3JATB

Cryo-em structure of gmpcpp-microtubule (14 protofilaments) decorated with kinesin
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 153
structure length 426
sequence length 426
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jatB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jatB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jatB01
3JATA 2BTQB 4O2BB 5MN4A 4TV8B 3JALB 5LXTB 1W5AA 4TUYA 4EB6A 3JARB 5IJ0A 4F6RA 5BMVB 2R6R1 4TV9A 1W59A 1W581 5CA1A 1TUBA 3RYCB 4FFBA 5JVDB 3VOBA 5GONB 2XKBA 4DXDA 3JALA 2BTQA 4TV8A 5LXTA 2Q1XA 4YJ3B 2RHLA 3RYHA 5MN6A 2VXYA 4ZI7B 2VAPA 5LP6B 1RQ7A 3JAWA 4ZHQA 3VO9A 5EYPB 5IJ9B 2VAMA 3V3TA 4WBNA 4I55B 5CA1B 3WGLA 4O4JB 5J2UA 5JCOC 4O4IA 4U39A 4IIJA 4O4JA 5LYJB 2GVIA 4EB6B 4HNAB 1Z5WA 4O4HB 4O4HA 4M8IA 5LYJA 4B45A 5LA6A 5ITZA 3N2KB 3HKDA 3RYIB 3CB2A 4I50B 4EI8A 3E22B 3E22A 4WBNB 3VO8A 1TVKB 4U3JA 5KMGA 4EI9A 5JH7B 2BTOA 4X1IB 5GONA 4O2AB 4I4TB 3M89A 4HNAA 1FFXA 3HKCB 5J2TB 1SA0A 4ZOLA 3ZBPA 3RYIA 5EIBC 5LOVA 5BMVA 4YJ2A 4O4LA 3R4VA 5JVDA 3JASB 4X1YA 1TUBB 5EIBD 3VOAA 3N2GA 5EZYA 4O4IB 1RLUA 3RYFB 5JQGA 3WGNA 4F6RB 5CA0B 1SA0B 3M8KA 3HKCA 5EYPA 4O2AA 4X1KB 4LNUB 5LP6A 4ZI7A 4X1KA 5KX5A 4FFBB 4X20B 3RYCA 2RHHA 4XCQA 5EZYB 3N2GB 3JASA 4X1YB 3WGMA 5LA6B 2RHJA 1Z5VA 1JFFB 5IJ0B 3JAKA 5C8YA 3UT5B 1FSZA 4YJ2B 5J2TA 5LOVB 2VAWA 4ZOLB 5KX5B 3HKEA 4DRXB 5CB4B 4I55A 2RHOA 3C8LA 5FNVB 5IYZA 4TUYB 4X1IA 3ZIDA 5JH7A 4O2BA 5KMGB 4E6EA 4B46A 5CA0A 3RYHB 3RYFA 4YJ3A 5JQGB 2R751 1W5FA 4KWEA 4IHJA 2XKAA 3HKDB 3RB8A 5ITZB 3ZBQA 4I50A 1RQ2A 3UT5A 5C8YB 3WGKA 5FNVA 3N2KA 4O4LB 5IYZB 5MN5A 5CB4A 4DRXA 3WGJA 1OFUA 3HKBB 5LP6C 3HKBA 4IIJB 1W5EA 3VPAA 1FFXB 3JAKB 5J2UB 4I4TA 4TV9B 1JFFA 5M7EA 1W5BA 3JARA 5IJ9A 4LNUA 5JCOA 4EI7A 3JAWB 1TVKA 4U3JB 4IHJB 4ZHQB 2Q1YA 3HKEB 4X20A 3JATB
chains in the Genus database with same CATH superfamily
1BAPA 3I9JA 1IEQA 4XD7D 5L3GA 2YV4A 5IKXA 5BVHB 1E2BA 4TLCA 3A1TA 2R6JA 2OWOA 1JDSA 2Y1KA 2O5RA 2YS8A 3CRMA 1KMNA 1X52A 4BNGA 4BWGA 4JXZA 2UUPA 2V55B 1U3CA 3H13A 4G0MA 4KDEA 2JGFA 3B1WA 2QIOA 4N54A 4XX1A 5CYOA 2YFYA 3I6MA 4TMFA 5GADl 3NI2A 5ECDA 3WYEA 4B3RO 2WT9A 3OPNA 3IEMA 2I4LA 1HR0O 5LQDA 2ATKC 4FUTA 3CLSC 4WSOA 1HEYA 2FX3A 1GLGA 1U0RA 2I4RA 5E9AA 4DC9A 4K40A 2WWWA 2B33A 2WWHA 3GU3A 4RK4A 5A6VA 1E7RA 4HLNA 1LEHA 3IAXA 4M9QA 1F8UA 4F56A 1XEQA 2MK3A 5F7JA 1XROA 1G4UR 1G21B 1NX6A 3ASVA 1VQVA 2RB4A 4LDNA 4XWAA 1OCZB 1H0RA 3TEJA 1RXVA 1V1RB 5EEGA 3B1ZA 3N1UA 2VTBA 1IN6A 1RRGA 2OYRA 1N33B 4GR4A 3OTOB 1AQIA 3AR2A 2IHKA 1BG6A 3R4CA 2HFJA 4Z1OA 3LSQA 2ZDQA 4XQEA 2W4MA 3WK5A 1NNUA 1K6EA 4U2FA 4B7AA 5TMDA 1IURA 3OQJA 4CKCA 1L7PA 1OI2A 2ZI4A 3OZWA 4DIOA 4FHEA 1UKVY 2H65A 2ZXFA 3CZQA 3T7AA 4D74A 5FOQA 4UPEA 4EPYA 4Z4IA 5BR1A 4HNAA 4TXNA 5J2TB 2ZIGA 1ZCJA 1VDZA 3KJEA 4FFKA 4GNKA 3H9CA 2W4IA 5CJJA 1LV7A 2VEDA 1GAQA 2ODEA 3GK3A 3EC7A 1FW8A 3JAMM 1ZN8A 2ZT5A 4A0GA 2F55A 2GN8A 4J9VA 1XSEA 3E53A 1OWLA 3HVHA 3NHMA 5C3UA 3SFTA 5DKFA 1MG5A 2PV0A 2WKPA 3HR4A 5JC1A 1E58A 2VWJA 1XMOO 3HKCA 4MWOA 2HHHO 1VBKA 2OILA 4MR7B 1GEGA 5H83A 1R74A 1Z16A 2WKSA 3HGMA 4U6QA 5DHTA 4ZZ3A 1QG6A 1QYXA 2Y1WA 4M1SA 4NU6A 1YR9A 5GIOC 3OEHA 