1JN1A

Structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from haemophilus influenzae (hi0671)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
MIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPDTDMQYKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Structure of 2C-methyl-D-erythrol-2,4-cyclodiphosphate synthase from Haemophilus influenzae: activation by conformational transition.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 41
structure length 157
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1jn1A00
1JY8A 3B6NA 3MBMA 2PMPA 1IV3A 1JN1A 4C8EA 1VH8A 1W55A 3EORA 3K14A 3RE3A 3IEQA 1IV4A 1KNKA 1H48A 3FPIA 3F0GA 3QHDA 2UZHA 4C8IA 3IKFA 3JVHA 3ELCA 3ESJA 1YQNA 3F0EA 3IEWA 3T80A 1U3LA 1U40A 2GZLA 3P0ZA 1VHAA 3P10A 3K2XA 1U43A 4C82A 3KE1A 4C81A 1GX1A 2AMTA 3F0DA 1KNJA 4C8GA 1T0AA 1H47A 3FBAA 3GHZA 1U3PA 1IV2A 3F0FA 3IKEA 1W57A 5B8FA 3ERNA 1IV1A 3F6MA 3Q8HA
chains in the Genus database with same CATH superfamily
3J80M 1VH8A 3DC2A 3TD4A 1IV4A 1KNKA 4ZI7A 1TVKB 1Z5VA 3VYSC 4O4HA 3CB2A 3C8LA 1DT9A 3JAWB 3KIZA 5HY1A 3JALA 5LP6B 3K2XA 1VQOF 2KG4A 4I55A 5J2UA 3F0DA 3J7AR 1H47A 3QTYA 2KGWA 2Q1XA 2L26A 1RQ7A 3N2GB 3HKCB 1NQ3A 1X7PA 4ZOLA 1T0KB 1VQKF 4LCKA 2H8CA 2Z1TA 3Q8HA 1JY8A 1CK2A 2VAMA 5JH7B 1VQVA 1W5EA 2YXZA 5LP6C 3FPIA 3LFOA 4O2BA 3D01A 1KC8H 5JVDB 3SIVA 4IHJB 3V7QA 5FNVA 4HNAA 3ZP7A 5IJ0B 3CCVF 2OZBA 1KNJA 2FGYA 3MQWA 3VTIC 4BVTA 3CCLF 3HWUA 2RB9A 3GHZA 3WGJA 1TUBB 4O2AA 3TD5A 1H7MA 5MN5A 3IKEA 3JARA 3CMAF 2R6R1 4G4VA 1GO0A 2PMPA 4R40B 2BTOA 4ZK7A 3K14A 1IPAA 4KWEA 1YJ9F 3CCMF 1VQ6F 5IT9M 2QI2A 3E22A 5J2TB 2OTJF 5CA0B 4DRXA 2F9ZC 3MDOA 1XHOA 3RYHB 3I55F 5MN4A 1M90H 2LBWA 1GO1A 1T0AA 2P6YA 1COMA 1OAPA 1Q81H 3ERNA 1IV1A 3HKBA 4X20A 3FFMA 5KX5A 3F6MA 2KTVA 3B6NA 3LWQC 3L7QA 5EIBC 1YIJF 5ITZB 2W8BC 4C8EA 3RYCB 1YJWF 3RE3A 2UYNB 3I7TA 1CN7A 4C8IA 2LCAA 3IKFA 3HKDA 4BVRA 4F6RA 4BY9D 1XV2A 2CHSA 3JAKB 4O4LA 5C8YB 1FNKA 2HRUA 3LWRC 1VQ7F 2BTQB 1VQLF 3NVIB 5CA1A 3D54A 3U0OA 3JATA 4O4HB 1W5BA 4WBNA 3JALB 1QD9A 4I55B 3JASA 4PWTA 5JQGA 2UZHA 2BO1A 4BT7A 2VGNA 1KQSF 3IR9A 1U3LA 4ZOLB 3GYQA 3D00A 1FFXA 4ZHQA 5LXTA 