3IEWA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
SMDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 50
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3iewA00
3K14A 1W55A 1W57A 1VH8A 1U3LA 3RE3A 1JN1A 1U43A 1U40A 2GZLA 1H47A 3B6NA 3IKFA 3ESJA 3F0EA 3QHDA 4C8IA 4C81A 1H48A 3F0DA 3JVHA 3P0ZA 1KNKA 3IKEA 3IEWA 5B8FA 3F6MA 3KE1A 3F0GA 3MBMA 3ERNA 3IEQA 1U3PA 3K2XA 1IV1A 1JY8A 3F0FA 3GHZA 1T0AA 3T80A 1KNJA 3ELCA 1IV2A 3FPIA 3P10A 3EORA 1VHAA 2PMPA 2UZHA 3Q8HA 3FBAA 1GX1A 2AMTA 4C8EA 1IV3A 4C82A 1IV4A 1YQNA 4C8GA
chains in the Genus database with same CATH superfamily
2VGNA 3N4ZA 3HKCA 2HRYA 1Q8RA 5JVDA 2Z1UA 4ZI7A 5LA6A 1W41A 1TVKA 2I6RA 3E22B 4ERHA 5FJ4C 5EYPB 3OBWA 3N2GA 3IMPA 5B8FA 3F0GA 1KQSF 2VAMA 1W5AA 5BMVB 5CB4A 3CC7F 5C8YB 5LXTA 2VXYA 2GVIA 5FNVB 3G71F 2FC3A 2F9ZC 3CB2A 4O4LA 3JALB 2CZWA 5ITZB 1YQNA 3K14A 3CCSF 1FFXB 3M1XA 1K73H 1X52A 3CCEF 1YGYA 4I50A 3ZP4A 3HKEA 5LYJB 5IJ0B 3IR9A 3JAWB 3JAMM 4YJ2A 3SIVA 2BTQB 5CA1B 4F6RA 3TD5A 1Q82H 3DC2A 3WGNA 4TV8A 4FFBB 1VQ4F 2H6LA 2ZAUA 5HP8A 3EORA 4U3JB 1VQ7F 1VHAA 5GONA 2VAWA 1GX1A 4O4HB 2RHHA 3ZP7A 4O2AA 1W42A 4O4IB 2L26A 2I6DA 3L7QA 1K8AH 3LFOA 3RYCA 3ESJA 1YJ9F 3C9UA 3RYHB 3F0DA 3RYIB 3ON1A 5GINC 3JARA 2HP3A 1VQPF 1JFFA 1T0AA 3ZO8A 5LP6B 3NMUC 3V3TA 2FGYA 5HY0A 5JH7B 3WXMB 3I7TA 2V9YA 4EB6B 2UZHA 3FBAA 5KMGA 2HQSC 4IIJB 4DXDA 4O4JB 3GTZA 2H8EA 3VYUC 3RYCB 3CC4F 4X20B 1VQ6F 1U40A 3E20B 3CMEF 2BTOA 1VQLF 3S0HA 2HRUA 3D54A 3HKDA 1NJIH 3GYQA 3QUWA 1Z5VA 3RA6A 3KJKA 2QA4F 2UYKA 3VO8A 2ZVZA 4F6RB 5KX5B 4RHAA 3NK6A 3TD4A 1GZ0A 3CCMF 3AGKA 3CG6A 4YJ2B 4C8EA 5EIBC 1RLUA 4O2BB 3WGKA 1IV4A 1FSZA 1VQVA 3O85A 1ODEA 3DDNA 3RE3A 2WALA 2OZBA 1FFXA 3C8LA 1Q81H 3N2KB 3F0EA 1ZWZA 2LBXA 3P0ZA 4I55B 2CHTA 1RQ2A 4BVTA 3C9SA 4NUTA 3S03A 1VQ9F 1SA0B 3WGLA 4BW0B 5FNVA 2BO1A 3CPWF 3LYBA 3MCQA 5EWRA 5BMVA 1W5FA 4RQOA 4X3LA 4LNUB 3HKBB 1J7HA 3CCQF 4WBNB 1ONIA 2UYNB 4BT6A 5HY4A 2JNBA 1W55A 3E1YA 5LA6B 4ZI7B 3OW2F 2GZLA 2Z1TA 3HWUA 3IKFA 2UYNA 2H8CA 2CSLA 3HKBA 4LNUA 3KE1A 5CA0A 3G6EF 3VTIC 5EB0A 3K2XA 2HVYD 5MN5A 1W3EX 4LCKA 1YHQF 