3ZOKA 2DF8A 2YJTD 4A7PA 1ESMA 1Y3IA 1L0LH 3VNQA 2C4MA 1ZSYA 3TECE 1F2DA 3E8XA 2W11A 1EWVA 2WJ4A 3DGEC 2WFLA 3NBQA 4QUAA 1RRKA 4OJYA 4RJIA 4ZO4A 4Z54A 1KTIA 1C2YA 2H4ZA 3RC9A 1UBJS 3C85A 2HVJC 3CW8X 1KRWA 4G8BA 4C29A 3DEHA 2RJNA 1ZL0A 5SYAA 3M3DA 2FG6C 3KKQA 4EUEA 1E7SA 1OZFA 4JS0A 1YOBA 2HGSA 3TBKA 1I5YA 1F3OA 1HL3A 1M2KA 2ORYA 4LS3A 2W6OA 2I71A 5E3JA 1RZ3A 2QRNA 1T3ZA 3U3RA 4CEHB 3CZ9A 2I4NA 1AKUA 3O8QA 4YJ3A 3ODPA 4ARZA 1ZP6A 4WFJA 3G2OA 1AI5A 3ZMUA 3NTQA 1AKEA 3T2MA 4IXTA 2JDID 3V1UA 1JKFA 4AC9A 1UWKA 3LT0A 4Y7DA 1SKAA 3IEQA 5I9BA 3SYNA 3ZV7A 1KI6B 1NASA 3TJMA 5M7EA 1JEQA 1XCLA 1QMGA 2MSCB 1HDOA 4WKGA 2WWFA 4OKNA 3BXPA 4NK4A 1RKUA 1M2VA 3A6EA 1JA1A 4I3HA 4DCSA 3AG5A 3ENVA 2K1SA 1K92A 1DNPA 2AA3A 2DY0A 4JVMA 5AKHA 2FLVA 3L75H 3FDJA 3O75A 5D3QA 4X9XA 3ER9A 4IJ6A 4FJCC 3IURA 5TMEA 2LCQA 3I2HA 5EWLB 5EY5B 2KPOA 3CRW1 1XLUA 1LGYA 4BFZA 4LFBO 1D7AA 1VDMA 1LVGA 3FRJA 2BBOA 2PZGA 3DO6A 3GCZA 4CETA 1O97C 5CEFA 3B6IA 4FX2A 1L5YA 1LBTA 1ZQ9A 3TRJA 4X9QA 1XZGA 1P1HA 2DUMA 4GKAA 2ZB7A 4H0CA 4J1TA 4K1XA 4P4GA 3GBVA 1W1WA 2ZDIA 1T8WA 1F7VA 2QV0A 5IN5A 4NTZA 5KNBH 1I4TD 1FDUA 1UH5A 1Z6XA 3QEMA 4K0RA 2XSZD 4B3CA 3HA2A 4RHCA 3FM9A 3V48A 4A10A 3OQIB 2YIAA 4KR3A 1H2BA 1JZSA 4QLOA 4E70A 3DC7A 3GT0A 3NTOA 3SMQA 2YR0A 5FBWB 4V02A 3KQVA 3V7UA 4F91B 2C7GA 4AAYA 4MVWA 2YBDA 4ZYTA 1VJRA 3VPHA 3T0GA 5JATA 3NHAA 1O87A 4P6VF 4PHGA 3MCAB 1YDMA 3K8OE 3ZOPA 4L3WA 4CJXA 2HXGA 2ZI7A 4F85A 4AF6A 3C1UA 3FUTA 1VK3A 4OHCA 3QVUA 2Z5UA 3ZE1B 2PF4E 2QE7G 1OIWA 1MW9X 3UV3A 4XWYA 5CCXA 4ZEXA 3HXTA 3LQFA 4XX0B 4G5SA 5J4LA 4EI9A 2WJ3A 1KS9A 4AJ2A 5BT8A 2HS3A 1WBJB 3KAQA 5KA6A 5FPTA 4HRVA 2MSDB 1GL7A 1PWYE 2VA8A 4G0NA 4D99A 2F8MA 3WYBA 1C2TA 4Z5XA 3DCIA 4HEHA 5GJBA 2VJAA 2IZ6A 1AKTA 3EWSA 2Y0DA 3FHLA 4QDXA 5CJ2A 5AHKA 1P9WA 2GX6A 3TW6A 3E1YA 3W5UA 4KXXA 1A0OA 1JR6A 5LXTF 1MB3A 3IOEA 2K4MA 2R7NA 1IEVA 3EBLA 2H5EA 5KNBD 3CS5A 3I64A 2CYBA 3IUSA 1J9GA 2I65A 4MW0A 2IP1A 1YGPA 1QNMA 4MIYA 1T5EA 5FBQB 5FF9A 4I6GA 4P93A 1ZW1A 3NOVA 1KYIA 2D5CA 5H70A 3O4IA 4CFSA 4AM8A 3H5AA 1SKYE 1YT5A 3ZIAA 3OFJA 3B6EA 3GAZA 4KP7A 4W5HA 3ZHYA 3Q7PA 3LMEA 3U10A 3SSAA 2OQIA 2WAOA 4XRGA 5JQGF 2J9XB 4MT8A 3OLYA 1BH6A 3F6CA 2HP8A 1BXZA 2MR6A 3IUMA 3PHBE 4OQMA 3HSYA 3Q5DA 2I33A 2WR8A 4UUMA 2CC2A 4TMZA 2OD2A 4NE7A 3QEJA 4OHVA 3A32A 3WFZA 1FTWA 1EXNA 1HSZA 2D06A 3IERA 1HQDA 1WS6A 3INGA 4TXHA 3ETCA 3GCXA 1Q7YH 5G0TA 1M6YA 2YIVX 4ZVLA 1SG6A 3QI7A 4II2A 1XQ6A 3RYFA 4G07A 4TT3A 2PVCA 3OQVA 3G67A 1EBUA 2QSJA 3BSWA 3AVUA 4HN2A 1YBMA 1M2OB 4L50A 4ZZIA 4XBFA 1QYIA 2ANCA 2W2LD 4R0NA 4RGVA 1FFTB 2UYOA 4YAFA 4OHWA 1GN8A 4XEHA 4PW0A 1E8NA 3VPAA 4PELA 4RGQA 4E7PA 2UYNA 1GITA 1PLJA 2A78A 5KHIA 1NWHA 3H9UA 3I3FA 1HYGA 3EA0A 1I2MA 4NJEA 3SC4A 1R6DA 2VJBA 4GDFA 6AT1A 3ANLA 1N34O 3QYFA 1UMCA 4C1BA 3SIVA 3AF6A 3T9DA 2HCBA 2QRJA 4GXTA 5FOUA 3SFVA 5AFSA 3NG1A 2K7FA 2L6LA 2LCFA 2QM3A 3NM5A 5KJFA 4L87A 5H6QA 2UVPA 4RZHA 3L0OA 1MX1A 2OP0A 4BO8A 4I5EA 4GEGA 5IJXA 3IPAA 3BULA 1DC7A 3CR3C 5AI0A 3G9XA 3BQNB 4UBOA 1A9ZA 2GZ3A 4V0OA 1GADO 3ETLA 1ZUNB 1NF2A 1GZDA 5HGJA 3G8YA 4H1HA 1Q14A 2ZWOA 1SVKA 3W2GA 3KHNA 2QA5A 1J1IA 3T5CA 4CBVA 4P38A 3IKJA 4LXUA 4RIFA 5EIEA 