3S03A

The crystal structure of the periplasmic domain of helicobacter pylori motb (residues 97-256, p43).
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
SVLEQIDQGSILKLPSNLLFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the MotB linker in the assembly and activation of the bacterial flagellar motor.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Motor protein
molecule keywords Motility protein B
total genus 41
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3s03A00
4ZHVA 2N48A 4ERHA 2K1SA 2KGWA 3LDTA 5EB1B 3S02A 3S03A 3TD5A 3CYQA 5EAZA 3S0WA 3TD4A 3WPWA 4B62A 2L26A 3IMPA 2W8BC 1R1MA 4R40B 3KHNA 4G4WA 4B5CA 3TD3A 1OAPA 3S0YA 4PWTA 4G4YA 3S0HA 5EB0A 4ZHYB 2ZVYA 2MQEA 2ZF8A 2AIZP 4G4ZA 3OONA 2LCAA 2ZOVA 2ZVZA 3WPXA 4G4XA 4G88A 3S06A 3CYPB 2LBTA 4G4VA 4ZHWA 2HQSC 4RHAA
chains in the Genus database with same CATH superfamily
1W2BF 4LCKA 3N4YA 4LNUA 1JY8A 1CN7A 5KX5B 4WBNA 3HKEB 3TD5A 3HTNA 5HP7A 1FFXB 2OTMA 4O4HB 4YJ2A 1Q86H 3ZP4A 4O4LB 4ZI7B 1KD1H 2I6DA 2QA4F 1T0KB 5FLXM 3CCSF 4I50B 2CVLA 3VO8A 4U39A 5AVMA 2Z1UA 1RQ2A 1IPAA 1J7HA 4YJ3B 3VI6A 2H8EA 3J7AR 3NVKE 5HY4A 1JFFB 3I3FA 2KG4A 3F0EA 3P4EA 2H8CA 2HRUA 5LP6C 3D00A 1FNJA 3CMEF 3B6NA 3ESJA 3KHNA 3G4SF 3E20B 5GIOC 3CB2A 3CC4F 3PLAC 5EB0A 2UYKA 2GZLA 2EWCA 3P0ZA 2GVIA 3JALA 4O4JB 3OONA 2LCAA 3O85A 3RYCA 1X52A 1YHQF 3C9UA 3DDNA 2BO1A 4I4TB 3LWVC 1U3PA 4EI7A 4C82A 5HP8A 4ZHVA 1E7KA 2N48A 3JVHA 3S02A 1VQOF 1Q7YH 5EAZA 5GONA 4X1KA 1VHAA 1KQSF 4R40B 1VQ5F 5BMVB 1TUBA 4X1IB 1OAPA 4O2AA 5C8YA 2ZVYA 3CCQF 2ZF8A 2CHTA 4X20B 5LYJB 5EIBC 1W59A 3RE3A 2VAWA 4WBNB 3CYPB 3HKEA 3HKBB 2R751 3J80M 1PF5A 3D01A 4TV8A 4O4IA 5EZYB 3VYUC 5JVDA 3S03A 2HS4A 4RQOA 3E1YA 3TD4A 3I56F 1YIJF 2QI2A 3CCEF 5LP6B 4FFBA 3VCZA 3CCUF 4LNUB 3RYIA 1U43A 4ZOLA 1FFXA 4YJ2B 4O4HA 3K14A 3V7EA 3P10A 5J2UB 3I55F 2KTVA 2CZWA 2RHOA 3CMAF 5JH7B 2LBTA 3J81M 3LWPC 4BVQA 1QVGF 3GTZA 1GO1A 3CCJF 4TV9B 4ZHQA 5IJ0A 3E22A 4I55A 2RHLA 3OW2F 3LWQC 4DXDA 1QD9A 4IHJA 1VQ6F 1YJ9F 1Q81H 2OZBA 2QEXF 3TD3A 3ON1A 3FD5A 1JFFA 5LA6B 2HS3A 5LOVB 1IV2A 3JAKA 3CCRF 1CLIA 2CSLA 4C81A 