3S03A

The crystal structure of the periplasmic domain of helicobacter pylori motb (residues 97-256, p43).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
b'SVLEQIDQGSILKLPSNLLFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motility protein B
molecule tags Motor protein
source organism Helicobacter pylori
publication title Role of the MotB linker in the assembly and activation of the bacterial flagellar motor.
pubmed doi rcsb
total genus 41
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3s03A00
2MQEA 2N48A 2W8BC 3S03A 3WPWA 2HQSC 2ZVZA 2ZF8A 4PWTA 3TD5A 2LCAA 3KHNA 1R1MA 3S0YA 2ZVYA 3OONA 3S0HA 1OAPA 4G4XA 3S02A 5EB1B 2LBTA 4G4WA 5EB0A 4G4ZA 3S0WA 3TD3A 4G4VA 4B5CA 3WPXA 2L26A 4ERHA 4B62A 2ZOVA 4G88A 3CYPB 5EAZA 3TD4A 2K1SA 3IMPA 4ZHYB 4R40B 3CYQA 2AIZP 4G4YA 4RHAA 4ZHVA 4ZHWA 3S06A 3LDTA 2KGWA
chains in the Genus database with same CATH superfamily
2HP0A 4NUTA 2UZHA 4C8EA 5HP7A 1DBFA 2CSLA 3IEWA 1TVKB 3FPIA 3DDNA 1JFFB 1U3PA 2UYNB 4FFBB 2ALEA 5JQGA 4C4WC 2IQQA 3CCUF 3OBWA 3WGNA 4TV9A 3HKCA 5G4UC 3IEQA 2Q1XA 5EAZA 4WBNA 2Z1UA 3RYFB 1X25A 3ON1A 3JALA 4ZHQA 5KMGB 3CCLF 3UT5B 2H8EA 1PF5A 2B33A 2V9YA 3WJRA 5MN4A 5DCVA 3F0FA 5GIOC 5FJ4C 2RHOA 3E1YA 1R1MA 3WJQA 3J80M 1OAPA 4C82A 3K0TA 4BT3A 2BO1A 2DT4A 4NWOB 1YIJF 3K14A 1CK2A 1XV2A 1VQKF 1DT9A 1Q82H 3PLAC 1W3EX 2G9IA 3HKCB 5EYPA 4F6RB 2QEXF 3JARB 3MDOA 4RHAA 5LYJA 2EWCA 2YXZA 3LWOC 1W41A 1VQ6F 3WXMB 4YJ2B 1XHOA 5FNVA 2HQSC 1YITF 3JAWB 1RLUA 3RYCB 2KTUA 1Z5VA 3FD5A 5FLXM 3GTZA 1W5BA 5GONB 2CZWA 1YJNF 3M1XA 4G4WA 5EB0A 1YJWF 5CB4B 4I50B 2HRUA 2WALA 2VAWA 4X1IA 1QAHA 3PAFA 2GVIA 2DYYA 5IJ9B 3CB2A 4O2BB 3N4YA 2HRYA 3CCRF 3HTNA 3CYQA 1VQPF 3VIUA 4IIJB 2KGWA 1E7KA 5LYJB 4KWEA 5BMVB 3CMAF 1W5FA 1PXWA 5EIBC 4U3JB 2VGMA 4B45A 1KNKA 5JVDA 2FC3A 1ZWZA 2LCAA 4BT7A 3KHNA 2AMTA 3LWVC 2VXYA 5JH7B 3NMUC 3HKBB 3P4EA 3JAMM 3CC4F 3SIUA 1GO1A 3G6EF 5HXUA 4O4JB 3LWPC 1M90H 3M84A 3CCMF 3GYQA 3KJJA 5C8YB 2Z01A 1S72F 2GZLA 3C9SA 1W2BF 4IIJA 5J2TA 5LP6B 1T0AA 3HKEB 1RQ7A 1VQLF 3MCAB 2IG8A 5HY1A 3S0YA 3V7EA 3E20B 1XBIA 3V7QA 1RLGA 2VAMA 3TD3A 4O2AB 