5IT9M 3LWVC 1W40A 3SIUA 1CN7A 3JCMM 4IHJB 2KG4A 2QEXF 5J2UB 1M1KH 1VH8A 3WJQA 5LOVB 4BT2A 5HY1A 1W59A 4O2BA 5J2TA 3VOAA 1SDSA 1T0KB 4WBNA 3LWPC 1IPAA 5LP6C 1YJNF 1X7OA 3ERNA 1VQ8F 1SZQA 3CYQA 3F0FA 1QD9A 4ZHYB 1CK2A 2HS0A 2AIZP 3UT5B 2LBTA 2BTUA 5HP7A 4TV9A 1SA0A 2R6R1 1XRGA 4TUYB 3I55F 2CVLA 1E7KA 4X1KB 3MQWA 4I55A 1M90H 2VGMA 3C9RA 4X20A 4NQ3A 3S02A 4X1YB 2Z1FA 4ZHVA 3MDOA 3KIZA 3HJWC 1JFFB 1JY8A 4KWEA 5A2QM 1CLIA 3CD6F 2AIFA 4B46A 3VIUA 4PWTA 3LWOC 3HKDB 3J80M 4C4WC 5EZYB 3V4DA 3CMAF 1W57A 5GANK 4BVQA 2P6YA 3M4SA 4BVRA 2KTUA 1R1MA 3WJPA 2CHSA 4EB6A 4TV8B 3TD3A 4ZOLB 4EI7A 1U3PA 3RYFB 5LP6A 2OTJF 1KNJA 3P10A 4NWOB 4G4XA 3JAWA 1UFYA 2CW4A 3HKEB 5LYJA 4TZZA 3I3FA 1Q7YH 3RYIA 2CWJA 1U43A 3B6NA 2ZVYA 4O4IA 4O2AB 3FD6A 3J7AR 3G4SF 1OAPA 3IEWA 4O4HA 3FD5A 3CXCF 1YJWF 2W8BC 2GLZA 4U3JA 3VMFB 5GIPC 3CCLF 5LXTB 1W581 4BT4A 3IEQA 3K0TA 4FFBA 2ALEA 5C8YA 5CB4B 5HXZA 2UYPA 1VQ5F 2RHJA 5EO3A 3R0PA 2LBWA 3N4YA 1JJ2F 3CCRF 1JD1A 3CYPB 3KHNA 2PMPA 5IJ0A 2UYJA 3HTNA 1IV3A 2KGWA 5LOVA 3OBYA 4C8GA 5JCOA 1Q86H 4I50B 3M84A 4U39A 5JVDB 3HKCB 1YITF 4I4TA 1FNJA 5IJ9B 4HNAB 2QTPA 3IKEA 3D00A 3K12A 5G4UC 3JALA 3F6MA 4X1IB 2HP0A 2EWCA 4G4YA 1KC8H 2OTLF 3CPQA 1YI2F 1X25A 3NK7A 5CA0B 2HP0B 3LDTA 3BYQA 3VYTC 2AMTA 3PLAC 3N2GB 4X3MA 5EYPA 3JATA 1TVKB 3E22A 4XCQA 5MN6A 4HNAA 5EIBD 4I4TB 1JN1A 4C8IA 5IJ9A 1TUBB 4YJ3A 3WPXA 4C81A 4BVSA 1QVGF 1GO1A 4G4WA 2G9IA 4ZHWA 3VCZA 3C9TA 5IYZA 5AVMA 1UI9A 4BT5A 5DCVA 1W2BF 3CCVF 1IV1A 4G4VA 3JAKA 3HAXD 1XV2A 1IV2A 3P4EA 1QU9A 5GIOC 4G88A 5G4VC 3CC2F 1VQMF 1DT9A 1OFUA 2YXZA 3Q8HA 2MQEA 3QTYA 5MN4A 3N2KA 1KD1H 4ZK7A 2VAPA 2DYYA 3VOBA 4M8IA 2R751 3S0YA 3JVHA 1K9MH 1PF5A 2RB9A 4BT7A 1VK3A 2NMUA 3JASA 2Z01A 3J81M 5KX5A 3OONA 2OHWA 1W5BA 2Q1XA 4ZHQA 3ELCA 3RYFA 3LWRC 2HS3A 4ZOLA 2ZF8A 3WPWA 1S72F 1YIJF 2HX0A 1VQOF 5GAPK 5JQGB 1RLGA 2RHOA 4O4JA 3QHDA 2DT4A 1PXWA 1H47A 4IIJA 5JQGA 3NVIB 3ZOPA 5EAZA 5KMGB 5EZYA 3MBMA 2Q1YA 5JH7A 1QVFF 4DRXB 3GHZA 1COMA 3VI6A 2N48A 1VQNF 4DRXA 3LWQC 3RA5A 3JARB 4BY9D 3KJJA 1NQ3A 4X1YA 3RYHA 1DBFA 2PHNA 1H7MA 3WGMA 2KTVA 5HXUA 2YYEA 3D01A 