3S03A

The crystal structure of the periplasmic domain of helicobacter pylori motb (residues 97-256, p43).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
SVLEQIDQGSILKLPSNLLFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords Motility protein B
publication title Role of the MotB linker in the assembly and activation of the bacterial flagellar motor.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 41
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3s03A00
2ZVYA 2LCAA 4G4ZA 2LBTA 1R1MA 3TD4A 2N48A 2L26A 3S03A 3KHNA 4B62A 3S02A 4G4WA 5EB1B 3OONA 3WPXA 3TD3A 2K1SA 4ZHYB 2ZOVA 4R40B 2MQEA 2AIZP 3CYQA 4ERHA 4ZHVA 1OAPA 3S0YA 3S06A 2ZVZA 4G4XA 4B5CA 2HQSC 4PWTA 4G4YA 2W8BC 5EAZA 3LDTA 3S0HA 3TD5A 2ZF8A 2KGWA 4G88A 4ZHWA 5EB0A 3S0WA 3WPWA 3CYPB 3IMPA 4RHAA 4G4VA
chains in the Genus database with same CATH superfamily
1YI2F 1GX1A 2QI2A 5AVMA 4C82A 3CMEF 3C9RA 2QA4F 1E7KA 5GANK 3IR9A 4ZHQA 3O85A 1TVKB 3CG6A 1CK2A 1QVGF 3Q8HA 5HXUA 4IHJA 3J7AR 1VQNF 2OTJF 3F0GA 2VGMA 4F6RA 3MCQA 4BVTA 2QEXF 3GHZA 2GZLA 3LWPC 1PF5A 3RYCA 1IV2A 4ZHQB 5EIBC 3CCRF 5LA6A 3IEWA 1K73H 4IHJB 3ZP7A 3K2XA 4EB6A 4U3JA 2H8CA 2UYNA 5LOVA 3T80A 4C8GA 3ON1A 4F6RB 4E6EA 5HY4A 4G4WA 5LYJA 4I50A 3E22A 2MQEA 5CA0A 4ZHVA 2HP0A 1Q8RA 5LA6B 2HVYD 3CCMF 3FD6A 1Z5VA 1W5AA 2GVIA 4DXDA 5DCVA 2UYNB 5LOVB 5G4UC 4BT5A 1TUBA 5JQGA 3DDNA 5LYJB 1FNJA 4I50B 3E22B 1X52A 4I4TA 2VAWA 5CA0B 1W2BF 2HP0B 3NVKE 4YJ2A 5FLXM 1DBFA 3HKBA 2AIFA 4TV9A 5MN6A 2BTUA 3HKDA 5HY2A 3MDOA 1TUBB 5JQGB 1UFYA 3RYFA 4ZOLA 3FD5A 1KNKA 3HKCA 2HQSC 5HP8A 1QD9A 5GIOC 2VAPA 3VI6A 1W59A 2Z1FA 3TD5A 3V3TA 4YJ2B 3CCSF 1SZQA 2KTVA 4NUTA 1VQVA 3HKBB 4KWEA 4TV9B 1Q81H 3HKDB 3JAKA 5J2TA 5FNVA 2HS3A 5JCOA 4TV8A 4EI9A 2LBTA 3F6MA 3RYFB 3TD4A 2CHSA 4ZOLB 3RA6A 1VQOF 1VQPF 3NVIB 1H47A 3HKCB 3S02A 2R751 2HRYA 1YGYA 3IKEA 4BT4A 1U3PA 3C9TA 4TUYA 1FFXA 3CYQA 1Q86H 5EZYA 3ZP4A 4NQ3A 2UYJA 4B5CA 3JAKB 5J2TB 3CCJF 5FNVB 4PWTA 2B33A 4TV8B 2RHJA 5EAZA 1VQ9F 1YITF 3D54A 3K0TA 4ZI7A 3G6EF 4BVRA 1JFFA 2HP3A 4X3LA 1H7MA 3JARA 3KJKA 4TUYB 1FFXB 1ODEA 5EZYB 5IJ0A 1S72F 