2PHNA 3VO8A 1TUBA 2QA4F 1KNJA 1W5AA 2L26A 3JASA 2Z1FA 5EZYA 5AVMA 2F9ZC 1JY8A 3VYSC 3IMPA 1K8AH 1H48A 2IAFA 2LBXA 1VHAA 3ZOPA 4ZHWA 5LA6A 3N2GB 2VGNA 3G4SF 2H6LA 4TUYA 4ZI7A 5LOVB 5JQGB 2JNBA 2CVLA 2LBTA 3F0GA 4G4ZA 1VQMF 1JN1A 3CPWF 4WBNB 1TUBB 2HS0A 2VAPA 4O4LB 3JASB 5EZYB 2P6YA 3OBYA 5KMGA 1YI2F 3IKFA 1U3LA 2HP3A 2R751 3I3FA 4ZOLB 4BT5A 3NVIB 5LA6B 4BT2A 3J7AR 3KJKA 3CD6F 3F0DA 2KG4A 1QVFF 2QTPA 3D01A 2CW4A 4DRXB 3OONA 4X20A 4TUYB 1W59A 4XCQA 2RHJA 4I55A 4X3MA 5CB4A 3NVKE 3S02A 3CPQA 5GANK 4X1IB 3CC7F 3E22A 1GX1A 4O2BA 2OZBA 1QU9A 5EYPB 3VYTC 4F6RA 3HAXD 5HWEA 4EI7A 2RHLA 4TV9B 1VQ7F 4YJ2A 3JALB 4ZOLA 1OFUA 1SZQA 2UYKA 4ZHQB 5EO3A 4C8GA 5JH7A 1YGYA 3JAWA 2HVYD 2BTUA 4HNAA 1IPAA 3OW2F 3J81M 5GONA 3RA5A 4G4XA 3ESJA 3N4ZA 4X1YB 3RYHB 1Z5WA 4IHJB 2FGYA 1YJ9F 5IJ9A 1YHQF 3C9RA 4BVSA 5JCOA 2RB9A 4C8IA 3SIVA 4B46A 5J2TB 4G4YA 5LP6A 3QUWA 1T0KB 1RA4A 1IV3A 1VQ8F 5LXTB 3FBAA 1XRGA 4BW0B 3IR9A 3HKBA 5KX5B 4EB6B 5FNVB 5IYZA 4EI8A 4BVQA 4O4HA 1SDSA 4ZK7A 3CCQF 4O4JA 3CMEF 4TZZA 4X1YA 1K9MH 3T80A 1W581 1W5EA 4IHJA 1W55A 4LNUA 4B62A 2Z1EA 3WGLA 1N8RH 1NQ3A 3MBMA 4R40B 1W40A 4U39A 2R6R1 4M8IA 3VOAA 4G4VA 1K73H 1VQ4F 2MQEA 5HY4A 2YYEA 3S03A 1Q8RA 4ZI7B 2ZF8A 5CA0B 2OHWA 1X52A 3U0OA 1YQNA 3N2KB 3JCMM 3P0ZA 1U40A 5J2UB 3RYIA 3LMEA 4X1KB 3HJWC 5IJ0B 4ERHA 1J7HA 1U43A 2HS4A 4LNUB 3ZP7A 2AIZP 3M4SA 3V4DA 1KQSF 3KE1A 3B6NA 1H7MA 4X20B 2ZVZA 1UFYA 1TVKA 3CCVF 4O4IA 1VQ9F 1JJ2F 1JFFA 4FFBA 3JATB 4BVTA 3HKEA 2ZVYA 3R0PA 5MN5A 1Q86H 1FNJA 3E22B 4YJ3B 3LYBA 3FD6A 4X3LA 3HWUA 3CG6A 5ITZB 3WGMA 3JVHA 4G88A 3CYPB 5HXZA 4NQ3A 4EI9A 5CA1A 1VK3A 3LDTA 3GHZA 1CLIA 2KTVA 2W8BC 4E6EA 3Q8HA 4HNAB 3CC2F 3I55F 1ONIA 3NK7A 3N2GA 4O4IB 1NJIH 3JAKA 1JD1A 3C9UA 5EB1B 2UYNA 5LOVA 3S0WA 1QVGF 1VQVA 2OTLF 3RA6A 1FSZA 3O85A 3D54A 3K2XA 1Q7YH 3TD4A 2K1SA 5ITZA 4C81A 5EIBD 3LWQC 4ZHVA 1GZ0A 4BT4A 1KC8H 1CN7A 2I6RA 3WPWA 5IYZB 5B8FA 4O4HB 3WJPA 3EORA 1KD1H 5G4VC 2I6DA 3RE3A 4I50A 2CHTA 3VYUC 3RYHA 4DRXA 1NMUB 2HX0A 2UYPA 3DC2A 3VMFB 1Q81H 4I55B 1IV4A 1W57A 1COMA 1VQOF 4B5CA 4TV8A 3BYQA 4BY9D 2HS3A 5HY0A 5GIPC 4LCKA 1IV1A 3IKEA 3P10A 