3LMEA 1JD1A 3VOAA 1PXWA 1K8AH 3JAMM 2F9ZC 3K0TA 3WPXA 2AMTA 3JAWA 4G4VA 3WXMB 3C8LA 2Q1YA 2IAFA 3LWRC 5BMVA 1YITF 5HXZA 5HY0A 3CPQA 3CYQA 3R0PA 3IKEA 3IMPA 5C8YB 1VQLF 1X7OA 1TVKB 3JATB 3ZOPA 4B5CA 3S0YA 3S0HA 4BVRA 1NQ3A 2VXYA 2CHSA 3C9RA 1YJNF 3OBWA 1YJWF 4X1KB 3S06A 4C8EA 1YGYA 5JCOC 4ZHWA 3MQWA 1KC8H 3N2GA 3LDTA 3NK6A 2UYNA 3S0WA 2ZODA 2W8BC 4O2BA 3RA6A 2LBXA 1NJIH 3CC7F 1COMA 3CD6F 3AGKA 2CW4A 2DYYA 1KNJA 5GONB 5GAPK 4BW0B 3NMUC 3F6MA 1SA0B 1Q82H 4O2AB 2HQSC 1IV4A 5FNVA 1ZWZA 3IEWA 2FC3A 2K1SA 4IHJB 5GANK 5EWRA 2HP3A 5LYJA 2UZHA 4NWOB 1VK3A 3M4SA 2BTQB 5HY2A 4C8GA 2CWJA 2WALA 3VTIC 5B8FA 2FGYA 3QTYA 2Z01A 3VOBA 4KWEA 3E22B 4I55B 3SIUA 1X25A 1N8RH 1XHOA 3MDOA 4X3LA 3LFOA 1SZQA 3ERNA 1RA4A 3GHZA 3HKCB 1S72F 1U40A 5LA6A 5CB4B 4BVSA 4ERHA 3HJWC 4BT5A 4ZOLB 3HKBA 1QVFF 5IJ9A 1KNKA 1XRGA 4EB6B 1R1MA 1U3LA 4NUTA 1IV1A 1JN1A 1VH8A 5J2TB 3T80A 3V4DA 5EO3A 4U3JB 1VQ4F 3ZP7A 3KJJA 3D54A 4G4ZA 1W5EA 3N2GB 1TVKA 3K12A 2VGMA 1VQNF 2BTOA 1W581 4BT4A 4TUYB 4HNAA 5CA1B 3JARB 3CCMF 1VQ7F 5LOVA 3JAKB 2GLZA 3RYHA 3M84A 5EYPA 1Q8RA 2Z1FA 3KJKA 4X1YB 5IYZB 3N2KB 3NVIB 3HKDA 3G71F 1X7PA 2ZAUA 4ZHQB 5IJ0B 5ITZB 2VAPA 4BT3A 3G6EF 1SA0A 1W5BA 1FNKA 2HP0B 5G4VC 4BY9D 3WGJA 5LXTA 3QUWA 2Q1XA 3VIUA 3CPWF 3FFMA 4O2BB 1UI9A 2HS0A 3CXCF 3KIZA 1Z5WA 2KGWA 3JAWB 3MBMA 1W41A 4B62A 1XV2A 2VAMA 1W3EX 1DBFA 4X3MA 3LYBA 2P6YA 5JCOA 4ZK7A 4F6RA 3CCVF 4B45A 1H48A 3V7QA 3ELCA 1RLGA 5FNVB 1Z5VA 2RHJA 4DRXB 4ZHYB 3M1XA 2MQEA 3JASB 2I6RA 2PHNA 5HWEA 3JATA 3DC2A 2UYNB 1VQVA 1GZ0A 3MCQA 3WJQA 2B33A 1OFUA 3LWOC 3QHDA 4B46A 1UFYA 1ONIA 4IIJA 2BTUA 2ALEA 3CG6A 2G9IA 1QAHA 1W55A 3FBAA 4YJ3A 4G4WA 4PWTA 4BVTA 4XCQA 5EIBD 2OHWA 3RYFB 1W5FA 5G4UC 2Z1TA 3KE1A 3Q8HA 2RHHA 2OTLF 1SDSA 3RYHB 5JQGA 4BT2A 4G4XA 3HAXD 5MN6A 5J2TA 4I50A 2AIFA 1GO0A 1W5AA 2LBWA 2Z1EA 4EI8A 2JNBA 2L26A 1T0AA 3OBYA 1GX1A 1NMUB 1XBIA 3JALB 1RQ7A 3F0FA 4TUYA 3JARA 5CA1A 4C4WC 5CB4A 3C9TA 4BT7A 5KMGA 4I4TA 3FD6A 2IG8A 4C8IA 4TZZA 5IJ9B 5IT9M 4EB6A 2KTUA 4G88A 3UT5B 3WGKA 4EI9A 1JJ2F 3CCLF 3VYSC 4RHAA 5A2QM 5FJ4C 5CA0A 4F6RB 3HKCA 1RLUA 3WGNA 5GIPC 2HP0A 3WPWA 