3HKEA 4O4IA 2ZAUA 5GAPK 2I6DA 3FBAA 2G9IA 4NWOB 3OONA 2ZOVA 2RHOA 5EO3A 4ZI7B 3ELCA 1OAPA 1J7HA 2QTPA 1JFFB 5JVDA 3JARB 3N2GA 5IJ0B 3HKEB 4O4IB 3G4SF 4C81A 3HTNA 2RHLA 1W40A 3E20B 4B45A 1W41A 3CYPB 1IV3A 1KQSF 4BT7A 3J80M 4O4LA 2FGYA 3LYBA 1VHAA 3LWOC 2VXYA 2LBXA 5JVDB 3N2GB 3WPXA 3TD3A 2CWJA 4ZHYB 3LMEA 3N4YA 4BT6A 5LP6A 5J2UA 4EI8A 3CXCF 1W3EX 4X1KA 5KX5A 5HXZA 4O4LB 3I56F 4BW0B 3I3FA 3WPWA 3GTZA 3CCLF 3BYQA 4BVQA 5FJ4C 1W5BA 4RHAA 3ZO8A 3JASA 3KE1A 1PXWA 2DYYA 5LP6B 5J2UB 2RHHA 1JN1A 2UYPA 3I7TA 4X1KB 5KX5B 4U39A 1H48A 3KHNA 3S03A 2CVLA 3CCQF 5ITZB 2WALA 3CPWF 4X20A 3RYCB 1YHQF 1KNJA 3QTYA 3WGJA 5C8YA 4LCKA 3S0YA 3CD6F 2KG4A 5BMVA 4C8EA 2DT4A 3JASB 3VTIC 3NMUC 4O2BA 4EB6B 4U3JB 3K14A 5EB0A 2KTUA 2BO1A 3G71F 2HRUA 2OZBA 3N2KA 3AGKA 2ZVYA 5EYPA 4X20B 1N8RH 1CN7A 1OFUA 3UT5A 5LXTA 3JVHA 3WJRA 5BMVB 1XRGA 1VQ6F 2H8EA 3WJQA 2H6LA 4O2BB 4R40B 3C9UA 2NMUA 1VQKF 1DT9A 4BT2A 3VYUC 3ESJA 1U43A 2R6R1 4I55A 2VAMA 1SDSA 3N2KB 5EYPB 2CHTA 2V9YA 4I4TB 3UT5B 3LDTA 5LXTB 4TZZA 2KGWA 4XCQA 2OHWA 4X1YA 4X1IA 3V7QA 1Z5WA 3VYSC 3QHDA 3D01A 4O4JA 3CMAF 4I55B 3M84A 2Z1TA 4B62A 2YXZA 5HY1A 5EB1B 3CCUF 4DRXA 2BTOA 3LFOA 5KMGA 1IV4A 1SA0A 4X1YB 4X1IB 2BTQB 2FC3A 4IIJA 5GONA 2YYEA 4O4JB 3LWVC 3LWQC 3PAFA 1K9MH 3PLAC 3C9SA 1KD1H 5B8FA 4O2AA 4DRXB 2VGNA 2Z1UA 3WXMB 5KMGB 3V4DA 1SA0B 3M1XA 5IJ9A 3CC2F 3ZOPA 1XV2A 5HWEA 1JY8A 2P6YA 4IIJB 5GONB 4M8IA 5G4VC 1X7OA 3OBWA 3S06A 2IG8A 4O2AB 2JNBA 4BVSA 3L7QA 5JCOC 1QVFF 1RLGA 3HWUA 5EIBD 5IJ9B 3VMFB 2PMPA 1CLIA 1JD1A 3SIVA 3WJPA 1Q7YH 3DC2A 2LBWA 2CSLA 5EWRA 2HS4A 5IYZA 1YJNF 1ZWZA 1YJ9F 2CZWA 1W5FA 1GO1A 1FSZA 2UYKA 3RE3A 5MN5A 1VQ8F 3OBYA 4FFBA 1YQNA 3JCMM 2Z01A 3P0ZA 1YJWF 4C4WC 2F9ZC 4G88A 1W42A 1T0KB 3CCEF 2IQQA 2HX0A 5HP7A 5IYZB 4X3MA 4YJ3A 1R1MA 4FFBB 2IAFA 3WGMA 1VQ4F 1ONIA 1X25A 3VYTC 1Q82H 3J81M 1VQ7F 4WBNA 1IV1A 2EWCA 2OTMA 5GINC 3K12A 3GYQA 1RLUA 4G4XA 4O4HA 3F0EA 1W5EA 3RYIA 3WGNA 4YJ3B 4G4YA 5MN4A 1NJIH 3JATA 1VH8A 1W57A 3JAWA 3IEQA 1NMUB 2Z1EA 3IMPA 3V7EA 3U0OA 4WBNB 5LP6C 4G4ZA 3E1YA 5C8YB 4O4HB 3RYIB 1QAHA 3VO8A 3NK7A 3JATB 3OW2F 3JAWB 1VQMF 3KIZA 3M4SA 1M1KH 5HY0A 3CC4F 1UI9A 3VOBA 2ZVZA 3HJWC 2ZODA 4EI7A 1U40A 3C8LA 2ZF8A 1K8AH 3HAXD 1RQ7A 2HS0A 1VK3A 2Q1XA 3KJJA 1VQLF 3SIUA 4C8IA 3D00A 3N4ZA 5IT9M 4ERHA 1KC8H 4BT3A 3P4EA 3JALA 1YIJF 2PHNA 5JH7A 3S0HA 2CW4A 5CB4A 3I55F 3P10A 5GIPC 4B46A 4G4VA 3CCVF 2LCAA 1NQ3A 1FNKA 1XHOA 3MQWA 3LWRC 2L26A 3ERNA 1T0AA 3JALB 3IKFA 2GLZA 3NK6A 2AMTA 3VOAA 1GO0A 5JH7B 1JJ2F 3CPQA 3VIUA 5CB4B 1QU9A 2AIZP 3WGLA 3WGKA 5CA1A 3FPIA 1VQ5F 1U3LA 3R0PA 2I6RA 1W581 3RYHA 4LNUA 3S0WA 2Q1YA 1X7PA 4ZK7A 2UZHA 4RQOA 3B6NA 3EORA 3CB2A 3MBMA 3MCAB 1COMA 2N48A 5CA1B 3FFMA 1XBIA 3QUWA 1M90H 3RYHB 3F0DA 4LNUB 4HNAA 2K1SA 5ITZA 3VCZA 3JAMM 1RQ2A 2ALEA 1TVKA 1GZ0A 1W55A 4BY9D 5A2QM 2W8BC 3CC7F 3F0FA 1RA4A 4ZHWA 1IPAA 2OTLF 3RA5A 4HNAB 2RB9A
chains in the Genus database with same CATH topology
2ZVYA 2LCAA 4G4ZA 2LBTA 1R1MA 3TD4A 2N48A 2L26A 3S03A 3KHNA 4B62A 3S02A 4G4WA 5EB1B 3OONA 3WPXA 3TD3A 2K1SA 4ZHYB 2ZOVA 4R40B 2MQEA 2AIZP 3CYQA 4ERHA 4ZHVA 1OAPA 3S0YA 3S06A 2ZVZA 4G4XA 4B5CA 2HQSC 4PWTA 4G4YA 2W8BC 5EAZA 3LDTA 3S0HA 3TD5A 2ZF8A 2KGWA 4G88A 4ZHWA 5EB0A 3S0WA 3WPWA 3CYPB 3IMPA 4RHAA 4G4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVY A;  2LCA A;  4G4Z A;  2LBT A;  1R1M A;  3TD4 A;  2N48 A;  2L26 A;  3S03 A;  3KHN A;  4B62 A;  3S02 A;  4G4W A;  5EB1 B;  3OON A;  3WPX A;  3TD3 A;  2K1S A;  4ZHY B;  2ZOV A;  4R40 B;  2MQE A;  2AIZ P;  3CYQ A;  4ERH A;  4ZHV A;  1OAP A;  3S0Y A;  3S06 A;  2ZVZ A;  4G4X A;  4B5C A;  2HQS C;  4PWT A;  4G4Y A;  2W8B C;  5EAZ A;  3LDT A;  3S0H A;  3TD5 A;  2ZF8 A;  2KGW A;  4G88 A;  4ZHW A;  5EB0 A;  3S0W A;  3WPW A;  3CYP B;  3IMP A;  4RHA A;  4G4V A; 
#chains in the Genus database with same CATH topology
 1YI2 F;  1GX1 A;  2QI2 A;  5AVM A;  4C82 A;  3CME F;  3C9R A;  2QA4 F;  1E7K A;  5GAN K;  3IR9 A;  4ZHQ A;  3O85 A;  1TVK B;  3CG6 A;  1CK2 A;  1QVG F;  3Q8H A;  5HXU A;  4IHJ A;  3J7A R;  1VQN F;  2OTJ F;  3F0G A;  2VGM A;  4F6R A;  3MCQ A;  4BVT A;  2QEX F;  3GHZ A;  2GZL A;  3LWP C;  1PF5 A;  3RYC A;  1IV2 A;  4ZHQ B;  5EIB C;  3CCR F;  5LA6 A;  3IEW A;  1K73 H;  4IHJ B;  