KNJA 2AMTA 1U40A 3B6NA 3IEWA 4C8EA 1KNKA 4C82A 3F0FA 1IV3A 1T0AA 3ESJA 1GX1A 3P0ZA 3F0EA 3RE3A 3T80A 1U43A 2GZLA 3K14A 1JY8A 3P10A 3FPIA 3FBAA 3K2XA 4C8IA 1JN1A 3F0GA 3GHZA 3MBMA 1VH8A 1W57A 3EORA 1YQNA 3ELCA 1IV4A 3IEQA 1U3LA 3KE1A 3F0DA 4C81A 3IKEA 2UZHA 1H47A 3JVHA 3ERNA 1IV1A 1W55A 3QHDA 3F6MA 5B8FA 3IKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8G A;  1IV2 A;  1VHA A;  1H48 A;  2PMP A;  1U3P A;  3Q8H A;  1KNJ A;  2AMT A;  1U40 A;  3B6N A;  3IEW A;  4C8E A;  1KNK A;  4C82 A;  3F0F A;  1IV3 A;  1T0A A;  3ESJ A;  1GX1 A;  3P0Z A;  3F0E A;  3RE3 A;  3T80 A;  1U43 A;  2GZL A;  3K14 A;  1JY8 A;  3P10 A;  3FPI A;  3FBA A;  3K2X A;  4C8I A;  1JN1 A;  3F0G A;  3GHZ A;  3MBM A;  1VH8 A;  1W57 A;  3EOR A;  1YQN A;  3ELC A;  1IV4 A;  3IEQ A;  1U3L A;  3KE1 A;  3F0D A;  4C81 A;  3IKE A;  2UZH A;  1H47 A;  3JVH A;  3ERN A;  1IV1 A;  1W55 A;  3QHD A;  3F6M A;  5B8F A;  3IKF A; 
#chains in the Genus database with same CATH topology
 1IV2 A;  3C9R A;  3QUW A;  5HP8 A;  4BW0 B;  3WJP A;  4X1K B;  5FLX M;  3VYU C;  1NMU B;  3CYQ A;  3S0W A;  1VQ5 F;  1DBF A;  3NK7 A;  5JCO C;  1FNK A;  2RHH A;  3I3F A;  3RYH A;  4U3J A;  5EAZ A;  3HKB A;  3LME A;  2OTJ F;  3MBM A;  1FFX B;  3ON1 A;  4IIJ B;  1W57 A;  1YIJ F;  3NMU C;  4LCK A;  1VQ6 F;  5CA1 B;  4X1Y B;  5A2Q M;  3VTI C;  3NVK E;  1UI9 A;  1GZ0 A;  3IKE A;  3CC7 F;  1GO1 A;  1X25 A;  1FSZ A;  3HWU A;  3N4Z A;  5HY2 A;  3CCS F;  1H48 A;  1XRG A;  4NQ3 A;  3VI6 A;  1Q8R A;  2HP3 A;  3DC2 A;  2ZOD A;  5JH7 B;  2UYN A;  4ZI7 A;  4BT7 A;  1RLU A;  3D01 A;  3D00 A;  3ESJ A;  3RE3 A;  3F0E A;  4X1I B;  1U43 A;  1JY8 A;  3OW2 F;  1W5A A;  4BVS A;  5KX5 B;  3LFO A;  3I7T A;  3V7E A;  4BVQ A;  4G4V A;  3TD3 A;  3N2G B;  4I55 A;  1FNJ A;  2H8C A;  1OAP A;  1H47 A;  2JNB A;  2QEX F;  3F0F A;  2CSL A;  3LWO C;  4ERH A;  5CA0 A;  3L7Q A;  3N4Y A;  3UT5 A;  3JAK A;  4WBN B;  5EIB D;  1Q81 H;  1QU9 A;  1U40 A;  4C8E A;  5MN5 A;  5LYJ B;  4G4W A;  5LP6 A;  4B46 A;  3JAR A;  4IHJ A;  3S02 A;  5IJ0 A;  3G71 F;  3LDT A;  5J2U B;  4TV8 B;  3P10 A;  1QD9 A;  4NUT A;  4BT4 A;  4C8I A;  5IJ9 B;  2RHO A;  3HKD B;  3ZO8 A;  3S03 A;  4O4I A;  4DXD A;  3VYS C;  5EZY B;  3MCA B;  4O4L B;  4DRX A;  4ZOL B;  5LOV A;  3JAL B;  1M90 H;  4C8G A;  3MDO A;  3M4S A;  4LNU B;  3GYQ A;  4TV9 A;  3WJR A;  3M84 A;  3P0Z A;  3VMF B;  2HQS C;  3VYT C;  2Z01 A;  1W42 A;  1K9M H;  4X20 B;  2CHS A;  4F6R B;  3RA6 A;  2AIF A;  3D54 A;  2UYJ A;  5MN6 A;  3SIV A;  1W3E X;  5JCO A;  5HY1 A;  3RYC B;  4E6E A;  3HKE A;  2ZVZ A;  5JVD B;  1W55 