1QU9A 3WGMA 5MN5A 3RYCB 1VQMF 1H7MA 3F0DA 5KX5A 3VMFB 4NQ3A 4G4YA 4HNAB 3WGLA 2HVYD 4O4LA 4ZI7A 1W42A 3N4ZA 5GINC 2AIZP 2YYEA 2UYJA 2VGNA 4X1YA 5IYZA 3N2KA 3SIVA 3IKFA 4O4IB 4U3JA 5EZYA 5JVDB 5HY1A 3WJRA 2HRYA 1K9MH 5ITZA 3IR9A 5LP6A 1H47A 5EB1B 4FFBB 3IEQA 3MCAB 4O4JA 5HXUA 5LXTB 3BYQA 2R6R1 1VQKF 1YQNA 5EYPB 2YXZA 3ZO8A 4BT6A 1CK2A 4M8IA 3JCMM 4TV8B 3RA5A 5JQGB 1YI2F 3HKDB 5JH7A 3WJPA 2RB9A 3U0OA 2NMUA 2ZVZA 1VQ8F 1VQ9F 4TV9A 3PAFA 1M90H 3CC2F 1TUBB 3I7TA 3RYIB 1W40A 3F0GA 4DRXA 2PMPA 3HWUA 4X20A 5J2UA 3VYTC 2QTPA 5KMGB 2UYPA 5MN4A 5DCVA 1VQPF 2DT4A 1ODEA 3V3TA 2HX0A 1FSZA 3K2XA 3UT5A 3GYQA 1W57A 1K73H 1DT9A 2IQQA 3FPIA 4X1IA 4IIJB 2H6LA 2ZOVA 2OTJF 5CA0B 3EORA 3L7QA 3JASA 2V9YA 1M1KH 1IV3A 3NK7A 3C9SA 4E6EA 3RYFA
chains in the Genus database with same CATH topology
4ZHVA 2N48A 4ERHA 2K1SA 2KGWA 3LDTA 5EB1B 3S02A 3S03A 3TD5A 3CYQA 5EAZA 3S0WA 3TD4A 3WPWA 4B62A 2L26A 3IMPA 2W8BC 1R1MA 4R40B 3KHNA 4G4WA 4B5CA 3TD3A 1OAPA 3S0YA 4PWTA 4G4YA 3S0HA 5EB0A 4ZHYB 2ZVYA 2MQEA 2ZF8A 2AIZP 4G4ZA 3OONA 2LCAA 2ZOVA 2ZVZA 3WPXA 4G4XA 4G88A 3S06A 3CYPB 2LBTA 4G4VA 4ZHWA 2HQSC 4RHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHV A;  2N48 A;  4ERH A;  2K1S A;  2KGW A;  3LDT A;  5EB1 B;  3S02 A;  3S03 A;  3TD5 A;  3CYQ A;  5EAZ A;  3S0W A;  3TD4 A;  3WPW A;  4B62 A;  2L26 A;  3IMP A;  2W8B C;  1R1M A;  4R40 B;  3KHN A;  4G4W A;  4B5C A;  3TD3 A;  1OAP A;  3S0Y A;  4PWT A;  4G4Y A;  3S0H A;  5EB0 A;  4ZHY B;  2ZVY A;  2MQE A;  2ZF8 A;  2AIZ P;  4G4Z A;  3OON A;  2LCA A;  2ZOV A;  2ZVZ A;  3WPX A;  4G4X A;  4G88 A;  3S06 A;  3CYP B;  2LBT A;  4G4V A;  4ZHW A;  2HQS C;  4RHA A; 
#chains in the Genus database with same CATH topology
 1W2B F;  4LCK A;  3N4Y A;  4LNU A;  1JY8 A;  1CN7 A;  5KX5 B;  4WBN A;  3HKE B;  3TD5 A;  3HTN A;  5HP7 A;  1FFX B;  2OTM A;  4O4H B;  4YJ2 A;  1Q86 H;  3ZP4 A;  4O4L B;  4ZI7 B;  1KD1 H;  2I6D A;  2QA4 F;  1T0K B;  5FLX M;  3CCS F;  4I50 B;  2CVL A;  3VO8 A;  4U39 A;  5AVM A;  2Z1U A;  1RQ2 A;  1IPA A;  1J7H A;  4YJ3 B;  3VI6 A;  2H8E A;  3J7A R;  3NVK E;  5HY4 A;  