3ZP7 A;  3K2X A;  4EB6 A;  4U3J A;  2H8C A;  2UYN A;  5LOV A;  3T80 A;  4C8G A;  3ON1 A;  4F6R B;  4E6E A;  5HY4 A;  4G4W A;  5LYJ A;  4I50 A;  3E22 A;  2MQE A;  5CA0 A;  4ZHV A;  2HP0 A;  1Q8R A;  5LA6 B;  2HVY D;  3CCM F;  3FD6 A;  1Z5V A;  1W5A A;  2GVI A;  4DXD A;  5DCV A;  2UYN B;  5LOV B;  5G4U C;  4BT5 A;  1TUB A;  5JQG A;  3DDN A;  5LYJ B;  1FNJ A;  4I50 B;  3E22 B;  1X52 A;  4I4T A;  2VAW A;  5CA0 B;  1W2B F;  2HP0 B;  3NVK E;  4YJ2 A;  5FLX M;  1DBF A;  3HKB A;  2AIF A;  4TV9 A;  5MN6 A;  2BTU A;  3HKD A;  5HY2 A;  3MDO A;  1TUB B;  5JQG B;  1UFY A;  3RYF A;  4ZOL A;  3FD5 A;  1KNK A;  3HKC A;  2HQS C;  5HP8 A;  1QD9 A;  5GIO C;  2VAP A;  3VI6 A;  1W59 A;  2Z1F A;  3TD5 A;  3V3T A;  4YJ2 B;  3CCS F;  1SZQ A;  2KTV A;  4NUT A;  1VQV A;  3HKB B;  4KWE A;  4TV9 B;  1Q81 H;  3HKD B;  3JAK A;  5J2T A;  5FNV A;  2HS3 A;  5JCO A;  4TV8 A;  4EI9 A;  2LBT A;  3F6M A;  3RYF B;  3TD4 A;  2CHS A;  4ZOL B;  3RA6 A;  1VQO F;  1VQP F;  3NVI B;  1H47 A;  3HKC B;  3S02 A;  2R75 1;  2HRY A;  1YGY A;  3IKE A;  4BT4 A;  1U3P A;  3C9T A;  4TUY A;  1FFX A;  3CYQ A;  1Q86 H;  5EZY A;  3ZP4 A;  4NQ3 A;  2UYJ A;  4B5C A;  3JAK B;  5J2T B;  3CCJ F;  5FNV B;  4PWT A;  2B33 A;  4TV8 B;  2RHJ A;  5EAZ A;  1VQ9 F;  1YIT F;  3D54 A;  3K0T A;  4ZI7 A;  3G6E F;  4BVR A;  1JFF A;  2HP3 A;  4X3L A;  1H7M A;  3JAR A;  3KJK A;  4TUY B;  1FFX B;  1ODE A;  5EZY B;  5IJ0 A;  1S72 F;  3HKE A;  4O4I A;  2ZAU A;  5GAP K;  2I6D A;  3FBA A;  2G9I A;  4NWO B;  3OON A;  2ZOV A;  2RHO A;  5EO3 A;  4ZI7 B;  3ELC A;  1OAP A;  1J7H A;  2QTP A;  1JFF B;  5JVD A;  3JAR B;  3N2G A;  5IJ0 B;  3HKE B;  4O4I B;  3G4S F;  4C81 A;  3HTN A;  2RHL A;  1W40 A;  3E20 B;  4B45 A;  1W41 A;  3CYP B;  1IV3 A;  1KQS F;  4BT7 A;  3J80 M;  4O4L A;  2FGY A;  3LYB A;  1VHA A;  3LWO C;  2VXY A;  2LBX A;  5JVD B;  3N2G B;  3WPX A;  3TD3 A;  2CWJ A;  4ZHY B;  3LME A;  3N4Y A;  4BT6 A;  5LP6 A;  5J2U A;  4EI8 A;  3CXC F;  1W3E X;  4X1K A;  5KX5 A;  5HXZ A;  4O4L B;  3I56 F;  4BW0 B;  3I3F A;  3WPW A;  3GTZ A;  3CCL F;  3BYQ A;  4BVQ A;  5FJ4 