1QD9A 3L7QA 5BMVA 3RYFA 2N48A 4RQOA 2AIFA 2BTQB 4BT6A 3QHDA 5KX5A 4EB6A 3CCJF 4PWTA 3N2KA 1GO0A 1X7OA 3FFMA 3WGKA 5IT9M 3RYCA 3LFOA 3ZO8A 2BTOA 3C8LA 4X1KA 2Z1TA 4I4TA 3LWRC 2CWJA 4DXDA 3G71F 3MQWA 2NMUA 1W42A 2ZOVA 4TV8B 1VH8A 4ZHYB 1VQNF 3HKDA 1X7PA 2Q1YA 2ZAUA 1SA0B 3JARA 3JATA 5CA0A 1FFXA 3QTYA 5LP6C 3VTIC 3I56F 5LXTA 2UYJA 3RYIB 5J2UA 2CHSA 3VI6A 3CXCF 4I4TB 5IJ0A 3WPXA 2QI2A 1VQ5F 1RQ2A 3VOBA 1FNKA 5C8YA 2HP0B 3HKDB 3VCZA 3CCEF 2ZODA 5GINC 1ODEA 5HP8A 3KIZA 1SA0A 3K12A 3MCQA 4BVRA 3JAKB 2OTJF 3TD5A 1FFXB 5GAPK 3NK6A 4U3JA 2LBWA 3F6MA 5JVDB 4YJ3A 3S0HA 5A2QM 3ZP4A 2GLZA 1IV2A 3I7TA 3ELCA 5JCOC 3F0EA 4O4LA 2OTMA 3AGKA 2H8CA 4O2AA 2PMPA 5EWRA 5CA1B 5MN6A 2RHHA 3CCSF 3ERNA 1UI9A 3WGJA 3UT5A 3V3TA 5HY2A 1M1KH 3S06A 3C9TA 1H47A 3D00A
chains in the Genus database with same CATH topology
2MQEA 2N48A 2W8BC 3S03A 3WPWA 2HQSC 2ZVZA 2ZF8A 4PWTA 3TD5A 2LCAA 3KHNA 1R1MA 3S0YA 2ZVYA 3OONA 3S0HA 1OAPA 4G4XA 3S02A 5EB1B 2LBTA 4G4WA 5EB0A 4G4ZA 3S0WA 3TD3A 4G4VA 4B5CA 3WPXA 2L26A 4ERHA 4B62A 2ZOVA 4G88A 3CYPB 5EAZA 3TD4A 2K1SA 3IMPA 4ZHYB 4R40B 3CYQA 2AIZP 4G4YA 4RHAA 4ZHVA 4ZHWA 3S06A 3LDTA 2KGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQE A;  2N48 A;  2W8B C;  3S03 A;  3WPW A;  2HQS C;  2ZVZ A;  2ZF8 A;  4PWT A;  3TD5 A;  2LCA A;  3KHN A;  1R1M A;  3S0Y A;  2ZVY A;  3OON A;  3S0H A;  1OAP A;  4G4X A;  3S02 A;  5EB1 B;  2LBT A;  4G4W A;  5EB0 A;  4G4Z A;  3S0W A;  3TD3 A;  4G4V A;  4B5C A;  3WPX A;  2L26 A;  4ERH A;  4B62 A;  2ZOV A;  4G88 A;  3CYP B;  5EAZ A;  3TD4 A;  2K1S A;  3IMP A;  4ZHY B;  4R40 B;  3CYQ A;  2AIZ P;  4G4Y A;  4RHA A;  4ZHV A;  4ZHW A;  3S06 A;  3LDT A;  2KGW A; 
#chains in the Genus database with same CATH topology
 2HP0 A;  4NUT A;  2UZH A;  4C8E A;  5HP7 A;  1DBF A;  2CSL A;  3IEW A;  1TVK B;  3FPI A;  3DDN A;  1JFF B;  1U3P A;  2UYN B;  4FFB B;  2ALE A;  5JQG A;  4C4W C;  2IQQ A;  3CCU F;  3OBW A;  3WGN A;  4TV9 A;  3HKC A;  5G4U C;  3IEQ A;  2Q1X A;  5EAZ A;  4WBN A;  2Z1U A;  3RYF B;  1X25 A;  3ON1 A;  3JAL A;  4ZHQ A;  5KMG B;  3CCL F;  3UT5 B;  2H8E A;  1PF5 A;  