3OBYA 3VIUA 1GZ0A 1ZWZA 3JCMM 1U3PA 1JFFB 3OW2F 2ZAUA 2CSLA 2ZVZA 3LDTA 3RYIA 4O2BB 3CYQA 3K12A 2UYPA 2VAWA 4U3JA 3WXMB 3HKEA 4ZHYB 4G4XA 3G4SF 5FNVB 4BW0B 1SZQA 2HP0A 4TZZA 4HNAB 2H6LA 4IIJB 4YJ2A 4G4YA 5GANK 5EIBD 3M84A 5LOVA 2HRYA 4O2AB 2WALA 3IEWA 3JARB 4X3MA 5IYZA 4BVQA 3WGKA 2AIZP 1W2BF 3CXCF 2JNBA 2VAPA 3WPWA 2FC3A 3E22B 1VQ5F 1W42A 3VCZA 5KMGA 1Q82H 1ODEA 3HJWC 1XBIA 4DRXB 3I56F 5HY4A 2CHTA 5JCOA 5C8YA 1FSZA 3IEQA 1W5FA 3WJRA 3KJKA 3NK7A 5EWRA 1M1KH 4LNUA 3V4DA 5G4VC 3HKBB 3E20B 4X20B 3V7EA 5KX5B 3WGNA 2AMTA 3AGKA 4I50B 5FLXM 3FD5A 2QA4F 4F6RB 3VMFB 2CW4A 3S06A 3JAMM 2PHNA 2B33A 4O4LB 1W3EX 5LA6A 1S72F 3C9UA 1VK3A 2CZWA 3MCAB 1SA0A 4BVSA 5HWEA 5CA1B 1X25A 2CVLA 3TD3A 3JATB 2ZODA 3CC4F 5GONB 4DXDA 3PLAC 1U43A 3BYQA 2DT4A 4NUTA 4WBNB 3CC7F 3CC2F 5LYJA 3LWVC 2YYEA 3P4EA 3JASB 4BT5A 5JQGB 4EI7A 1VQ9F 5HP8A 3NK6A 5CB4B 2EWCA 1UI9A 5BMVA 3G6EF 1IV3A 5EZYA 5GIOC 2OTLF 2Q1YA 3MCQA 1FFXB 4ZHQB 1H48A 2Z1UA 2IQQA 5HP7A 2RHLA 3S03A 1J7HA 4B5CA 3VOBA 5MN6A 2Z01A 5JH7A 2Z1EA 3K0TA 2MQEA 1ONIA 4X1KA 1YI2F 2K1SA 1W40A 4TUYA 5EYPA 1VQPF 4ZHWA 4C81A 2QTPA 3RA5A 3HKEB 3WGLA 3FD6A 5JVDA 2HP0B 3I3FA 4ZI7B 3PAFA 1R1MA 5GIPC 3NMUC 1QAHA 1E7KA 5EB1B 1TUBA 5IYZB 3M4SA 3IMPA 4X1YA 1PXWA 4ZHVA 4O4IA 5J2UB 1K8AH 3F0EA 3OBWA 3C9RA 4EI9A 2IG8A 4EB6A 1YITF 5KMGB 1GX1A 3VI6A 4X3LA 3HTNA 4C8GA 5GINC 2G9IA 5CA0A 4X1IA 2I6RA 2ZOVA 1KD1H 4ERHA 5G4UC 1FNJA 4TV9A 5GAPK 3LWOC 4XCQA 4YJ3A 2R751 5HY0A 1RLGA 1JN1A 3CPQA 3EORA 2LBTA 3QHDA 3R0PA 4G4WA 4C4WC 1NMUB 3ELCA 2ZF8A 5JCOC 4RQOA 4BT6A 1U40A 1W41A 2GZLA 1W59A 3P10A 3WGMA 3UT5A 3RA6A 3KE1A 1K73H 3N4ZA 1X52A 1YJNF 3F0FA 1JJ2F 3CCSF 5LA6B 3RYFA 3S0HA 3LMEA 1SA0B 4BT2A 5HY2A 2ZVYA 3ZP4A 2OTMA 1W55A 4TV8A 3V3TA 4BT4A 3S02A 4O4JA 3CMEF 1YQNA 2VXYA 5LYJB 5DCVA 5FJ4C 3P0ZA 1VHAA 1OFUA 4FFBA 4C82A 5IJ9A 5BMVB 5EZYB 3OONA 2RHJA 2HP3A 1W57A 2ALEA 3N2KA 3HKDB 2VGMA 1VQMF 3E1YA 4X1KB 3S0WA 1JFFA 4TUYB 1QVGF 3ZOPA 5EYPB 3CPWF 3ZO8A 1UFYA 1PF5A 4I4TA 2V9YA 3JVHA 4EI8A 2NMUA 1VQ8F 4IIJA 5HXZA 3SIUA 1TVKA 1RLUA 5EAZA 3JAWA 4X1YB 2AIFA 3CCJF 4O4IB 2LBXA 5LP6A 3O85A 1XRGA 1Z5WA 2IAFA 3C9SA 2GVIA 3CCUF 4EB6B 3CCQF 3WJQA 2HX0A 5A2QM 