1MR3F 4GGPA 2QTGA 3MTBA 3QNEA 1XZAA 3A3YA 2W2NA 3KYIB 4N1AA 2VZ0A 5JT1A 3L07A 1HQYE 4UFNA 2LVBA 3N6RA 4UUQA 5LA6F 4EYSA 1ECFA 2OWEA 4LY0A 5GJVC 3KUDA 3MS4A 3V3TA 5EMLA 4O29A 1ZNZA 2ACVA 3L7LA 4KB5A 3ISJA 3Q8KA 2NACA 3SJCA 1DEAA 1K5GA 2WWVD 3SGLA 2H18A 3HBAA 1Q16A 4X24A 3EAQA 2EZ4A 1ODIA 3EQ6A 3HBMA 4ID3A 2FW7A 2CW5A 3IR9A 1EFCA 2JAOA 3HKDA 3PQFA 4RD6A 4WLVA 3ZGVA 1T4CA 3UV7A 2DVMA 3LYHA 3U7FB 2QZZA 1YIDA 4W5NA 4O59O 1XDCA 1Z6YA 2WF5A 3MINA 3NZEA 4EPWA 1SUAA 3T54A 3S2UA 1Z7GA 1JJAA 4FSXA 2DUUA 3BPSA 5F1KA 3M3PA 2OQ2A 1NW8A 1WJGA 4DLUA 5BNZA 3FZNA 1E1YA 5L9AA 2EIJC 1A7KA 5EIBC 3QFFA 2EJCA 4EYEA 1L4MA 2PD4A 5TGZA 1T4BA 4B8ZA 5DHRA 3KBBA 3SQMA 4YV7A 1HE4A 2XGGA 5DBEX 2ONYA 1EVJA 2Q4EA 2BFBB 3HCAA 4I2NA 4ZA2A 3RT1A 1GMGA 2P9CA 3Q3HA 4X3PA 3V5NA 5DM60 4MULA 4Q1AA 3GCDA 4IZHA 4B8YA 1GYRA 1EHYA 4BIOA 1JOYA 4OI0A 4CKBA 4M2LA 1BRTA 1ORTA 3H1TA 3U0ZA 1B2RA 3BD6A 2PBZA 2WJAA 2NUBA 1QGUB 1GK9A 1ECGA 3V8RA 1RWVA 2Y71A 3H4VA 3NHFA 2GCPA 3AG2C 1SQ6A 3VZSA 1I4WA 3GWKC 2EIHA 2BHLA 2AFVA 1N36O 1DUSA 2QLNA 4DMFA 1VQOF 1GA1A 1L0BA 1X1CA 3K03A 2OCAA 3HB4X 4Z86A 1TYBE 5ICSA 4X97A 4TVSA 2IYQA 1ZVKA 3FETA 4HLUA 3C4JA 1GU0A 1W87A 1T9KA 5LNK1 1JJFA 1SB8A 3QF7A 1E3EA 1DFIA 1Z3CA 3COPA 4KR0A 1BDMA 5DDIP 5ERYA 1FK8A 5G4LA 3WFVA 5CA0A 3BORA 2UUAO 3QOXA 1K8ZB 3WLEA 1PZMA 1S3IA 5AJWA 3IQDB 1NZ6A 4GKVA 4C0SA 3ETJA 4OPAA 2BJVA 3NBUA 1C1DB 3OOHA 4MPJA 4RCZA 1YIJF 5HKKD 1QS0B 2ZP1A 1U4OA 1NULA 2GDJA 3LW8A 4P5EA 5EJ8A 1QRUA 3WI7A 4ICGA 2Z5FA 3EARA 4DTCA 2HJWA 3S7TA 4YAKA 1F5NA 1BA2A 3OZXA 5J23A 2BVNA 2CTWA 3WGZA 2QBYB 4I5DA 3GIWA 2Q8QA 1DELA 1HE3A 1JQ5A 3AQ4A 4JPRA 3D5QA 3P5SA 4IJUA 3F0GA 2X4LA 4L5JA 5FLYA 5AXDA 3W2EA 3F47A 2VO1A 3RN4A 1COZA 1IBSA 2F2TA 4JKYA 1PNQA 2B8EA 3C2QA 4UDXX 1C1XB 4X8MA 2H17A 5EKUA 1KH2A 4WBNF 1YDGA 2G63A 2UUCO 3AIMA 3MERA 4LXTA 4JF3A 1WLEA 2V0CA 4LJ6A 3E9RA 3S29A 2FP3A 3TLBA 1IN4A 5AIBA 4PRYA 4CIYA 4FX5A 2N04A 3TOVA 1E5XA 4XSGA 2FSPA 1KE2A 1NQXA 4W8GA 2VK8A 3WAJA 1ZLZA 3L6EA 1OV4A 3CCVF 1P5JA 2V96A 3RYCB 3L7CA 2QRQA 1ZIPA 2JFZA 2XCOA 1J8FA 1JQJC 1C1DA 5GQSA 4NYIQ 1KF0A 5JNSA 1KBOA 1ZD9A 2OTLV 4AQDA 1UT5A 5DLYA 4H3SA 1Q92A 4HRXA 1YCGA 1TZMA 4KBGA 9ABPA 1VQ7V 1U2EA 1UMDB 1C0IA 2VLIA 1CF9A 4FGUA 4IGEA 3IIKA 4XM2A 1V7PC 5F51A 1J8MF 4LBZA 3SG0A 4FK5C 1AVMA 2E76B 4RGBA 3UWMA 4WFFA 1D2DA 1LBQA 1X1TA 4JIMA 1Y5RA 5IRCD 4D25A 2DRIA 3GBPA 3P9ZA 1EGAA 2EERA 2H63A 3VDQA 1VF7A 5CVEA 4E3WA 1VG0B 4M99A 2FSSA 2PCLA 3P0FA 4KFMA 4MQEA 3VHLB 1G19A 2V0NA 3AETA 4HVAA 3I5AA 1YHNA 1FMTA 1SU8A 2A86A 1P0PA 1VSUA 2RGCA 2ST1A 1JR9A 1CUFA 1NAIA 3JAMN 2R47A 1RXIA 3DDSA 3G17A 3G1TA 3F6BX 3I2KA 1L5VA 1T6XA 4LNAA 2WMOB 4M0DA 2QW0X 4QDZA 1GNVA 4MTFA 1P18A 3Q0IA 1XDDA 1XZFA 2R6DA 3DPIA 4R51A 2RH4A 3ZGZA 4BP9A 5JCXA 1A8SA 1E96A 4GR9A 2NUTA 4BU1A 5E7JA 3KCYA 3G4SV 3O1LA 2AEMA 3BX1A 5TDHA 3GW8A 5FQOA 2OHOA 2ECQA 1Y74B 3GF4A 3GJQA 3NC4A 4X93A 1XB2A 4CH3A 3EPLA 1QVGF 2KM1A 3AERA 2G6BA 4PXYA 5HR5A 4K9SA 1J5XA 5JJBA 3IEWA 1IBKB 3RASA 5KWSA 1GN6A 4CF4A 1XTIA 3LFHA 3A10A 3RIHA 3TUIC 5CT5A 1U8TA 1ZOIA 4QLAA 1C3LA 4CV2A 4P83A 3G2QA 3ZHOA 3P9XA 2Y6UA 1F4LA 2YYYA 4FGLA 1KH3A 2OO7A 2QN8A 1Z25A 5JZOA 3CGWA 2OCGA 2QTFA 