1JFF B;  3I3F A;  2KG4 A;  3F0E A;  3P4E A;  2H8C A;  2HRU A;  5LP6 C;  3D00 A;  1FNJ A;  3CME F;  3B6N A;  3ESJ A;  3KHN A;  3G4S F;  3E20 B;  5GIO C;  3CB2 A;  3CC4 F;  3PLA C;  5EB0 A;  2UYK A;  2GZL A;  2EWC A;  3P0Z A;  2GVI A;  3JAL A;  4O4J B;  3OON A;  2LCA A;  3O85 A;  3RYC A;  1X52 A;  1YHQ F;  3C9U A;  3DDN A;  2BO1 A;  4I4T B;  3LWV C;  1U3P A;  4EI7 A;  4C82 A;  5HP8 A;  4ZHV A;  1E7K A;  2N48 A;  3JVH A;  3S02 A;  1VQO F;  1Q7Y H;  5EAZ A;  5GON A;  4X1K A;  1VHA A;  1KQS F;  4R40 B;  1VQ5 F;  5BMV B;  1TUB A;  4X1I B;  1OAP A;  4O2A A;  5C8Y A;  2ZVY A;  3CCQ F;  2ZF8 A;  2CHT A;  4X20 B;  5LYJ B;  5EIB C;  1W59 A;  3RE3 A;  2VAW A;  4WBN B;  3CYP B;  3HKE A;  3HKB B;  2R75 1;  3J80 M;  1PF5 A;  3D01 A;  4TV8 A;  4O4I A;  5EZY B;  3VYU C;  5JVD A;  3S03 A;  2HS4 A;  4RQO A;  3E1Y A;  3TD4 A;  3I56 F;  1YIJ F;  2QI2 A;  3CCE F;  5LP6 B;  4FFB A;  3VCZ A;  3CCU F;  4LNU B;  3RYI A;  1U43 A;  4ZOL A;  1FFX A;  4YJ2 B;  4O4H A;  3K14 A;  3V7E A;  3P10 A;  5J2U B;  3I55 F;  2KTV A;  2CZW A;  2RHO A;  3CMA F;  5JH7 B;  2LBT A;  3J81 M;  3LWP C;  4BVQ A;  1QVG F;  3GTZ A;  1GO1 A;  3CCJ F;  4TV9 B;  4ZHQ A;  5IJ0 A;  3E22 A;  4I55 A;  2RHL A;  3OW2 F;  3LWQ C;  4DXD A;  1QD9 A;  4IHJ A;  1VQ6 F;  1YJ9 F;  1Q81 H;  2OZB A;  2QEX F;  3TD3 A;  3ON1 A;  3FD5 A;  1JFF A;  5LA6 B;  2HS3 A;  5LOV B;  1IV2 A;  3JAK A;  3CCR F;  1CLI A;  2CSL A;  4C81 A;  3LME A;  1JD1 A;  3VOA A;  1PXW A;  1K8A H;  3JAM M;  2F9Z C;  3K0T A;  3WPX A;  2AMT A;  3JAW A;  4G4V A;  3WXM B;  3C8L A;  2Q1Y A;  2IAF A;  3LWR C;  5BMV A;  1YIT F;  5HXZ A;  5HY0 A;  3CPQ A;  3CYQ A;  3R0P A;  3IKE A;  3IMP A;  5C8Y B;  1VQL F;  1X7O A;  1TVK B;  3JAT B;  3ZOP A;  4B5C A;  3S0Y A;  3S0H A;  4BVR A;  1NQ3 A;  2VXY A;  2CHS A;  3C9R A;  1YJN F;  3OBW A;  1YJW F;  4X1K B;  3S06 A;  4C8E A;  1YGY A;  5JCO C;  4ZHW A;  3MQW A;  1KC8 H;  3N2G A;  3LDT A;  3NK6 A;  2UYN A;  3S0W A;  2ZOD A;  2W8B C;  4O2B A;  3RA6 A;  2LBX A;  1NJI H;  3CC7 F;  1COM A;  3CD6 F;  3AGK A;  2CW4 A;  2DYY A;  1KNJ A;  5GON B;  5GAP K;  4BW0 