3N2GA 3HKCA 5LXTB 3VYTC 3DDNA 4X1IB 5AVMA 2DYYA 3CCRF 4TV9B 1YGYA 4M8IA 2KTUA 3CG6A 3VYUC 3RYIB 4YJ3B 4B62A 1Q8RA 3WJPA 3LWPC 2I6DA 1NJIH 4U3JB 3NVKE 3FBAA 2RHOA 4U39A 5B8FA 4NWOB 3GTZA 3LYBA 4IHJA 4YJ2B 3N4YA 2HQSC 2UYKA 3MBMA 5IJ0A 5LOVB 2BTUA 1VQ4F 4I50A 2OHWA 3ON1A 3UT5B 4B45A 3F0GA 4G88A 2N48A 2HVYD 3S0YA 3T80A 3CYPB 5EB0A 3RYFB 2UYJA 3KJJA 1Q86H 5HXUA 2HS3A 2RHHA 4G4ZA 4NQ3A 3CD6F 3HAXD 5J2TA 1QVFF 3KHNA 1W5AA 4B46A 4TV8B 1QU9A 3C9TA 5GONA 1SDSA 3RYHA 3WPXA 4O4JB 1RA4A 4LNUB 1N8RH 1RQ2A 1X7OA 3VO8A 5EO3A 3CCEF 2H8EA 1YHQF 4FFBB 2HS0A 3QUWA 3G71F 3VOAA 1JD1A 5IJ9B 1DBFA 5CB4A 1K9MH 3ESJA 3J81M 4E6EA 1W581 2HS4A 5ITZA 1CLIA 2QEXF 3RYCA 3N2KB 2CWJA 2UYNA 4RHAA 3M1XA 2Z1FA 2GLZA 3JAKA 1IV2A 1VQNF 4I4TB 1Q7YH 4BT3A
chains in the Genus database with same CATH topology
1JY8A 3B6NA 3MBMA 2PMPA 1IV3A 1JN1A 4C8EA 1VH8A 1W55A 3EORA 3K14A 3RE3A 3IEQA 1IV4A 1KNKA 1H48A 3FPIA 3F0GA 3QHDA 2UZHA 4C8IA 3IKFA 3JVHA 3ELCA 3ESJA 1YQNA 3F0EA 3IEWA 3T80A 1U3LA 1U40A 2GZLA 3P0ZA 1VHAA 3P10A 3K2XA 1U43A 4C82A 3KE1A 4C81A 1GX1A 2AMTA 3F0DA 1KNJA 4C8GA 1T0AA 1H47A 3FBAA 3GHZA 1U3PA 1IV2A 3F0FA 3IKEA 1W57A 5B8FA 3ERNA 1IV1A 3F6MA 3Q8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY8 A;  3B6N A;  3MBM A;  2PMP A;  1IV3 A;  1JN1 A;  4C8E A;  1VH8 A;  1W55 A;  3EOR A;  3K14 A;  3RE3 A;  3IEQ A;  1IV4 A;  1KNK A;  1H48 A;  3FPI A;  3F0G A;  3QHD A;  2UZH A;  4C8I A;  3IKF A;  3JVH A;  3ELC A;  3ESJ A;  1YQN A;  3F0E A;  3IEW A;  3T80 A;  1U3L A;  1U40 A;  2GZL A;  3P0Z A;  1VHA A;  3P10 A;  3K2X A;  1U43 A;  4C82 A;  3KE1 A;  4C81 A;  1GX1 A;  2AMT A;  3F0D A;  1KNJ A;  4C8G A;  1T0A A;  1H47 A;  3FBA A;  3GHZ A;  1U3P A;  1IV2 A;  3F0F A;  3IKE A;  1W57 A;  5B8F A;  3ERN A;  1IV1 A;  3F6M A;  3Q8H A; 
#chains in the Genus database with same CATH topology