3KQSA 2LBTA 3DNPA 3BIXA 2W43A 4PCLA 3FMGA 1TAEA 1IIBA 2IAFA 4BZWA 4HVTA 5JECA 4NHOA 3CC4F 2QM0A 4CT4B 4EFNA 1N3IA 1NWCA 1S96A 1UK7A 3VR5D 3CG4A 1RYHA 4LCBA 3E2PA 5THKA 5JS8A 4P7BA 2WD7B 2QVXX 5DTMA 1IZ9A 4AY3A 1U63A 4GH5A 3ZCCA 3IAM6 3LK6A 1WULS 4F2DA 3FLEA 3TQCA 1F6WA 4Z3KA 3DTYA 1H9BA 3TVYA 2PKWA 2H1OA 1GKLA 1ZY2A 3FBAA 2F59A 3M3HA 4RKRA 2X0FA 3TZ6A 1NOJA 3PRKE 1SWWA 4UAGA 1POWA 3MZ0A 1KE1A 2FGYA 1TK9A 4MKIA 2O3SA 1O08A 4L08A 2PHZA 1XZ8A 2EG5A 2GCNA 2R9VA 1KIFA 3X2SA 3EGCA 3G9ZA 3REGA 2QD2A 4G5HA 3ZU6A 3FJYA 5F7XA 1P60A 5I7WA 1Z28A 3ICPA 3BXZA 1MH1A 4NBVA 4FYKA 1Q57A 5D87A 3ZG6A 2Q8NA 3ETEA 1DTSA 2XUFA 5JAOA 3A6JA 5LVAA 2P7IA 2IYWA 2ZRDA 4BW5A 4P80A 1HZZC 4YREA 1B14A 5L3VA 2Y69B 1OXTA 3BJIC 1D7OA 4FMBB 4DQDA 2GTAA 2HRZA 4PC6A 2F6RA 2XT6A 3SX2A 2KTUA 3SXJA 3VVBA 4KUGA 4TGLA 5BV0A 3OE5A 3FYHA 2HDHA 4GQAA 3TLJA 2YJZA 1R16A 2GF9A 4HZGA 3MWKA 4GGOA 3UEOA 1NUUA 1Q5OA 2IJHA 1R7RA 3AG4C 3OEHD 4PLZA 5CBHA 4E5YA 1U7WA 2XB8A 3T4PA 2GO7A 3LM8A 5CT8A 1QNLA 4HGYA 2FEOA 4FOSA 1S4QA 5EXDA 1GM5A 4FOOA 1G20A 3ICEA 1YZUA 3A11A 4IF6A 4RIEA 5KQSA 4YHBA 1DOAA 1KK3A 3C3WA 4C21A 4Q7QA 1N3LA 2EIJB 1OHHA 3HCFA 4KZKA 2EKZA 2WF6A 3PEFA 4JUCA 5SZIA 1Z73A 1GCGA 4EY3A 1ORIA 4ITVA 2H2FA 3H1IH 2BM8A 4ND8A 3B82A 4BN5A 5LP6B 4HNGA 3CC7V 2ZT9B 1EM1A 1EJ0A 2IPAB 2QN2A 4P4TA 3WGGA 1U43A 3H17A 5BN1A 2FMTA 3WK7A 1B8UA 3K9FC 1H3FA 1S3SA 1MA3A 3LT1A 3UVEA 2HDOA 1WQ1R 4BBJA 1DRVA 2UZIR 7GPBA 3PLAE 1ODTC 1C4XA 1P7YA 1X1SA 1NBMA 4CH4A 2Y2UA 4L0QA 4MUHA 5DN9A 4D3XA 1NLMA 3PDCA 4MV4A 5HS6A 4PZYA 2P75A 2FCAA 4DWOA 1UBGA 3BB4A 2W0FC 1WXHA 1SC3A 1IVNA 2PIDA 4L9SA 2ZQMA 2TECE 3TSYA 1QB7A 3VTZA 1DLBA 3DP9A 4CKBB 3E5HA 3MIIA 1PJQA 1Y6ZA 2NNLD 1ICIA 3NGMA 3I3OA 3V46A 3X1JA 3VKVA 4S1VA 3BMQA 4XA8A 2Z2JA 2RGBA 5CTAA 3AHJA 3H9EO 5DWVA 1FUEA 2DH6A 1EUZA 1WUTA 4DIKA 1YVEI 1K8RA 3BSSA 4NXNB 4FSHA 1TF5A 4ADSG 3QEOA 4ITUA 4KV9A 1H85A 1PRYA 3IO5A 3STHA 3U1BA 1NT2B 1AM4D 3H3FA 5A0VA 3ACCA 4FW9A 4OXXA 1EBBA 3F78A 4XUDA 3ZDXB 3AG3B 3K72B 2BOBC 2EWCA 4KBYA 4G6ZA 6REQA 4R05A 2FPRA 2VP9A 1RXUA 3BHPA 2ZRKA 2O8EA 2XODA 2QG4A 4Z0PA 1UPBA 4RQEA 3HU5A 1OXKB 4YRTA 4IIVA 5AKZA 2EINB 4FDMA 5A1TA 3QE9Y 1BHQ1 3CEJA 3QE4A 5IVKA 5AKKA 2IDZA 2VOEA 4BVJA 2BFCB 4L5BA 2FEMA 4GYKA 1T9BA 1CLUA 1JIVA 1XL6A 3IXLA 3LNNA 3PYMA 3PQ7A 4EUKA 2OR3A 5M3BA 2JIQA 1PAUA 1Q0TA 1LPOA 1YJQA 2ZGVA 1RKBA 3I83A 4CZZA 3IA7A 1PKEA 2EKLA 4J7XA 2V7QG 1TU0A 1VPDA 3DW3X 4JAVC 4YNBA 3VYUB 5F23A 1XCPA 3FX7A 4P08A 3KIPA 4BVGA 1B0AA 5AHOA 4Q6BA 3TAUA 3RK1A 4GX2A 1ODSA 3F6SA 4RZUA 2Q2QA 3PQ5A 1JA9A 3I04M 3QPVA 3PC3A 4G26A 4MCIA 3PD0A 3GYBA 1W0KA 5DMXA 1WY5A 2MINA 1H0SA 3BXFA 4P9PA 3D3IA 4NJOA 4UDYX 4NOLA 4BY9E 1VLVA 1ULUA 2HKOA 3D4NA 3L7MA 5JAPA 4ZAYA 1OZAA 3CCUF 2RONA 3GFRA 2E5LO 5ICFA 1FYXA 1W34A 2W2MA 3CSSA 4EABA 1FTQA 3UKDA 3JAKB 2QD1A 3OHSX 2CNDA 5DX1A 3CWBH 1SO8A 4NBWA 5D00A 5TISZ 1Q1QA 5EWMA 4YIPA 4B17A 4UZSA 3LYAA 3U9LA 2VDRB 3AUKA 2J6CA 4R3UC 3A25A 1L7AA 2GBOA 1FRZA 1IY1A 1GUBA 3LPAA 4WCFB 3WNDA 2ZSFA 2X6CA 2NAPA 1W5AA 2UYCA 4O3MA 1JR2A 3P4YA 4S3MA 3ZNOA 5K6RA 2B4YA 5CLGA 3HXMA 4ABMA 1DK1A 4HDCA 4YT8A 4CU2A 1A8IA 1NBIA 1KAHA 4LY9A 5LWHA 1MXFA 2VF4X 2W98A 3T1CA 