2B33 A;  2V9Y A;  3WJR A;  5MN4 A;  5DCV A;  3F0F A;  5GIO C;  5FJ4 C;  2RHO A;  3E1Y A;  1R1M A;  3WJQ A;  3J80 M;  1OAP A;  4C82 A;  3K0T A;  4BT3 A;  2BO1 A;  2DT4 A;  4NWO B;  1YIJ F;  3K14 A;  1CK2 A;  1XV2 A;  1VQK F;  1DT9 A;  1Q82 H;  3PLA C;  1W3E X;  2G9I A;  3HKC B;  5EYP A;  4F6R B;  2QEX F;  3JAR B;  3MDO A;  4RHA A;  5LYJ A;  2EWC A;  2YXZ A;  3LWO C;  1W41 A;  1VQ6 F;  3WXM B;  4YJ2 B;  1XHO A;  5FNV A;  2HQS C;  1YIT F;  3JAW B;  1RLU A;  3RYC B;  2KTU A;  1Z5V A;  3FD5 A;  5FLX M;  3GTZ A;  1W5B A;  5GON B;  2CZW A;  1YJN F;  3M1X A;  4G4W A;  5EB0 A;  1YJW F;  5CB4 B;  4I50 B;  2HRU A;  2WAL A;  2VAW A;  4X1I A;  1QAH A;  3PAF A;  2GVI A;  2DYY A;  5IJ9 B;  3CB2 A;  4O2B B;  3N4Y A;  2HRY A;  3CCR F;  3HTN A;  3CYQ A;  1VQP F;  3VIU A;  4IIJ B;  2KGW A;  1E7K A;  5LYJ B;  4KWE A;  5BMV B;  3CMA F;  1W5F A;  1PXW A;  5EIB C;  4U3J B;  2VGM A;  4B45 A;  1KNK A;  5JVD A;  2FC3 A;  1ZWZ A;  2LCA A;  4BT7 A;  3KHN A;  2AMT A;  3LWV C;  2VXY A;  5JH7 B;  3NMU C;  3HKB B;  3P4E A;  3JAM M;  3CC4 F;  3SIU A;  1GO1 A;  3G6E F;  5HXU A;  4O4J B;  3LWP C;  1M90 H;  3M84 A;  3CCM F;  3GYQ A;  3KJJ A;  5C8Y B;  2Z01 A;  1S72 F;  2GZL A;  3C9S A;  1W2B F;  4IIJ A;  5J2T A;  5LP6 B;  1T0A A;  3HKE B;  1RQ7 A;  1VQL F;  3MCA B;  2IG8 A;  5HY1 A;  3S0Y A;  3V7E A;  3E20 B;  1XBI A;  3V7Q A;  1RLG A;  2VAM A;  3TD3 A;  4O2A B;  2PHN A;  3VO8 A;  1TUB A;  2QA4 F;  1KNJ A;  1W5A A;  2L26 A;  3JAS A;  2Z1F A;  5EZY A;  5AVM A;  2F9Z C;  1JY8 A;  3VYS C;  3IMP A;  1K8A H;  1H48 A;  2IAF A;  2LBX A;  1VHA A;  3ZOP A;  4ZHW A;  5LA6 A;  3N2G B;  2VGN A;  3G4S F;  2H6L A;  4TUY A;  4ZI7 A;  5LOV B;  5JQG B;  2JNB A;  2CVL A;  2LBT A;  3F0G A;  4G4Z A;  1VQM F;  1JN1 A;  3CPW F;  4WBN B;  1TUB B;  2HS0 A;  2VAP A;  4O4L B;  3JAS B;  5EZY B;  2P6Y A;  3OBY A;  5KMG A;  1YI2 F;  3IKF A;  1U3L A;  2HP3 A;  2R75 1;  3I3F A;  4ZOL B;  4BT5 A;  3NVI B;  5LA6 B;  4BT2 A;  3J7A R;  3KJK A;  3CD6 F;  3F0D A;  2KG4 A;  1QVF F;  2QTP A;  3D01 A;  2CW4 A;  4DRX B;  3OON A;  4X20 A;  4TUY B;  1W59 A;  4XCQ A;  2RHJ A;  4I55 A;  4X3M A;  5CB4 A;  3NVK E;  3S02 A;  3CPQ A;  5GAN K;  4X1I B;  3CC7 F;  3E22 A;  1GX1 A;  4O2B A;  2OZB A;  1QU9 A;  5EYP B;  3VYT C;  4F6R A;  3HAX D;  5HWE A;  4EI7 A;  2RHL A;  4TV9 B;  1VQ7 F;  4YJ2 A;  3JAL B;  4ZOL A;  1OFU A;  1SZQ A;  2UYK A;  4ZHQ B;  5EO3 A;  4C8G A;  5JH7 A;  1YGY A;  3JAW A;  2HVY D;  2BTU A;  4HNA A;  1IPA A;  3OW2 F;  3J81 M;  5GON A;  3RA5 A;  4G4X A;  3ESJ A;  3N4Z A;  4X1Y B;  3RYH B;  1Z5W A;  4IHJ B;  2FGY A;  1YJ9 F;  5IJ9 A;  1YHQ F;  3C9R A;  4BVS A;  5JCO A;  2RB9 A;  4C8I A;  3SIV A;  4B46 A;  5J2T B;  4G4Y A;  5LP6 A;  3QUW A;  1T0K B;  1RA4 A;  1IV3 A;  1VQ8 F;  5LXT B;  3FBA A;  1XRG A;  4BW0 B;  3IR9 A;  3HKB A;  5KX5 B;  4EB6 B;  5FNV B;  5IYZ A;  4EI8 A;  4BVQ A;  4O4H A;  1SDS A;  4ZK7 A;  3CCQ F;  4O4J A;  3CME F;  4TZZ A;  4X1Y A;  1K9M H;  3T80 A;  1W58 1;  1W5E A;  4IHJ A;  1W55 A;  4LNU A;  4B62 A;  2Z1E A;  3WGL A;  1N8R H;  1NQ3 A;  3MBM A;  4R40 B;  1W40 A;  4U39 A;  2R6R 1;  4M8I A;  3VOA A;  4G4V A;  1K73 H;  1VQ4 F;  2MQE A;  5HY4 A;  2YYE A;  3S03 A;  1Q8R A;  4ZI7 B;  2ZF8 A;  5CA0 B;  2OHW A;  1X52 A;  3U0O A;  1YQN A;  3N2K B;  3JCM M;  3P0Z A;  1U40 A;  5J2U B;  3RYI A;  3LME A;  4X1K B;  3HJW C;  5IJ0 B;  4ERH A;  1J7H A;  1U43 A;  2HS4 A;  4LNU B;  3ZP7 A;  2AIZ P;  3M4S A;  3V4D A;  1KQS F;  3KE1 A;  3B6N A;  1H7M A;  4X20 B;  2ZVZ A;  1UFY A;  1TVK A;  3CCV F;  4O4I A;  1VQ9 F;  1JJ2 F;  1JFF A;  4FFB A;  3JAT B;  4BVT A;  3HKE A;  2ZVY A;  3R0P A;  5MN5 A;  1Q86 H;  1FNJ A;  3E22 B;  4YJ3 B;  3LYB A;  3FD6 A;  4X3L A;  3HWU A;  3CG6 A;  5ITZ B;  3WGM A;  3JVH A;  4G88 A;  3CYP B;  5HXZ A;  4NQ3 A;  4EI9 A;  5CA1 A;  1VK3 A;  3LDT A;  3GHZ A;  1CLI A;  2KTV A;  2W8B C;  4E6E A;  3Q8H A;  4HNA B;  3CC2 F;  3I55 F;  1ONI A;  3NK7 A;  3N2G A;  4O4I B;  1NJI H;  3JAK A;  1JD1 A;  3C9U A;  5EB1 B;  2UYN A;  5LOV A;  3S0W A;  1QVG F;  1VQV A;  2OTL F;  3RA6 A;  1FSZ A;  3O85 A;  3D54 A;  3K2X A;  1Q7Y H;  3TD4 A;  2K1S A;  5ITZ A;  4C81 A;  5EIB D;  3LWQ C;  4ZHV A;  1GZ0 A;  4BT4 A;  1KC8 H;  1CN7 A;  