C;  1W5B A;  4RHA A;  3ZO8 A;  3JAS A;  3KE1 A;  1PXW A;  2DYY A;  5LP6 B;  5J2U B;  2RHH A;  1JN1 A;  2UYP A;  3I7T A;  4X1K B;  5KX5 B;  4U39 A;  1H48 A;  3KHN A;  3S03 A;  2CVL A;  3CCQ F;  5ITZ B;  2WAL A;  3CPW F;  4X20 A;  3RYC B;  1YHQ F;  1KNJ A;  3QTY A;  3WGJ A;  5C8Y A;  4LCK A;  3S0Y A;  3CD6 F;  2KG4 A;  5BMV A;  4C8E A;  2DT4 A;  3JAS B;  3VTI C;  3NMU C;  4O2B A;  4EB6 B;  4U3J B;  3K14 A;  5EB0 A;  2KTU A;  2BO1 A;  3G71 F;  2HRU A;  2OZB A;  3N2K A;  3AGK A;  2ZVY A;  5EYP A;  4X20 B;  1N8R H;  1CN7 A;  1OFU A;  3UT5 A;  5LXT A;  3JVH A;  3WJR A;  5BMV B;  1XRG A;  1VQ6 F;  2H8E A;  3WJQ A;  2H6L A;  4O2B B;  4R40 B;  3C9U A;  2NMU A;  1VQK F;  1DT9 A;  4BT2 A;  3VYU C;  3ESJ A;  1U43 A;  2R6R 1;  4I55 A;  2VAM A;  1SDS A;  3N2K B;  5EYP B;  2CHT A;  2V9Y A;  4I4T B;  3UT5 B;  3LDT A;  5LXT B;  4TZZ A;  2KGW A;  4XCQ A;  2OHW A;  4X1Y A;  4X1I A;  3V7Q A;  1Z5W A;  3VYS C;  3QHD A;  3D01 A;  4O4J A;  3CMA F;  4I55 B;  3M84 A;  2Z1T A;  4B62 A;  2YXZ A;  5HY1 A;  5EB1 B;  3CCU F;  4DRX A;  2BTO A;  3LFO A;  5KMG A;  1IV4 A;  1SA0 A;  4X1Y B;  4X1I B;  2BTQ B;  2FC3 A;  4IIJ A;  5GON A;  2YYE A;  4O4J B;  3LWV C;  3LWQ C;  3PAF A;  1K9M H;  3PLA C;  3C9S A;  1KD1 H;  5B8F A;  4O2A A;  4DRX B;  2VGN A;  2Z1U A;  3WXM B;  5KMG B;  3V4D A;  1SA0 B;  3M1X A;  5IJ9 A;  3CC2 F;  3ZOP A;  1XV2 A;  5HWE A;  1JY8 A;  2P6Y A;  4IIJ B;  5GON B;  4M8I A;  5G4V C;  1X7O A;  3OBW A;  3S06 A;  2IG8 A;  4O2A B;  2JNB A;  4BVS A;  3L7Q A;  5JCO C;  1QVF F;  1RLG A;  3HWU A;  5EIB D;  5IJ9 B;  3VMF B;  2PMP A;  1CLI A;  1JD1 A;  3SIV A;  3WJP A;  1Q7Y H;  3DC2 A;  2LBW A;  2CSL A;  5EWR A;  2HS4 A;  5IYZ A;  1YJN F;  1ZWZ A;  1YJ9 F;  2CZW A;  1W5F A;  1GO1 A;  1FSZ A;  2UYK A;  3RE3 A;  5MN5 A;  1VQ8 F;  3OBY A;  4FFB A;  1YQN A;  3JCM M;  2Z01 A;  3P0Z A;  1YJW F;  4C4W C;  2F9Z C;  4G88 A;  1W42 A;  1T0K B;  3CCE F;  2IQQ A;  2HX0 A;  5HP7 A;  5IYZ B;  4X3M A;  4YJ3 A;  1R1M A;  4FFB B;  2IAF A;  3WGM A;  1VQ4 F;  1ONI A;  1X25 A;  3VYT C;  1Q82 H;  3J81 M;  1VQ7 F;  4WBN A;  1IV1 