A;  4EB6 A;  3JAW A;  4ZHY B;  3IKF A;  1X7O A;  5KMG A;  2PMP A;  1TUB B;  1XBI A;  4I50 B;  4R40 B;  5LA6 B;  4O2B B;  3MCQ A;  1JFF B;  3CMA F;  1K73 H;  3JAT B;  3SIU A;  3HTN A;  1VQP F;  5FNV B;  2P6Y A;  1U3L A;  5EYP A;  3KE1 A;  3CPW F;  4YJ2 A;  3P4E A;  5HWE A;  3JAS B;  4O4H B;  3QHD A;  1YJN F;  2UYK A;  3WGL A;  2ALE A;  2BTO A;  4FFB A;  5J2T B;  2YYE A;  2DYY A;  2EWC A;  3VO8 A;  2KTU A;  3CCM F;  4C4W C;  3IR9 A;  2BO1 A;  3WGJ A;  3TD4 A;  4EI7 A;  3KHN A;  1QAH A;  1VQ7 F;  3I55 F;  5EB0 A;  1OFU A;  4RHA A;  1RQ2 A;  1VQ9 F;  4HNA B;  3O85 A;  4X1Y A;  3RYH B;  4U3J B;  5IT9 M;  3HKB B;  3B6N A;  1S72 F;  5AVM A;  2YXZ A;  3ZOP A;  4ZK7 A;  4C82 A;  4EI9 A;  5FJ4 C;  1N8R H;  5CB4 B;  2HX0 A;  4G4X A;  3TD5 A;  3NVI B;  3PAF A;  2RB9 A;  1CK2 A;  3GHZ A;  3E20 B;  3CYP B;  1W2B F;  1CN7 A;  2UYN B;  3HKC A;  1W5F A;  4G4Z A;  3V4D A;  4B62 A;  3N2G A;  2IAF A;  2I6R A;  1NQ3 A;  4I4T B;  3CD6 F;  1ODE A;  2OZB A;  5EWR A;  3MQW A;  5HXZ A;  4O4J A;  5JQG A;  3CXC F;  3ZP4 A;  1TVK B;  4I55 B;  3WPX A;  4WBN A;  4ZHQ A;  3K2X A;  4BT2 A;  5LYJ A;  1VQM F;  3JCM M;  1M1K H;  5C8Y A;  1YQN A;  3PLA C;  4TV8 A;  3JAK B;  3IEQ A;  3CME F;  3LWQ C;  5LP6 B;  5IJ9 A;  2UZH A;  3JAR B;  1Z5V A;  3HKD A;  2L26 A;  1IV1 A;  3CG6 A;  1PXW A;  4BT6 A;  2VAW A;  5LXT A;  5EZY A;  3N2K A;  5GAP K;  5ITZ B;  5GON B;  3RYF B;  3CCQ F;  1GO0 A;  1KNJ A;  1W40 A;  4YJ3 A;  4BT3 A;  3LWP C;  4O4I B;  3C9U A;  5EIB C;  3K12 A;  1YJ9 F;  2N48 A;  3ZP7 A;  4DRX B;  1VQK F;  2RHL A;  3FBA A;  5LOV B;  2VGN A;  1RA4 A;  2BTQ B;  4LNU A;  3CCE F;  3F0G A;  5BMV A;  5G4U C;  3C9S A;  2R6R 1;  3KIZ A;  2AIZ P;  1SDS A;  5EO3 A;  1W58 1;  2QTP A;  4M8I A;  2HS3 A;  2ZVY A;  3WXM B;  4X20 A;  5EB1 B;  3WGN A;  4TUY A;  1NJI H;  3RYI A;  3OON A;  1W41 A;  3RYC A;  3S0Y A;  1KD1 H;  4O2A A;  4ZHW A;  2HP0 B;  1IV3 A;  1T0A A;  1T0K B;  1SA0 B;  2CWJ A;  2GVI A;  4XCQ A;  3QTY A;  4I50 A;  3E22 A;  2FGY A;  4O2B A;  4B5C A;  4EB6 B;  5KMG B;  2VAM A;  3ELC A;  3LWV C;  2G9I A;  2CVL A;  5LP6 C;  2OHW A;  1CLI A;  5MN4 A;  2QI2 A;  1KC8 H;  5FNV A;  1H7M A;  2ZAU A;  1YIT F;  2AMT A;  5IYZ A;  3FD6 A;  3JAS A;  1X7P A;  4KWE A;  1SZQ A;  1GX1 A;  3WGM A;  4YJ2 B;  3K14 A;  3CC4 F;  3FPI A;  4X1K A;  1J7H A;  1JN1 A;  2KGW A;  1VH8 A;  5GIP C;  1ONI A;  2NMU A;  2Z1U A;  4C81 A;  1VQ4 F;  2Q1X A;  1VQV A;  4FFB B;  1UFY A;  3G4S F;  3JAM M;  1FFX A;  4IIJ A;  3CCU F;  5CA1 A;  5GAN K;  2KG4 A;  1U3P A;  1ZWZ A;  3CB2 A;  1Q82 H;  3K0T A;  2RHJ A;  