2IWHA 5FPPA 3O8DA 1NJ8A 3RD5A 1Q12A 3S2ZA 3VYVA 3ZWBA 3QVVA 1UBOS 4BVTA 2H29A 2Q5HA 2PKQO 3MJRA 4XDJA 1CUVA 1EFPB 2D5AA 3WRWA 3J80M 1ESEA 5L3EA 2XWSA 4MVJI 3A1EA 3T3GA 3TXXA 1XRLA 4MW1A 2DP4E 1PZGA 3K0FB 1CP9A 4KVGA 3E1KA 3ELCA 1MPTA 2R7AA 3TTUA 2HQOA 4BN0A 2HMTA 1ZRHA 4DMLA 4NH4A 5CIWA 5J2UA 2ASEA 3ME5A 4BNIA 4B73A 3QHDA 1DDOA 2IIQA 4D0LB 1I3CA 2ODTX 1H4SA 2OGWA 2D5LA 2R1UA 3RHFA 2X42A 1ECJA 3RQSA 1NHGA 1ZUIA 4AZTA 2N46A 2PLWA 1OKKA 1GPDG 3IMKA 1TZBA 4D7SA 1W75A 3GOHA 1T5BA 2PUSA 1GCAA 4JBNA 1E5LA 5B8FA 4UDNA 5DNCA 2G0NA 2QTHA 3I72A 3LVFO 4AO7A 5KREA 4AZWA 2VN8A 2J41A 3JQFA 3CVVA 1GRQA 1KZGB 1R66A 2WQZA 1I4OA 1VIDA 4N12A 1J2JA 3CLTD 1BCSA 1PX0A 1VLHA 3PE3A 5A7FA 5IANA 3K9NA 1JBEA 1KJJA 5K3AA 2BSQA 1OQAA 2XWQA 3KXIA 3E5RA 1YDWA 3OMWA 4QQNA 3TQHA 5K8LA 1XZIA 1H9AA 4XYBA 1G3RA 2H11A 3LPCA 1PJSA 3HR0A 1PNLA 3DHNA 2PL9A 1DOHA 4WFKA 3P9RA 5HTKA 4KQWA 3QIAA 4LJYA 1QG2A 5G2OA 5AVSA 4C5CA 3QX3A 1NQVA 2WNIA 1YITF 4M1OA 2F9FA 5ULLA 3R5HA 4H7JA 1E3QA 3ND9A 4PLGA 2WT8A 2VDMB 1B0PA 1Q3TA 5BN5A 2B2CA 2OSBA 2H7CA 1FMCA 4JCOA 3VZPA 4E15A 4EPTA 4FB5A 4ZDIA 1X19A 5HY4A 3P9IA 1ZD1A 2BKAA 5CFLA 2YWCA 4KQ1A 4OKIA 4N3BA 2Q5IA 3OZGA 1DBIA 3BCRA 4JXKA 2WFLB 1F14A 2CTRA 5CNJA 5C31A 4CMCA 2F00A 3UJ7A 3CVJA 2WWYA 4UBNA 3ROKA 3GVIA 4LF5B 3OZVA 3DLBA 4Q15A 1GNLA 3FGZA 3KZCA 4BJ6A 1Y1TA 2ZYDA 1KEEB 4YJGA 1JE1A 1SUIA 3AG4B 1QVGU 2D0PB 3DE1X 5K7SA 2FB9A 3DVRX 3I42A 3VHRA 4QBKA 3IKLA 4E88A 1JNXX 4EX6A 2R751 5CFPA 2C2YA 5IT9N 3D3EA 3HLKA 2VHXA 4K28A 2Q4DA 5THXA 1NFFA 2FZLA 1VXOA 3FYUC 4DV7B 3IPLA 2Z1NA 4EARA 3D3NA 1RBMA 1U97A 3JU3A 3R3SA 5AKXA 1PP9H 3RREA 1XI1A 5FTNA 4ARBA 2CFTA 5JY6A 4H7FA 2HUNA 4DR1B 3AB7A 3AIOA 5AG2A 1RJDA 4LNHA 1RD4A 1JFFA 2ONKA 3QXSA 3TZEA 2WTNA 4X6LA 1GTMA 1HOXA 1UOOA 3S4YA 2DZDA 2YIBA 4ETMA 1QKIA 3EEOA 3L1IA 1G291 3DLTA 1LQTA 4FLWA 3TQIA 1XMPA 4IT5A 1I7NA 2J5KA 2NU6A 1ZUHA 2VJPA 5DSTA 1LVHA 3C5HA 1NA5A 1YB6A 2AK2A 4HD8A 4ND5A 5HXAA 3KKZA 2A9JA 3PKIA 3WLTA 4BLUA 2BEVB 4WLFA 1TAUA 2AJ8A 2P7HA 3OG9A 4JASA 4MAAA 5CAEA 5KVSA 2AX4A 3EFOA 4IZIA 4DR2O 2XCLA 3A6KA 3GZTB 1PDVA 3IIJA 4QSMA 3FOZA 4YALA 2HLHA 3D0KA 4N7RA 4JLPA 5E3IA 1IWPB 1MCZA 2P11A 4M8SA 4MLPA 3M9XA 5CK5A 2N48A 4ERNA 4V0KA 4JAUA 4QYMA 5JWHA 1EFPA 3MT9A 5CCBA 2IW5A 1DHRA 1SXIA 2J30A 4KWIA 1EXVA 4PY2A 1GAEO 1ZRNA 3U7EB 1SOWA 3C7TA 3ZDZB 2ZUWA 3AG3C 4HAOA 1E1CB 1NXPA 3FAVA 4BKPA 3CIOA 3W4JA 3UO3A 1ESNA 4FE3A 3W7VA 2OD9A 1ONNA 3KQKA 2FUG1 3KYDA 3N07A 2VTVA 4O2LA 4UM8B 2QMOA 1Z5ZA 1Z18A 1VB5A 5HNKA 1TQDA 4PDLA 4EYKA 3UFXA 1M34B 4PFKA 2JJ8A 2O23A 3OEWA 1JEAA 2VYFA 5A5EA 3OJWA 5AW8A 1EH5A 4J3FA 4DWWA 1XELA 4M36A 1NX9A 1Z7BA 3RTDA 4B3XA 5HFAA 1QRDA 1COWA 5DCUA 3P45A 3QBEA 3WMGA 1YQEA 2FMFA 1UFKA 3BA6A 4D9HA 5I47A 1SD1A 3S81A 3VNUA 2XOKG 2PI5A 2RGYA 4PZCA 2H54A 3HKCB 3CNEA 3L1HA 3ZKAA 2HRYA 1QIIA 3BMCA 4LMAA 2EQAA 3W7UA 3U3JA 2P9EA 4ZWNA 2ATCA 3CVWA 3RUCA 4UU1A 2AQHA 2V97A 3CINA 1F06A 3A6LA 1U28C 5A1JA 3I56V 4B6EA 4NAHA 3R5SA 3VYSB 5JDIC 3FMIA 4EGQA 4IMJB 3TZBA 3OY2A 3C6QA 1S7CA 3ABQB 2B5UA 3D36A 4LNUB 2PJDA 4KZPA 3STWA 1Z74A 1QLJA 1VCHA 2XHZA 1VM6A 4PI2A 3LGSA 2C2HA 3OT1A 1C9JA 3PXCX 4HXFB 4OOFA 2D3OW 4C4PA 4G1VA 4UD2A 