 3J80 M;  1VH8 A;  3DC2 A;  3TD4 A;  1IV4 A;  1KNK A;  4ZI7 A;  1TVK B;  1Z5V A;  3VYS C;  4O4H A;  3CB2 A;  3C8L A;  1DT9 A;  3JAW B;  3KIZ A;  5HY1 A;  3JAL A;  5LP6 B;  3K2X A;  1VQO F;  2KG4 A;  4I55 A;  5J2U A;  3F0D A;  3J7A R;  1H47 A;  3QTY A;  2KGW A;  2Q1X A;  2L26 A;  1RQ7 A;  3N2G B;  3HKC B;  1NQ3 A;  1X7P A;  4ZOL A;  1T0K B;  1VQK F;  4LCK A;  2H8C A;  2Z1T A;  3Q8H A;  1JY8 A;  1CK2 A;  2VAM A;  5JH7 B;  1VQV A;  1W5E A;  2YXZ A;  5LP6 C;  3FPI A;  3LFO A;  4O2B A;  3D01 A;  1KC8 H;  5JVD B;  3SIV A;  4IHJ B;  3V7Q A;  5FNV A;  4HNA A;  3ZP7 A;  5IJ0 B;  3CCV F;  2OZB A;  1KNJ A;  2FGY A;  3MQW A;  3VTI C;  4BVT A;  3CCL F;  3HWU A;  2RB9 A;  3GHZ A;  3WGJ A;  1TUB B;  4O2A A;  3TD5 A;  1H7M A;  5MN5 A;  3IKE A;  3JAR A;  3CMA F;  2R6R 1;  4G4V A;  1GO0 A;  2PMP A;  4R40 B;  2BTO A;  4ZK7 A;  3K14 A;  1IPA A;  4KWE A;  1YJ9 F;  3CCM F;  1VQ6 F;  5IT9 M;  2QI2 A;  3E22 A;  5J2T B;  2OTJ F;  5CA0 B;  4DRX A;  2F9Z C;  3MDO A;  1XHO A;  3RYH B;  3I55 F;  5MN4 A;  1M90 H;  2LBW A;  1GO1 A;  1T0A A;  2P6Y A;  1COM A;  1OAP A;  1Q81 H;  3ERN A;  1IV1 A;  3HKB A;  4X20 A;  3FFM A;  5KX5 A;  3F6M A;  2KTV A;  3B6N A;  3LWQ C;  3L7Q A;  5EIB C;  1YIJ F;  5ITZ B;  2W8B C;  4C8E A;  3RYC B;  1YJW F;  3RE3 A;  2UYN B;  3I7T A;  1CN7 A;  4C8I A;  2LCA A;  3IKF A;  3HKD A;  4BVR A;  4F6R A;  4BY9 D;  1XV2 A;  2CHS A;  3JAK B;  4O4L A;  5C8Y B;  1FNK A;  2HRU A;  3LWR C;  1VQ7 F;  2BTQ B;  1VQL F;  3NVI B;  5CA1 A;  3D54 A;  3U0O A;  3JAT A;  4O4H B;  1W5B A;  4WBN A;  3JAL B;  1QD9 A;  4I55 B;  3JAS A;  4PWT A;  5JQG A;  2UZH A;  2BO1 A;  4BT7 A;  2VGN A;  1KQS F;  3IR9 A;  1U3L A;  4ZOL B;  3GYQ A;  3D00 A;  1FFX A;  4ZHQ A;  5LXT A;  3OBY A;  3VIU A;  1GZ0 A;  1ZWZ A;  3JCM M;  1U3P A;  1JFF B;  3OW2 F;  2ZAU A;  2CSL A;  2ZVZ A;  3LDT A;  3RYI A;  4O2B B;  3CYQ A;  3K12 A;  2UYP A;  2VAW A;  4U3J A;  3WXM B;  3HKE A;  4ZHY B;  4G4X A;  3G4S F;  5FNV B;  4BW0 B;  1SZQ A;  2HP0 A;  4TZZ A;  4HNA B;  2H6L A;  4IIJ B;  4YJ2 A;  4G4Y A;  5GAN K;  5EIB D;  3M84 A;  5LOV A;  2HRY A;  4O2A B;  2WAL A;  3IEW A;  3JAR B;  4X3M A;  5IYZ A;  4BVQ A;  3WGK A;  2AIZ P;  1W2B F;  3CXC F;  2JNB A;  2VAP A;  3WPW A;  2FC3 A;  3E22 B;  1VQ5 F;  1W42 A;  3VCZ A;  5KMG A;  1Q82 H;  1ODE A;  3HJW C;  1XBI A;  4DRX B;  3I56 F;  5HY4 A;  2CHT A;  5JCO A;  5C8Y A;  1FSZ A;  3IEQ A;  1W5F A;  3WJR A;  3KJK A;  3NK7 A;  5EWR A;  1M1K H;  4LNU