B;  3NMU C;  3F6M A;  1SA0 B;  1Q82 H;  4O2A B;  2HQS C;  1IV4 A;  5FNV A;  1ZWZ A;  3IEW A;  2FC3 A;  2K1S A;  4IHJ B;  5GAN K;  5EWR A;  2HP3 A;  5LYJ A;  2UZH A;  4NWO B;  1VK3 A;  3M4S A;  2BTQ B;  5HY2 A;  4C8G A;  2CWJ A;  2WAL A;  3VTI C;  5B8F A;  2FGY A;  3QTY A;  2Z01 A;  3VOB A;  4KWE A;  3E22 B;  4I55 B;  3SIU A;  1X25 A;  1N8R H;  1XHO A;  3MDO A;  4X3L A;  3LFO A;  1SZQ A;  3ERN A;  1RA4 A;  3GHZ A;  3HKC B;  1S72 F;  1U40 A;  5LA6 A;  5CB4 B;  4BVS A;  4ERH A;  3HJW C;  4BT5 A;  4ZOL B;  3HKB A;  1QVF F;  5IJ9 A;  1KNK A;  1XRG A;  4EB6 B;  1R1M A;  1U3L A;  4NUT A;  1IV1 A;  1JN1 A;  1VH8 A;  5J2T B;  3T80 A;  3V4D A;  5EO3 A;  4U3J B;  1VQ4 F;  3ZP7 A;  3KJJ A;  3D54 A;  4G4Z A;  1W5E A;  3N2G B;  1TVK A;  3K12 A;  2VGM A;  1VQN F;  2BTO A;  1W58 1;  4BT4 A;  4TUY B;  4HNA A;  5CA1 B;  3JAR B;  3CCM F;  1VQ7 F;  5LOV A;  3JAK B;  2GLZ A;  3RYH A;  3M84 A;  5EYP A;  1Q8R A;  2Z1F A;  3KJK A;  4X1Y B;  5IYZ B;  3N2K B;  3NVI B;  3HKD A;  3G71 F;  1X7P A;  2ZAU A;  4ZHQ B;  5IJ0 B;  5ITZ B;  2VAP A;  4BT3 A;  3G6E F;  1SA0 A;  1W5B A;  1FNK A;  2HP0 B;  5G4V C;  4BY9 D;  3WGJ A;  5LXT A;  3QUW A;  2Q1X A;  3VIU A;  3CPW F;  3FFM A;  4O2B B;  1UI9 A;  2HS0 A;  3CXC F;  3KIZ A;  1Z5W A;  2KGW A;  3JAW B;  3MBM A;  1W41 A;  4B62 A;  1XV2 A;  2VAM A;  1W3E X;  1DBF A;  4X3M A;  3LYB A;  2P6Y A;  5JCO A;  4ZK7 A;  4F6R A;  3CCV F;  4B45 A;  1H48 A;  3V7Q A;  3ELC A;  1RLG A;  5FNV B;  1Z5V A;  2RHJ A;  4DRX B;  4ZHY B;  3M1X A;  2MQE A;  3JAS B;  2I6R A;  2PHN A;  5HWE A;  3JAT A;  3DC2 A;  2UYN B;  1VQV A;  1GZ0 A;  3MCQ A;  3WJQ A;  2B33 A;  1OFU A;  3LWO C;  3QHD A;  4B46 A;  1UFY A;  1ONI A;  4IIJ A;  2BTU A;  2ALE A;  3CG6 A;  2G9I A;  1QAH A;  1W55 A;  3FBA A;  4YJ3 A;  4G4W A;  4PWT A;  4BVT A;  4XCQ A;  5EIB D;  2OHW A;  3RYF B;  1W5F A;  5G4U C;  2Z1T A;  3KE1 A;  3Q8H A;  2RHH A;  2OTL F;  1SDS A;  3RYH B;  5JQG A;  4BT2 A;  4G4X A;  3HAX D;  5MN6 A;  5J2T A;  4I50 A;  2AIF A;  1GO0 A;  1W5A A;  2LBW A;  2Z1E A;  4EI8 A;  2JNB A;  2L26 A;  1T0A A;  3OBY A;  1GX1 