4MHSA 1A2KC 1NS1A 1G8JA 2QZ9A 2ZIWB 2XCIA 3G2HA 4K88A 3VHXA 3OAAG 1ZD8A 2CFOA 1YACA 5EEHA 3VGPA 4BNJA 4MA5A 4DLZA 1PQUA 3JAKA 1JJIA 3LI2A 1VSVA 4RA6B 3E27A 4HNUA 2Y93A 2BLNA 4BJHB 3G2KA 2HS0A 2DFKB 2IWRA 3K79A 2OTMA 3KTAA 4PS0A 4E2YA 5C51B 1J1UA 3R65A 3W9UA 1R6UA 4DLPA 4TXLA 1UXHA 5IM4F 4OXNA 4GP7A 1NVDA 2WTAA 4MS4A 5BYAA 4B46A 2A4MA 2GYUA 2XE7A 2CNKA 4S2UA 3TW8A 2OMKA 1N5MA 3GPDG 1WEHA 2DCUA 3VOTA 4A73A 1Z37A 1P5FA 2V7VA 2XAUA 1CS0A 4R3WA 2FC3A 1OGIA 3L7JA 2DR3A 5FL7A 2MW2B 1YV9A 3N4ZA 3I9NA 2GHTA 3L6CA 1L6IA 2QE7A 5T41A 2BFCA 1C9MA 1JR4A 1G9TA 1XQ1A 2VJYA 2AOUB 1TTPB 4OJNA 4YAEA 2GEFA 4GKJO 3UHPA 1QF7A 1UBRS 1DI0A 1FQJA 2UU9B 1U5BA 4IFEA 1XKXA 1GTSA 2XXBA 3IJEB 2Z98A 4TM8A 1JHQA 3HMKA 4J6FA 4W9NA 4OL0A 4MA4A 2HEIA 2HU5A 2QGFA 3S2YA 5L3RA 3HDYA 1VI5A 1ULAA 3I30X 3FFAA 2VUSA 1IN7A 5EIOA 2QRGA 4AYTA 3AF4A 3IVMA 1H2KA 2YXHA 3VO2A 3E2EA 4HGQA 3TX6A 2H92A 4D9EA 1IBMB 5L8VA 4M89A 1ST2A 4R6ZA 2A7WA 2IXBA 3LQ4A 3IKFA 4UUBA 1K73W 2V6FA 4RVGA 5JBNA 4RJ2A 1TUBA 1RQNA 3ZK9A 4CCWA 1P8AA 2IU4A 3DMTC 4KHZA 3WR5A 3PS9A 3SIWA 3WDMA 1FQOA 3AFMA 1EI9A 3I4CA 4XGIA 2VQ3A 3LUFA 4TV8A 2MJLA 3NOQA 1AK9A 5L45A 3WTCA 1HMYA 4RNDB 2HY7A 3PJGA 1M7GA 5AI8A 4BFLA 4X66O 2P2DA 4L9AA 3JAWA 3OW2U 3GRRA 3SYPA 1KI9A 3GFPA 3TMAA 3FROA 3V4ZA 1H2FA 2LIPA 1RAFA 2EZOA 2XJ9A 1ZO8A 2HF9A 1CNMA 5FTJA 4M0MA 4D9IA 5CN0A 1EVEA 2I34A 4MLCA 4US0R 4AQYO 4ZKDA 3MJSA 3Q8XB 3V1MA 4Z4GA 4PIPA 1NATA 1MHTA 3THXA 3WGIA 2O2SA 1I5XA 3CP1A 1GG5A 1V1JA 1AKQA 1TJ3A 1ZONA 3FKQA 3IKMB 4D9MA 2B2NA 3HSSA 1GPLA 1N2BA 2Q6OA 3LXMA 1VIBA 2Q49A 3RRYA 4BDTA 4D8YA 3S8YA 4KHPB 1AY0A 2GD1O 4MDYA 4O2AB 2CXXA 2GUWA 3EUFA 4IILA 1I2BA 4K05A 3WLFA 1X70A 4RHUA 4JC0A 4DBVO 1OD6A 2PGOA 3OU7A 4RUEA 3RYIA 2Q69A 3ORYA 4EUNA 5JMOA 4BVBA 1X7ZB 1K0FA 3UM7A 2RHRA 3DBLB 4XOUA 3ST7A 3ZLBA 4X1YA 2WYOA 5JZBA 3AP1A 1RIFA 1O0CA 3N2GA 4BCBA 3PUXA 1PK9A 1F7UA 5H81A 3R3XA 5AM4A 5AJYA 1YJ9V 1U2PA 1HEIA 1VJTA 4PG7A 4Q1VA 4TL6A 2CFCA 3F3KA 2QKYA 3IUNA 2L2QA 1IONA 2CLSA 2Q2NA 1WXQA 3LKBA 3OF5A 1XNHA 5BW6B 1MB0A 1V3VA 3NCTA 4Q9NA 5H8WA 5CHYA 9ATCA 5KQGA 4WKBA 3JVHA 3UC5A 1N78A 2X0RA 1G6Q1 2PKRA 4K46A 4L8VA 4UAVA 3VTKA 1MENA 1E9SA 1JSRA 2VWKA 3EBOA 4JLNA 1GXSB 1E6KA 4YV0A 3W5CA 4NCNA 2XECA 1N3BA 2YZ2A 1F17A 1KDPA 1QQ7A 2EAUA 3LIIA 2GAFA 3NEAA 2P2ZA 1YC5A 2GPBA 5HZKA 4L9RA 3A0RA 3NONA 4BT2A 4RXMA 5JJCA 3E5MA 4JDUA 3C1AA 3UG7A 1C50A 1XPJA 4FU0A 5IJZA 1BGVA 2ICAA 4PYOA 4UVEA 4P86A 5ELXA 2ZJ2A 1YZGA 2ZYWX 2ONZA 2IPXA 5IWCA 2VXBA 1P7ZA 1UKYA 2I66A 3NCHA 2ZSKA 1IXKA 4G84A 4HJRA 2M6SA 4MR8B 2H00A 4C43A 1W7AA 1WR8A 2YIBD 3MWDA 4RVSA 2ZR2A 3FYSA 2Q2WA 4U7OA 4YMVA 4F46A 2CE7A 3A3NA 4NCBA 3UMGA 1Z2CA 3ND7A 3OLVA 4RANA 2XAJA 4CCAA 3BGVA 1LZKA 4GRAA 1UDWA 1RXCA 5EKSA 1XZNA 4AX8A 2V6IA 3IE0A 1RPTA 1OW3B 5JSQA 5LZ2A 4FMDB 3QTYA 3FPJA 2PRSA 2JIMA 3BVPA 2BIFA 4Y6GB 5BMOA 1UR5A 3C3YA 3O9ZA 5F2VO 3BF8A 3TPCA 1W2GA 3ZWPA 4E6PA 1KQGA 3N70A 3SI7A 3ZK7A 5I5EA 2J9ZB 4JJFA 3MGKA 1LY1A 1M0SA 4DYHA 2VQFB 3MMZA 4LGYA 3I9FA 2UYPA 3FNGA 3U7QB 2BM0A 2H2DA 4KUMA 1U0OC 2IHJA 4X85A 3ZXYA 5BXZA 5FPKA 3FPLA 1EVIA 1JI0A 2FMXA 2G82A 5FI0B 1DBRA 5LMZA 2PT9A 3ZJZA 2V9YA 4OHZA 4EL5A 3FKJA 1ZRSA 5JSKA 