4B45 A;  2CHT A;  5G4V C;  1DT9 A;  4HNA A;  2R75 1;  1X52 A;  1W5E A;  2GZL A;  2W8B C;  4PWT A;  1VQO F;  5JH7 A;  1W59 A;  3V3T A;  3G6E F;  3S0H A;  3VCZ A;  2VXY A;  2VGM A;  3OBY A;  5CB4 A;  4X1I A;  2BTU A;  4BY9 D;  3CCR F;  3CPQ A;  3HAX D;  5HY4 A;  3VOA A;  2HS0 A;  5KX5 A;  1E7K A;  4ZI7 B;  5HY0 A;  3ERN A;  1RLG A;  3F6M A;  2HVY D;  1QVG F;  4X3M A;  1YGY A;  3KJJ A;  5HP7 A;  1Q7Y H;  3IEW A;  3LYB A;  3VIU A;  3I56 F;  2WAL A;  2Z1F A;  4I4T A;  3HKC B;  2H8E A;  1YI2 F;  3IMP A;  1JD1 A;  1QVF F;  2B33 A;  1VQ8 F;  1XHO A;  3VOB A;  1TVK A;  3J81 M;  1K8A H;  1KQS F;  3UT5 B;  5CA0 B;  5J2U A;  3FFM A;  1PF5 A;  4O4J B;  3AGK A;  3M1X A;  4IHJ B;  5JQG B;  5IJ0 B;  4G4Y A;  2K1S A;  3KJK A;  3NK6 A;  3S06 A;  1RQ7 A;  3J7A R;  4ZHQ B;  1YHQ F;  4O4L A;  3LWR C;  4ZOL A;  2GLZ A;  5C8Y B;  3HJW C;  3JAL A;  1IPA A;  3FD5 A;  2HS4 A;  3DDN A;  2LBW A;  5HXU A;  2V9Y A;  2MQE A;  5GON A;  3RYF A;  5ITZ A;  1COM A;  2VAP A;  2DT4 A;  2HRU A;  2IG8 A;  2IQQ A;  3EOR A;  5LXT B;  3E1Y A;  3N2K B;  3CC2 F;  1VQN F;  2LCA A;  4YJ3 B;  4BVT A;  4TV9 B;  4F6R A;  4X3L A;  2I6D A;  5B8F A;  4BVR A;  1VK3 A;  1VHA A;  3Q8H A;  3C8L A;  5BMV B;  2ZF8 A;  1Z5W A;  1KNK A;  4G88 A;  5JVD A;  5GIN C;  3T80 A;  3R0P A;  3GTZ A;  3J80 M;  3RA5 A;  2H6L A;  3HKE B;  3WGK A;  1YJW F;  4RQO A;  1TUB A;  4TUY B;  4ZHV A;  2HP0 A;  3RYI B;  3CCV F;  1XV2 A;  5LA6 A;  3JAW B;  4TZZ A;  2Q1Y A;  2LBX A;  2ZOV A;  1SA0 A;  1JFF A;  3OBW A;  3WPW A;  1Q86 H;  3CCJ F;  4O2A B;  2CW4 A;  2UYP A;  3JAT A;  3WJQ A;  2Z1E A;  3JVH A;  3V7Q A;  1W5B A;  5DCV A;  4U39 A;  1VQL F;  2HRY A;  2OTM A;  3E22 B;  2PHN A;  1R1M A;  1JJ2 F;  4NWO B;  2LBT A;  4BT5 A;  4O4H A;  5GIO C;  2QA4 F;  5EYP B;  3U0O A;  2KTV A;  2CZW A;  5J2T A;  2Z1T A;  2FC3 A;  1IV4 A;  3BYQ A;  2F9Z C;  3CCL F;  3F0D A;  5IYZ B;  2OTL F;  3C9T A;  4EI8 A; 
#chains in the Genus database with same CATH homology
 4C8G A;  1IV2 A;  1VHA A;  1H48 A;  2PMP A;  1U3P A;  3Q8H A;  1KNJ A;  2AMT A;  1U40 A;  3B6N A;  3IEW A;  4C8E A;  1KNK A;  4C82 A;  3F0F A;  1IV3 A;  1T0A A;  3ESJ A;  1GX1 A;  3P0Z A;  3F0E A;  3RE3 A;  3T80 A;  1U43 A;  2GZL A;  3K14 A;  1JY8 A;  3P10 A;  3FPI A;  3FBA A;  3K2X A;  4C8I A;  1JN1 A;  3F0G A;  3GHZ A;  3MBM A;  1VH8 A;  1W57 A;  3EOR A;  1YQN A;  3ELC A;  1IV4 A;  3IEQ A;  1U3L A;  3KE1 A;  3F0D A;  4C81 A;  3IKE A;  2UZH A;  1H47 A;  3JVH A;  3ERN A;  1IV1 A;  1W55 A;  3QHD A;  3F6M A;  5B8F A;  3IKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...