5FLXM 1Z5WA 3VYSC 3CCUF 3CCJF 1N8RH 1H48A 1RQ7A 5GONB 1XHOA 2K1SA 4X1KA 4E6EA 4TUYA 5HY2A 1XBIA 4B45A 4TV9B 5HWEA 3FFMA 3U0OA 3UT5A 5CA1A 3V7EA 4ZHQB 5JCOC 3NVKE 2RHLA 3FPIA 2QI2A 2B33A 1FNKA 5IYZB 3JASB 4EI9A 4B5CA 2OTMA 1W5EA 1GO0A 4C82A 3T80A 5J2TB 1TUBA 4YJ3B 4G4ZA 4BT3A 3S06A 1NMUB 2Z1EA 1U3LA 2IAFA 3JATB 5ITZA 5J2UA 1VQKF 5EB1B 2IG8A 2LCAA 4O4LB 2ZOVA 4IHJA 3WJRA 3I56F 1X7PA 3WGJA 2ZODA 3LMEA 4B62A 3JAKB 1QAHA 3V7QA 3PAFA 1RA4A 4X1IA 4R40B 4EI8A 3S0WA 2IQQA 3MCAB 2HS4A 1KNKA
chains in the Genus database with same CATH topology
3K14A 1W55A 1W57A 1VH8A 1U3LA 3RE3A 1JN1A 1U43A 1U40A 2GZLA 1H47A 3B6NA 3IKFA 3ESJA 3F0EA 3QHDA 4C8IA 4C81A 1H48A 3F0DA 3JVHA 3P0ZA 1KNKA 3IKEA 3IEWA 5B8FA 3F6MA 3KE1A 3F0GA 3MBMA 3ERNA 3IEQA 1U3PA 3K2XA 1IV1A 1JY8A 3F0FA 3GHZA 1T0AA 3T80A 1KNJA 3ELCA 1IV2A 3FPIA 3P10A 3EORA 1VHAA 2PMPA 2UZHA 3Q8HA 3FBAA 1GX1A 2AMTA 4C8EA 1IV3A 4C82A 1IV4A 1YQNA 4C8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K14 A;  1W55 A;  1W57 A;  1VH8 A;  1U3L A;  3RE3 A;  1JN1 A;  1U43 A;  1U40 A;  2GZL A;  1H47 A;  3B6N A;  3IKF A;  3ESJ A;  3F0E A;  3QHD A;  4C8I A;  4C81 A;  1H48 A;  3F0D A;  3JVH A;  3P0Z A;  1KNK A;  3IKE A;  3IEW A;  5B8F A;  3F6M A;  3KE1 A;  3F0G A;  3MBM A;  3ERN A;  3IEQ A;  1U3P A;  3K2X A;  1IV1 A;  1JY8 A;  3F0F A;  3GHZ A;  1T0A A;  3T80 A;  1KNJ A;  3ELC A;  1IV2 A;  3FPI A;  3P10 A;  3EOR A;  1VHA A;  2PMP A;  2UZH A;  3Q8H A;  3FBA A;  1GX1 A;  2AMT A;  4C8E A;  1IV3 A;  4C82 A;  1IV4 A;  1YQN A;  4C8G A; 
#chains in the Genus database with same CATH topology
 2VGN A;  3N4Z A;  3HKC A;  2HRY A;  1Q8R A;  5JVD A;  2Z1U A;  4ZI7 A;  5LA6 A;  1W41 A;  1TVK A;  2I6R A;  3E22 B;  4ERH A;  5FJ4 C;  5EYP B;  3OBW A;  3N2G A;  3IMP A;  5B8F A;  3F0G A;  1KQS F;  2VAM A;  1W5A A;  5BMV B;  5CB4 A;  3CC7 F;  5C8Y B;  5LXT A;  2VXY A;  2GVI A;  5FNV B;  3G71 F;  2FC3 A;  2F9Z C;  3CB2 A;  4O4L A;  3JAL B;  2CZW A;  5ITZ B;  1YQN A;  3K14 A;  3CCS F;  1FFX B;  3M1X A;  1K73 H;  1X52 A;  3CCE F;  1YGY A;  4I50 A;  3ZP4 A;  3HKE A;  5LYJ B;  