4BRZA 4F72A 1TCCA 4EHKA 4ICIA 1D3AA 4G4VA 2F64A 2VT2A 2I6RA 2XBLA 4BW9A 1INLA 1DG9A 1ILWA 1IPFA 1QC5A 1EX1A 1BCSB 3DMTA 4O4HA 5FHRA 4WJZA 3DKRA 2V6JA 1JQBA 2RGNC 3FTQA 4YJDA 4BQFA 3FTPA 2X40A 1EZZA 3OIYA 3NC1C 3REQB 4CZ2A 5LD2C 4TYMA 1GZ5A 2Y1XA 4URYR 3ABOB 1NPDA 3QNMA 4CNBA 5B4UA 1OYYA 1Z6QA 2AOXA 5E79Z 2GEJA 2E4WA 1PFWA 1XIVA 2V7PA 3MWEB 4HGZA 4QRHA 4RPLA 5C5IA 3VDXA 4R1TA 2QW8A 2RGXA 5IK2A 4YAGA 2HQSC 2OEPA 1HP8A 1WOMA 2P5UA 5DO9A 3WYNA 1G8KA 4CRWB 1ZR4A 4DR2B 1L7RA 4MX8A 2IS4A 4H59A 4R7GA 3C9SA 3N74A 2ID8A 2PLAA 4A8PA 1U7TA 1F8GA 4A5SA 4L27A 3ZBTA 1L7DA 4XJSA 1GARA 4K8RB 2DBYA 1DPGA 2J0UA 3MMPA 1FY2A 1ODLA 3OU6A 3OUZA 3Q8WA 4X1OA 4BB6A 5DH9A 4GICA 2C3MA 1M0TA 1O7JA 2V7BA 1QQAA 1YRQA 4FHDA 4A3SA 4KCGA 4DR6B 1ULBA 4IDOA 3IV6A 3UT0A 3HU2A 4Q4JA 1JR3D 3DXYA 4UCVA 4JD5A 1V3TA 4GPD1 1Y5MA 1JG2A 1SVUA 4DUZO 1ZK1A 2HGZA 4FNOA 3RV4A 3WICA 3FN4A 1QQCA 1F7YA 2OBXA 2UUBB 3NDJA 2GD6A 4FBMA 4XM1A 2NO1A 4JJZA 4IL6Z 4DUGA 5D3MB 3QLUC 3OPXA 1Q3KA 4L3VA 4JNCA 1ZDMA 1YRBA 3HWUA 4ZOLB 2Q73A 4MTLA 2FW0A 4CFZA 5IYZA 1DRWA 3W4IA 3ZIDA 5FWYB 5IF3A 5BSEA 3MJHA 3H6GA 1KNJA 4KRGA 4TOIA 2RIRA 3MOGA 4RBNA 3HI6A 1D0IA 4DGSA 1XCBA 3H0EA 4MWZA 1E3DA 4MZDA 4EHFA 3CO0S 4ZICA 5BOSB 2PH3A 4WFGA 3AEIA 1UJ6A 1PXWA 1Y7TA 3DM5A 3LT2A 4LF4O 2Y9MB 2VTEA 3IJRA 4FNGA 4N8SA 4OJKA 5I9NA 1Z4QA 1LDBA 4PLYA 3I2YX 4C7XA 2V7XA 4GYYA 2E4XA 1A9QA 1MO2A 3EDCA 1WIWA 4KK3A 4CMBA 1XFDA 4BMZA 1WF3A 4URZR 3AUYA 3CR8A 1C9KA 2H0RA 4IWNA 4QTXA 1ZM9A 1QU7A 3H0CA 5TJ9A 2Z3WA 5B7GA 3CZAA 2RCNA 1DBVO 2CZWA 1W93A 1XE3A 3A6GA 1HXHA 3AHDA 3KKKA 4RIGA 1ZZGA 5KHJA 3EC1A 5AOVA 1ZZEA 2G9UA 3QZUA 4FJ1A 5SZHB 3R75A 3RSHA 1S72V 2HRRA 4S1TA 3PHJA 3EWIA 3JALB 3CH4B 4CMAA 2Y9PB 1IBCA 2DETA 1X1BA 1MQ8B 3RVNA 2IX9A 4EBFA 2QV7A 1JH9A 3AM1A 5AJVB 1TGOA 4OMUA 2AUMA 4EAAA 1XNQO 3SNHA 4OLHA 5L4SA 2CGEA 2XNDA 2ILTA 4HDQB 3OM0A 3DZFA 2VTDA 4HPJB 4D82A 1HV8A 4A6PA 4EUFA 4YPOA 4DXDA 4BS9A 1FFCA 5IM5A 2F17A 3OTQA 1NUHA 1WHTB 3H2IA 3JQCA 4G1BA 2ISCA 4ER7A 4B6JA 1ZVJA 2CLOB 2ZRLA 4QXQA 1C8BA 2QENA 2JCYA 4RVCA 2OP1A 3QLVA 4F4CA 3ZRXA 3GGJA 3B8EA 4YT2A 1EBOA 1DG3A 2I6TA 4M1WA 1MZVA 2QUIA 4MKXA 4WAUA 4CBCA 4F4JA 1KI3A 4J16C 3Q3EA 3ZDAA 1JHRA 1MV8A 2I67A 2OBYA 3V8PA 4GVLA 4HAVA 1P0CA 3BIWA 4V2UA 5K03A 3D54A 3OFNG 3V7QA 1PJTA 3ROTA 3F90A 3L7NA 4JITA 3FYEB 1Z0AA 1EEHA 5CDSA 2AQ8A 2QVCA 2F90A 3AUXA 5AKJA 4C81A 1R5OA 2PKYX 3RDPA 5CMUA 5AM2A 5BWLA 5CB0A 1XD9A 4MQ4A 4BUCA 1HNZB 3K0EA 2HCFA 1KARA 1GHTA 1FC0A 1QH1B 4BASA 3KFLA 5J1SB 3GRKA 2RGUA 4C0QC 5JO0A 2GMWA 4FLYA 4IRMA 3G4SF 3L71H 3PFWO 2IHNA 4IBOA 1QU9A 2WE8A 1CW2B 2GZMA 3NIGB 3K14A 4ISBA 2BP7A 3HN7A 2YJ5A 1TJ5A 2Z2XA 5CT4A 3I62A 3ADOA 3CV3A 3P4UA 1YZFA 2CXTA 1DMSA 2F7SA 2L82A 5C8XA 2W93A 4ASUG 2HYIC 1M5RA 3DP7A 1WP4A 4L4YA 5HMLA 2ZJ5A 4BZZA 4E21A 4U7FA 1YZQA 1Y4AE 3ZEIA 2ZYGA 1QO9A 4OMDA 4XUGB 1ABEA 2QRVA 4QFMA 3HVUA 4Y2XA 4BFTA 1T0IA 1H38A 5GM1A 4BGIA 2X7XA 4X62B 1XNRO 4HDKB 1Y89A 5DN6G 4BO3A 1LVUA 1V43A 3RYTC 1XPOA 4YUWA 3TM5A 3G71F 3GLFB 5GINC 1QXSA 2DTEA 3K9BA 4JAVA 2X5JO 5AVKA 4BE4A 5JARA 2EJVA 2JJMA 3GBSA 5U4QA 4EB3A 2IYTA 2PFGA 3H18A 3L49A 4LBYA 4XAQA 3TQRA 4BXOA 5CGQB 4LH7A 5GTIZ 1SD2A 4ERXA 