A;  1NMU B;  1XBI A;  3JAL B;  1RQ7 A;  3F0F A;  4TUY A;  3JAR A;  5CA1 A;  4C4W C;  5CB4 A;  3C9T A;  4BT7 A;  5KMG A;  4I4T A;  3FD6 A;  2IG8 A;  4C8I A;  4TZZ A;  5IJ9 B;  5IT9 M;  4EB6 A;  2KTU A;  4G88 A;  3UT5 B;  3WGK A;  4EI9 A;  1JJ2 F;  3CCL F;  3VYS C;  4RHA A;  5A2Q M;  5FJ4 C;  5CA0 A;  4F6R B;  3HKC A;  1RLU A;  3WGN A;  5GIP C;  2HP0 A;  3WPW A;  1QU9 A;  3WGM A;  5MN5 A;  3RYC B;  1VQM F;  1H7M A;  3F0D A;  5KX5 A;  3VMF B;  4NQ3 A;  4G4Y A;  4HNA B;  3WGL A;  2HVY D;  4O4L A;  4ZI7 A;  1W42 A;  3N4Z A;  5GIN C;  2AIZ P;  2YYE A;  2UYJ A;  2VGN A;  4X1Y A;  5IYZ A;  3N2K A;  3SIV A;  3IKF A;  4O4I B;  4U3J A;  5EZY A;  5JVD B;  5HY1 A;  3WJR A;  2HRY A;  1K9M H;  5ITZ A;  3IR9 A;  5LP6 A;  1H47 A;  5EB1 B;  4FFB B;  3IEQ A;  3MCA B;  4O4J A;  5HXU A;  5LXT B;  3BYQ A;  2R6R 1;  1VQK F;  1YQN A;  5EYP B;  2YXZ A;  3ZO8 A;  4BT6 A;  1CK2 A;  4M8I A;  3JCM M;  4TV8 B;  3RA5 A;  5JQG B;  1YI2 F;  3HKD B;  5JH7 A;  3WJP A;  2RB9 A;  3U0O A;  2NMU A;  2ZVZ A;  1VQ8 F;  1VQ9 F;  4TV9 A;  3PAF A;  1M90 H;  3CC2 F;  1TUB B;  3I7T A;  3RYI B;  1W40 A;  3F0G A;  4DRX A;  2PMP A;  3HWU A;  4X20 A;  5J2U A;  3VYT C;  2QTP A;  5KMG B;  2UYP A;  5MN4 A;  5DCV A;  1VQP F;  2DT4 A;  1ODE A;  3V3T A;  2HX0 A;  1FSZ A;  3K2X A;  3UT5 A;  3GYQ A;  1W57 A;  1K73 H;  1DT9 A;  2IQQ A;  3FPI A;  4X1I A;  4IIJ B;  2H6L A;  2ZOV A;  2OTJ F;  5CA0 B;  3EOR A;  3L7Q A;  3JAS A;  2V9Y A;  1M1K H;  1IV3 A;  3NK7 A;  3C9S A;  4E6E A;  3RYF A; 
#chains in the Genus database with same CATH homology
 4ZHV A;  2N48 A;  4ERH A;  2K1S A;  2KGW A;  3LDT A;  5EB1 B;  3S02 A;  3S03 A;  3TD5 A;  3CYQ A;  5EAZ A;  3S0W A;  3TD4 A;  3WPW A;  4B62 A;  2L26 A;  3IMP A;  2W8B C;  1R1M A;  4R40 B;  3KHN A;  4G4W A;  4B5C A;  3TD3 A;  1OAP A;  3S0Y A;  4PWT A;  4G4Y A;  3S0H A;  5EB0 A;  4ZHY B;  2ZVY A;  2MQE A;  2ZF8 A;  2AIZ P;  4G4Z A;  3OON A;  2LCA A;  2ZOV A;  2ZVZ A;  3WPX A;  4G4X A;  4G88 A;  3S06 A;  3CYP B;  2LBT A;  4G4V A;  4ZHW A;  2HQS C;  4RHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...