5IJ0 B;  3IR9 A;  3JAW B;  3JAM M;  4YJ2 A;  3SIV A;  2BTQ B;  5CA1 B;  4F6R A;  3TD5 A;  1Q82 H;  3DC2 A;  3WGN A;  4TV8 A;  4FFB B;  1VQ4 F;  2H6L A;  2ZAU A;  5HP8 A;  3EOR A;  4U3J B;  1VQ7 F;  1VHA A;  5GON A;  2VAW A;  1GX1 A;  4O4H B;  2RHH A;  3ZP7 A;  4O2A A;  1W42 A;  4O4I B;  2L26 A;  2I6D A;  3L7Q A;  1K8A H;  3LFO A;  3RYC A;  3ESJ A;  1YJ9 F;  3C9U A;  3RYH B;  3F0D A;  3RYI B;  3ON1 A;  5GIN C;  3JAR A;  2HP3 A;  1VQP F;  1JFF A;  1T0A A;  3ZO8 A;  5LP6 B;  3NMU C;  3V3T A;  2FGY A;  5HY0 A;  5JH7 B;  3WXM B;  3I7T A;  2V9Y A;  4EB6 B;  2UZH A;  3FBA A;  5KMG A;  2HQS C;  4IIJ B;  4DXD A;  4O4J B;  3GTZ A;  2H8E A;  3VYU C;  3RYC B;  3CC4 F;  4X20 B;  1VQ6 F;  1U40 A;  3E20 B;  3CME F;  2BTO A;  1VQL F;  3S0H A;  2HRU A;  3D54 A;  3HKD A;  1NJI H;  3GYQ A;  3QUW A;  1Z5V A;  3RA6 A;  3KJK A;  2QA4 F;  2UYK A;  3VO8 A;  2ZVZ A;  4F6R B;  5KX5 B;  4RHA A;  3NK6 A;  3TD4 A;  1GZ0 A;  3CCM F;  3AGK A;  3CG6 A;  4YJ2 B;  4C8E A;  5EIB C;  1RLU A;  4O2B B;  3WGK A;  1IV4 A;  1FSZ A;  1VQV A;  3O85 A;  1ODE A;  3DDN A;  3RE3 A;  2WAL A;  2OZB A;  1FFX A;  3C8L A;  1Q81 H;  3N2K B;  3F0E A;  1ZWZ A;  2LBX A;  3P0Z A;  4I55 B;  2CHT A;  1RQ2 A;  4BVT A;  3C9S A;  4NUT A;  3S03 A;  1VQ9 F;  1SA0 B;  3WGL A;  4BW0 B;  5FNV A;  2BO1 A;  3CPW F;  3LYB A;  3MCQ A;  5EWR A;  5BMV A;  1W5F A;  4RQO A;  4X3L A;  4LNU B;  3HKB B;  1J7H A;  3CCQ F;  4WBN B;  1ONI A;  2UYN B;  4BT6 A;  5HY4 A;  2JNB A;  1W55 A;  3E1Y A;  5LA6 B;  4ZI7 B;  3OW2 F;  2GZL A;  2Z1T A;  3HWU A;  3IKF A;  2UYN A;  2H8C A;  2CSL A;  3HKB A;  4LNU A;  3KE1 A;  5CA0 A;  3G6E F;  3VTI C;  5EB0 A;  3K2X A;  2HVY D;  5MN5 A;  1W3E X;  4LCK A;  1YHQ F;  5IT9 M;  3LWV C;  1W40 A;  3SIU A;  1CN7 A;  3JCM M;  4IHJ B;  2KG4 A;  2QEX F;  5J2U B;  1M1K H;  1VH8 A;  3WJQ A;  5LOV B;  4BT2 A;  5HY1 A;  1W59 A;  4O2B A;  5J2T A;  3VOA A;  1SDS A;  1T0K B;  4WBN A;  3LWP C;  1IPA A;  5LP6 C;  1YJN F;  1X7O A;  3ERN A;  1VQ8 F;  1SZQ A;  3CYQ A;  3F0F A;  1QD9 A;  4ZHY B;  1CK2 A;  2HS0 A;  2AIZ P;  3UT5 B;  2LBT A;  