A;  2EWC A;  2OTM A;  5GIN C;  3K12 A;  3GYQ A;  1RLU A;  4G4X A;  4O4H A;  3F0E A;  1W5E A;  3RYI A;  3WGN A;  4YJ3 B;  4G4Y A;  5MN4 A;  1NJI H;  3JAT A;  1VH8 A;  1W57 A;  3JAW A;  3IEQ A;  1NMU B;  2Z1E A;  3IMP A;  3V7E A;  3U0O A;  4WBN B;  5LP6 C;  4G4Z A;  3E1Y A;  5C8Y B;  4O4H B;  3RYI B;  1QAH A;  3VO8 A;  3NK7 A;  3JAT B;  3OW2 F;  3JAW B;  1VQM F;  3KIZ A;  3M4S A;  1M1K H;  5HY0 A;  3CC4 F;  1UI9 A;  3VOB A;  2ZVZ A;  3HJW C;  2ZOD A;  4EI7 A;  1U40 A;  3C8L A;  2ZF8 A;  1K8A H;  3HAX D;  1RQ7 A;  2HS0 A;  1VK3 A;  2Q1X A;  3KJJ A;  1VQL F;  3SIU A;  4C8I A;  3D00 A;  3N4Z A;  5IT9 M;  4ERH A;  1KC8 H;  4BT3 A;  3P4E A;  3JAL A;  1YIJ F;  2PHN A;  5JH7 A;  3S0H A;  2CW4 A;  5CB4 A;  3I55 F;  3P10 A;  5GIP C;  4B46 A;  4G4V A;  3CCV F;  2LCA A;  1NQ3 A;  1FNK A;  1XHO A;  3MQW A;  3LWR C;  2L26 A;  3ERN A;  1T0A A;  3JAL B;  3IKF A;  2GLZ A;  3NK6 A;  2AMT A;  3VOA A;  1GO0 A;  5JH7 B;  1JJ2 F;  3CPQ A;  3VIU A;  5CB4 B;  1QU9 A;  2AIZ P;  3WGL A;  3WGK A;  5CA1 A;  3FPI A;  1VQ5 F;  1U3L A;  3R0P A;  2I6R A;  1W58 1;  3RYH A;  4LNU A;  3S0W A;  2Q1Y A;  1X7P A;  4ZK7 A;  2UZH A;  4RQO A;  3B6N A;  3EOR A;  3CB2 A;  3MBM A;  3MCA B;  1COM A;  2N48 A;  5CA1 B;  3FFM A;  1XBI A;  3QUW A;  1M90 H;  3RYH B;  3F0D A;  4LNU B;  4HNA A;  2K1S A;  5ITZ A;  3VCZ A;  3JAM M;  1RQ2 A;  2ALE A;  1TVK A;  1GZ0 A;  1W55 A;  4BY9 D;  5A2Q M;  2W8B C;  3CC7 F;  3F0F A;  1RA4 A;  4ZHW A;  1IPA A;  2OTL F;  3RA5 A;  4HNA B;  2RB9 A; 
#chains in the Genus database with same CATH homology
 2ZVY A;  2LCA A;  4G4Z A;  2LBT A;  1R1M A;  3TD4 A;  2N48 A;  2L26 A;  3S03 A;  3KHN A;  4B62 A;  3S02 A;  4G4W A;  5EB1 B;  3OON A;  3WPX A;  3TD3 A;  2K1S A;  4ZHY B;  2ZOV A;  4R40 B;  2MQE A;  2AIZ P;  3CYQ A;  4ERH A;  4ZHV A;  1OAP A;  3S0Y A;  3S06 A;  2ZVZ A;  4G4X A;  4B5C A;  2HQS C;  4PWT A;  4G4Y A;  2W8B C;  5EAZ A;  3LDT A;  3S0H A;  3TD5 A;  2ZF8 A;  2KGW A;  4G88 A;  4ZHW A;  5EB0 A;  3S0W A;  3WPW A;  3CYP B;  3IMP A;  4RHA A;  4G4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...