A;  3V4D A;  5G4V C;  3HKB B;  3E20 B;  4X20 B;  3V7E A;  5KX5 B;  3WGN A;  2AMT A;  3AGK A;  4I50 B;  5FLX M;  3FD5 A;  2QA4 F;  4F6R B;  3VMF B;  2CW4 A;  3S06 A;  3JAM M;  2PHN A;  2B33 A;  4O4L B;  1W3E X;  5LA6 A;  1S72 F;  3C9U A;  1VK3 A;  2CZW A;  3MCA B;  1SA0 A;  4BVS A;  5HWE A;  5CA1 B;  1X25 A;  2CVL A;  3TD3 A;  3JAT B;  2ZOD A;  3CC4 F;  5GON B;  4DXD A;  3PLA C;  1U43 A;  3BYQ A;  2DT4 A;  4NUT A;  4WBN B;  3CC7 F;  3CC2 F;  5LYJ A;  3LWV C;  2YYE A;  3P4E A;  3JAS B;  4BT5 A;  5JQG B;  4EI7 A;  1VQ9 F;  5HP8 A;  3NK6 A;  5CB4 B;  2EWC A;  1UI9 A;  5BMV A;  3G6E F;  1IV3 A;  5EZY A;  5GIO C;  2OTL F;  2Q1Y A;  3MCQ A;  1FFX B;  4ZHQ B;  1H48 A;  2Z1U A;  2IQQ A;  5HP7 A;  2RHL A;  3S03 A;  1J7H A;  4B5C A;  3VOB A;  5MN6 A;  2Z01 A;  5JH7 A;  2Z1E A;  3K0T A;  2MQE A;  1ONI A;  4X1K A;  1YI2 F;  2K1S A;  1W40 A;  4TUY A;  5EYP A;  1VQP F;  4ZHW A;  4C81 A;  2QTP A;  3RA5 A;  3HKE B;  3WGL A;  3FD6 A;  5JVD A;  2HP0 B;  3I3F A;  4ZI7 B;  3PAF A;  1R1M A;  5GIP C;  3NMU C;  1QAH A;  1E7K A;  5EB1 B;  1TUB A;  5IYZ B;  3M4S A;  3IMP A;  4X1Y A;  1PXW A;  4ZHV A;  4O4I A;  5J2U B;  1K8A H;  3F0E A;  3OBW A;  3C9R A;  4EI9 A;  2IG8 A;  4EB6 A;  1YIT F;  5KMG B;  1GX1 A;  3VI6 A;  4X3L A;  3HTN A;  4C8G A;  5GIN C;  2G9I A;  5CA0 A;  4X1I A;  2I6R A;  2ZOV A;  1KD1 H;  4ERH A;  5G4U C;  1FNJ A;  4TV9 A;  5GAP K;  3LWO C;  4XCQ A;  4YJ3 A;  2R75 1;  5HY0 A;  1RLG A;  1JN1 A;  3CPQ A;  3EOR A;  2LBT A;  3QHD A;  3R0P A;  4G4W A;  4C4W C;  1NMU B;  3ELC A;  2ZF8 A;  5JCO C;  4RQO A;  4BT6 A;  1U40 A;  1W41 A;  2GZL A;  1W59 A;  3P10 A;  3WGM A;  3UT5 A;  3RA6 A;  3KE1 A;  1K73 H;  3N4Z A;  1X52 A;  1YJN F;  3F0F A;  1JJ2 F;  3CCS F;  5LA6 B;  3RYF A;  3S0H A;  3LME A;  1SA0 B;  4BT2 A;  5HY2 A;  2ZVY A;  3ZP4 A;  2OTM A;  1W55 A;  4TV8 A;  3V3T A;  4BT4 A;  3S02 A;  4O4J A;  3CME F;  1YQN A;  2VXY A;  5LYJ B;  5DCV A;  5FJ4 C;  3P0Z A;  1VHA A;  1OFU A;  4FFB A;  4C82 A;  5IJ9 A;  5BMV B;  5EZY B;  3OON A;  2RHJ A;  2HP3 A;  1W57 A;  2ALE A;  3N2K A;  3HKD B;  2VGM A;  1VQM F;  3E1Y A;  4X1K B;  3S0W A;  1JFF A;  4TUY B;  