2BTU A;  5HP7 A;  4TV9 A;  1SA0 A;  2R6R 1;  1XRG A;  4TUY B;  3I55 F;  2CVL A;  1E7K A;  4X1K B;  3MQW A;  4I55 A;  1M90 H;  2VGM A;  3C9R A;  4X20 A;  4NQ3 A;  3S02 A;  4X1Y B;  2Z1F A;  4ZHV A;  3MDO A;  3KIZ A;  3HJW C;  1JFF B;  1JY8 A;  4KWE A;  5A2Q M;  1CLI A;  3CD6 F;  2AIF A;  4B46 A;  3VIU A;  4PWT A;  3LWO C;  3HKD B;  3J80 M;  4C4W C;  5EZY B;  3V4D A;  3CMA F;  1W57 A;  5GAN K;  4BVQ A;  2P6Y A;  3M4S A;  4BVR A;  2KTU A;  1R1M A;  3WJP A;  2CHS A;  4EB6 A;  4TV8 B;  3TD3 A;  4ZOL B;  4EI7 A;  1U3P A;  3RYF B;  5LP6 A;  2OTJ F;  1KNJ A;  3P10 A;  4NWO B;  4G4X A;  3JAW A;  1UFY A;  2CW4 A;  3HKE B;  5LYJ A;  4TZZ A;  3I3F A;  1Q7Y H;  3RYI A;  2CWJ A;  1U43 A;  3B6N A;  2ZVY A;  4O4I A;  4O2A B;  3FD6 A;  3J7A R;  3G4S F;  1OAP A;  3IEW A;  4O4H A;  3FD5 A;  3CXC F;  1YJW F;  2W8B C;  2GLZ A;  4U3J A;  3VMF B;  5GIP C;  3CCL F;  5LXT B;  1W58 1;  4BT4 A;  3IEQ A;  3K0T A;  4FFB A;  2ALE A;  5C8Y A;  5CB4 B;  5HXZ A;  2UYP A;  1VQ5 F;  2RHJ A;  5EO3 A;  3R0P A;  2LBW A;  3N4Y A;  1JJ2 F;  3CCR F;  1JD1 A;  3CYP B;  3KHN A;  2PMP A;  5IJ0 A;  2UYJ A;  3HTN A;  1IV3 A;  2KGW A;  5LOV A;  3OBY A;  4C8G A;  5JCO A;  1Q86 H;  4I50 B;  3M84 A;  4U39 A;  5JVD B;  3HKC B;  1YIT F;  4I4T A;  1FNJ A;  5IJ9 B;  4HNA B;  2QTP A;  3IKE A;  3D00 A;  3K12 A;  5G4U C;  3JAL A;  3F6M A;  4X1I B;  2HP0 A;  2EWC A;  4G4Y A;  1KC8 H;  2OTL F;  3CPQ A;  1YI2 F;  1X25 A;  3NK7 A;  5CA0 B;  2HP0 B;  3LDT A;  3BYQ A;  3VYT C;  2AMT A;  3PLA C;  3N2G B;  4X3M A;  5EYP A;  3JAT A;  1TVK B;  3E22 A;  4XCQ A;  5MN6 A;  4HNA A;  5EIB D;  4I4T B;  1JN1 A;  4C8I A;  5IJ9 A;  1TUB B;  4YJ3 A;  3WPX A;  4C81 A;  4BVS A;  1QVG F;  1GO1 A;  4G4W A;  2G9I A;  4ZHW A;  3VCZ A;  3C9T A;  5IYZ A;  5AVM A;  1UI9 A;  4BT5 A;  5DCV A;  1W2B F;  3CCV F;  1IV1 A;  4G4V A;  3JAK A;  3HAX D;  1XV2 A;  1IV2 A;  3P4E A;  1QU9 A;  5GIO C;  4G88 A;  5G4V C;  3CC2 F;  1VQM F;  1DT9 A;  1OFU A;  2YXZ A;  3Q8H A;  2MQE A;  3QTY A;  5MN4 A;  3N2K A;  1KD1 H;  4ZK7 A;  2VAP A;  2DYY A;  3VOB A;  4M8I A;  2R75 1;  