2I6R A;  3WPW A;  5IYZ B;  5B8F A;  4O4H B;  3WJP A;  3EOR A;  1KD1 H;  5G4V C;  2I6D A;  3RE3 A;  4I50 A;  2CHT A;  3VYU C;  3RYH A;  4DRX A;  1NMU B;  2HX0 A;  2UYP A;  3DC2 A;  3VMF B;  1Q81 H;  4I55 B;  1IV4 A;  1W57 A;  1COM A;  1VQO F;  4B5C A;  4TV8 A;  3BYQ A;  4BY9 D;  2HS3 A;  5HY0 A;  5GIP C;  4LCK A;  1IV1 A;  3IKE A;  3P10 A;  1QD9 A;  3L7Q A;  5BMV A;  3RYF A;  2N48 A;  4RQO A;  2AIF A;  2BTQ B;  4BT6 A;  3QHD A;  5KX5 A;  4EB6 A;  3CCJ F;  4PWT A;  3N2K A;  1GO0 A;  1X7O A;  3FFM A;  3WGK A;  5IT9 M;  3RYC A;  3LFO A;  3ZO8 A;  2BTO A;  3C8L A;  4X1K A;  2Z1T A;  4I4T A;  3LWR C;  2CWJ A;  4DXD A;  3G71 F;  3MQW A;  2NMU A;  1W42 A;  2ZOV A;  4TV8 B;  1VH8 A;  4ZHY B;  1VQN F;  3HKD A;  1X7P A;  2Q1Y A;  2ZAU A;  1SA0 B;  3JAR A;  3JAT A;  5CA0 A;  1FFX A;  3QTY A;  5LP6 C;  3VTI C;  3I56 F;  5LXT A;  2UYJ A;  3RYI B;  5J2U A;  2CHS A;  3VI6 A;  3CXC F;  4I4T B;  5IJ0 A;  3WPX A;  2QI2 A;  1VQ5 F;  1RQ2 A;  3VOB A;  1FNK A;  5C8Y A;  2HP0 B;  3HKD B;  3VCZ A;  3CCE F;  2ZOD A;  5GIN C;  1ODE A;  5HP8 A;  3KIZ A;  1SA0 A;  3K12 A;  3MCQ A;  4BVR A;  3JAK B;  2OTJ F;  3TD5 A;  1FFX B;  5GAP K;  3NK6 A;  4U3J A;  2LBW A;  3F6M A;  5JVD B;  4YJ3 A;  3S0H A;  5A2Q M;  3ZP4 A;  2GLZ A;  1IV2 A;  3I7T A;  3ELC A;  5JCO C;  3F0E A;  4O4L A;  2OTM A;  3AGK A;  2H8C A;  4O2A A;  2PMP A;  5EWR A;  5CA1 B;  5MN6 A;  2RHH A;  3CCS F;  3ERN A;  1UI9 A;  3WGJ A;  3UT5 A;  3V3T A;  5HY2 A;  1M1K H;  3S06 A;  3C9T A;  1H47 A;  3D00 A; 
#chains in the Genus database with same CATH homology
 2MQE A;  2N48 A;  2W8B C;  3S03 A;  3WPW A;  2HQS C;  2ZVZ A;  2ZF8 A;  4PWT A;  3TD5 A;  2LCA A;  3KHN A;  1R1M A;  3S0Y A;  2ZVY A;  3OON A;  3S0H A;  1OAP A;  4G4X A;  3S02 A;  5EB1 B;  2LBT A;  4G4W A;  5EB0 A;  4G4Z A;  3S0W A;  3TD3 A;  4G4V A;  4B5C A;  3WPX A;  2L26 A;  4ERH A;  4B62 A;  2ZOV A;  4G88 A;  3CYP B;  5EAZ A;  3TD4 A;  2K1S A;  3IMP A;  4ZHY B;  4R40 B;  3CYQ A;  2AIZ P;  4G4Y A;  4RHA A;  4ZHV A;  4ZHW A;  3S06 A;  3LDT A;  2KGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...