1QVG F;  3ZOP A;  5EYP B;  3CPW F;  3ZO8 A;  1UFY A;  1PF5 A;  4I4T A;  2V9Y A;  3JVH A;  4EI8 A;  2NMU A;  1VQ8 F;  4IIJ A;  5HXZ A;  3SIU A;  1TVK A;  1RLU A;  5EAZ A;  3JAW A;  4X1Y B;  2AIF A;  3CCJ F;  4O4I B;  2LBX A;  5LP6 A;  3O85 A;  1XRG A;  1Z5W A;  2IAF A;  3C9S A;  2GVI A;  3CCU F;  4EB6 B;  3CCQ F;  3WJQ A;  2HX0 A;  5A2Q M;  3N2G A;  3HKC A;  5LXT B;  3VYT C;  3DDN A;  4X1I B;  5AVM A;  2DYY A;  3CCR F;  4TV9 B;  1YGY A;  4M8I A;  2KTU A;  3CG6 A;  3VYU C;  3RYI B;  4YJ3 B;  4B62 A;  1Q8R A;  3WJP A;  3LWP C;  2I6D A;  1NJI H;  4U3J B;  3NVK E;  3FBA A;  2RHO A;  4U39 A;  5B8F A;  4NWO B;  3GTZ A;  3LYB A;  4IHJ A;  4YJ2 B;  3N4Y A;  2HQS C;  2UYK A;  3MBM A;  5IJ0 A;  5LOV B;  2BTU A;  1VQ4 F;  4I50 A;  2OHW A;  3ON1 A;  3UT5 B;  4B45 A;  3F0G A;  4G88 A;  2N48 A;  2HVY D;  3S0Y A;  3T80 A;  3CYP B;  5EB0 A;  3RYF B;  2UYJ A;  3KJJ A;  1Q86 H;  5HXU A;  2HS3 A;  2RHH A;  4G4Z A;  4NQ3 A;  3CD6 F;  3HAX D;  5J2T A;  1QVF F;  3KHN A;  1W5A A;  4B46 A;  4TV8 B;  1QU9 A;  3C9T A;  5GON A;  1SDS A;  3RYH A;  3WPX A;  4O4J B;  1RA4 A;  4LNU B;  1N8R H;  1RQ2 A;  1X7O A;  3VO8 A;  5EO3 A;  3CCE F;  2H8E A;  1YHQ F;  4FFB B;  2HS0 A;  3QUW A;  3G71 F;  3VOA A;  1JD1 A;  5IJ9 B;  1DBF A;  5CB4 A;  1K9M H;  3ESJ A;  3J81 M;  4E6E A;  1W58 1;  2HS4 A;  5ITZ A;  1CLI A;  2QEX F;  3RYC A;  3N2K B;  2CWJ A;  2UYN A;  4RHA A;  3M1X A;  2Z1F A;  2GLZ A;  3JAK A;  1IV2 A;  1VQN F;  4I4T B;  1Q7Y H;  4BT3 A; 
#chains in the Genus database with same CATH homology
 1JY8 A;  3B6N A;  3MBM A;  2PMP A;  1IV3 A;  1JN1 A;  4C8E A;  1VH8 A;  1W55 A;  3EOR A;  3K14 A;  3RE3 A;  3IEQ A;  1IV4 A;  1KNK A;  1H48 A;  3FPI A;  3F0G A;  3QHD A;  2UZH A;  4C8I A;  3IKF A;  3JVH A;  3ELC A;  3ESJ A;  1YQN A;  3F0E A;  3IEW A;  3T80 A;  1U3L A;  1U40 A;  2GZL A;  3P0Z A;  1VHA A;  3P10 A;  3K2X A;  1U43 A;  4C82 A;  3KE1 A;  4C81 A;  1GX1 A;  2AMT A;  3F0D A;  1KNJ A;  4C8G A;  1T0A A;  1H47 A;  3FBA A;  3GHZ A;  1U3P A;  1IV2 A;  3F0F A;  3IKE A;  1W57 A;  5B8F A;  3ERN A;  1IV1 A;  3F6M A;  3Q8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...