3S0Y A;  3JVH A;  1K9M H;  1PF5 A;  2RB9 A;  4BT7 A;  1VK3 A;  2NMU A;  3JAS A;  2Z01 A;  3J81 M;  5KX5 A;  3OON A;  2OHW A;  1W5B A;  2Q1X A;  4ZHQ A;  3ELC A;  3RYF A;  3LWR C;  2HS3 A;  4ZOL A;  2ZF8 A;  3WPW A;  1S72 F;  1YIJ F;  2HX0 A;  1VQO F;  5GAP K;  5JQG B;  1RLG A;  2RHO A;  4O4J A;  3QHD A;  2DT4 A;  1PXW A;  1H47 A;  4IIJ A;  5JQG A;  3NVI B;  3ZOP A;  5EAZ A;  5KMG B;  5EZY A;  3MBM A;  2Q1Y A;  5JH7 A;  1QVF F;  4DRX B;  3GHZ A;  1COM A;  3VI6 A;  2N48 A;  1VQN F;  4DRX A;  3LWQ C;  3RA5 A;  3JAR B;  4BY9 D;  3KJJ A;  1NQ3 A;  4X1Y A;  3RYH A;  1DBF A;  2PHN A;  1H7M A;  3WGM A;  2KTV A;  5HXU A;  2YYE A;  3D01 A;  5FLX M;  1Z5W A;  3VYS C;  3CCU F;  3CCJ F;  1N8R H;  1H48 A;  1RQ7 A;  5GON B;  1XHO A;  2K1S A;  4X1K A;  4E6E A;  4TUY A;  5HY2 A;  1XBI A;  4B45 A;  4TV9 B;  5HWE A;  3FFM A;  3U0O A;  3UT5 A;  5CA1 A;  3V7E A;  4ZHQ B;  5JCO C;  3NVK E;  2RHL A;  3FPI A;  2QI2 A;  2B33 A;  1FNK A;  5IYZ B;  3JAS B;  4EI9 A;  4B5C A;  2OTM A;  1W5E A;  1GO0 A;  4C82 A;  3T80 A;  5J2T B;  1TUB A;  4YJ3 B;  4G4Z A;  4BT3 A;  3S06 A;  1NMU B;  2Z1E A;  1U3L A;  2IAF A;  3JAT B;  5ITZ A;  5J2U A;  1VQK F;  5EB1 B;  2IG8 A;  2LCA A;  4O4L B;  2ZOV A;  4IHJ A;  3WJR A;  3I56 F;  1X7P A;  3WGJ A;  2ZOD A;  3LME A;  4B62 A;  3JAK B;  1QAH A;  3V7Q A;  3PAF A;  1RA4 A;  4X1I A;  4R40 B;  4EI8 A;  3S0W A;  2IQQ A;  3MCA B;  2HS4 A;  1KNK A; 
#chains in the Genus database with same CATH homology
 3K14 A;  1W55 A;  1W57 A;  1VH8 A;  1U3L A;  3RE3 A;  1JN1 A;  1U43 A;  1U40 A;  2GZL A;  1H47 A;  3B6N A;  3IKF A;  3ESJ A;  3F0E A;  3QHD A;  4C8I A;  4C81 A;  1H48 A;  3F0D A;  3JVH A;  3P0Z A;  1KNK A;  3IKE A;  3IEW A;  5B8F A;  3F6M A;  3KE1 A;  3F0G A;  3MBM A;  3ERN A;  3IEQ A;  1U3P A;  3K2X A;  1IV1 A;  1JY8 A;  3F0F A;  3GHZ A;  1T0A A;  3T80 A;  1KNJ A;  3ELC A;  1IV2 A;  3FPI A;  3P10 A;  3EOR A;  1VHA A;  2PMP A;  2UZH A;  3Q8H A;  3FBA A;  1GX1 A;  2AMT A;  4C8E A;  1IV3 A;  4C82 A;  1IV4 A;  1YQN A;  4C8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...