1R64A 3NFRA 4PHHA 3MM4A 2FN9A 5T8KC 3OETA 1L7MA 1RTKA 5AVWA 2CJFA 5HIKA 2RHTA 5B2FA 1W0KD 5ADHA 1A9XB 4Z1MA 2DT5A 4MW2A 1Q1GA 3WLMA 4CMHA 2Y1GA 4QDUA 1XA4A 4H37A 1F0PA 2E6UX 2PZSA 3ADPA 2SKDA 1NC3A 3C1OA 4K6CA 4LTNA 1HDIA 3GY0A 3AYZB 1NN3A 1XZKA 1SEVA 3QUQA 1D2MA 4P81A 1XN1A 5DTQA 1EPUA 2GPNA 1F2UA 4J90A 4JJIA 4E5VA 4PG8A 4HUTA 3KR1A 1L4LA 2W6CX 4XX0A 4ZREA 2YX1A 4BT7A 1G8FA 1L5SA 4CWAA 5JXHA 1XR3A 3LWZA 6ABPA 4P58A 3CIFA 3K8QA 3UAOA 4WKOA 1E62A 5KTNA 4B6RA 3GUYA 4QVGA 3SQDA 4X66B 2V7TA 3OT5A 2Q4BA 5D3MA 1F6BA 2JAXA 4OLFA 2GM4A 4ZJPA 3K35A 4ZK2A 4TYPA 1WXFA 4G4ZA 1C8VB 2ZWIA 3PLRA 3WWDA 3KT8A 2XUGA 5AJZA 3H4IA 1XRMA 3VJKA 2WIBA 2TMKA 4QOGA 5GONB 3L0BA 2C82A 4PX2A 3RS7A 4F0JA 5EVJA 3DE3X 4IYIA 2GESA 5DEIA 1NTRA 3BXHA 1V11B 4DJAA 3K31A 4BNWA 3OWXA 5AW3A 3LBYA 3WPWA 2IEZA 3NMUC 1B3QA 2FQQA 5BY2A 2NUPB 1E6MA 3SZ3A 4ZVQA 1BOOA 4BLWA 5JLAA 1F48A 3EXHB 3IDZA 3WQSB 4OJMX 3G79A 3ZD8A 1HPLA 4IVPA 4NF2A 4CN8A 3D7RA 3BHIA 1IZ8A 4D7TA 4Y3UA 3T38A 4M8IA 5JSZA 4KR6A 3AQIA 4LK2A 1Q74A 3TW0A 1KZ9A 3A7EA 1BXRB 3IJPA 1UK6A 3GEMA 3QEKA 4HH0A 3SAJA 3TI9A 2O4CA 1QRSA 4DC0A 2UXBO 1MKYA 1QG0A 5COQA 4BQOA 1GPKA 1YBVA 4GBGA 1KIAA 3QV2A 2AUTA 4G0OA 4QIWF 5SY4A 4LXXA 2GBPA 1GN3A 2G3YA 5DSXA 5E1AC 3MUOA 1ND6A 1NBMG 4D4MA 1KI4A 3B78A 4GOXA 5L7TA 1SA0A 4DMGA 3CJQA 1JFLA 3W9SA 2IQQA 5ER6A 4DDKA 1PFYA 2OXIA 2AUNA 1KJIA 1PDWA 3GRUA 1G6HA 1E1KA 4KREA 1DE0A 3FCYA 2RH8A 4K3UA 1S9HA 1WSAA 3GQVA 4JL6A 1N6NA 2FWAA 2CUKA 2EDCA 3O8QB 4QX6A 5EWLA 2YASA 1RM5A 3STUA 1I7FA 1OI4A 5T6BA 5DV9A 1OPXA 5KUTA 3WKEA 1KTVA 2I2XB 4DSOA 5IBRA 3OZTA 2V7WA 1N5LA 1IHPA 2YWRA 2HHCA 3IR6A 4EH1A 1VQ4V 2ZINA 5EC1C 4XIFA 3M6FA 5C93A 2XI4A 2GJ8A 2YL2A 3KALA 3BVOA 1KI6A 4CM1A 4CGZA 2P4UA 5C35A 3K96A 4EW6A 2P06A 5IT4A 3IEPA 4RHXA 4ZALA 3UGKA 1OU4A 4BVQA 2XE8A 1NRXA 4H7HA 5J40A 1Q2UA 4FYXA 3KSBC 2IEAA 2PV7A 3HA5A 5JUWA 4JX9A 1DHTA 2YXYA 3TCUA 1JL3A 5KYVA 3IFXA 3ESYA 1SXJD 4K1LA 3SE0A 1RWOA 3L7DA 1U94A 3TTXA 2XUQA 3K3WA 2FUCA 2ZQYA 1E7YA 2QI9F 3EY9A 3V6MA 1DAPA 5F2OA 1XZEA 4MYCA 4E5PA 1NNI1 1UQTA 2CVQA 3T4XA 4L8WB 4DNFA 1U8CB 5AJHA 2QUZA 3CX8A 3PNOA 4DWVA 2ACWA 3B38A 3KJXA 3ZGNA 3COVA 3LK7A 1A9TA 1JB1A 5DRYA 4LV8B 5DX0A 1QIGA 5NLLA 2E18A 2VRCA 2JEZA 4M9ZA 2B1GA 4YS6A 3SHQA 3ZUGA 2Y0EA 2ZTLA 5KINB 1CSEE 1E89A 2IZ5A 2QG6A 4ALNA 4BMOB 1U6IA 5IJ9A 3F7OA 2EP8A 3VR5A 3DOUA 3IKEA 1KQSF 3D8TA 2ZVJA 1H5UA 1Y6QA 2BFAA 2PZ8A 3PI6A 3UK6A 5IZ4A 3ZDDA 3FFWA 121PA 1VQ4F 1UZNA 3H5OA 1F0YA 4PPYA 1I0ZA 4PBRA 4KODA 5BYBA 4REMA 4EFDA 3GPLA 3VOUA 4F04A 5I48A 3IMGA 4BT5A 3CF6R 2BT4A 4DHEA 4G5OA 1FNDA 4QDTA 2FA9A 2QDOA 2QI2A 2BEUA 2JIRA 2RAPA 3I73A 2XNKA 3LF2A 3NTLA 1LDGA 3O2QB 5ARDA 4B09A 1JILA 3C0KA 3I53A 3OHPA 4XD2A 3ZY6A 5LMUB 4LYYA 3F1KA 3EISA 4IJWA 4QHYA 4MS3B 4NAUA 4UARA 3I58A 4Y2VA 4ZGGA 4X92A 3U6BA 2F8TA 2C4HA 3LWOC 4KLAA 1EFDN 3MWLA 3P4EA 4BVKA 1FSPA 2P6NA 2WLIA 1ULZA 2C9OA 4TYQA 1JYSA 1Z2PX 1M6VB 2F1KA 5A5GA 3EGDA 4X7RA 4F12A 4P3KA 3IP6A 3PGVA 2B21A 4WINA 1RWQA 4TVOA 5M29A 4QUIA 2R4TA 1N2GA 2DBQA 3GGOA 4K6GA 5EGSA 1KRHA 2CJPA 2OQVA 1D9ZA 2AN4A 3TVTA 3B7GA 1YTFB 1W2BF 1RI1A 3KV1A 4Q82A 2ZCVA 5IH7A 3CMEF 1FJHA 2ZPUA 4R2HA 3E22B 1NOIA 3VJMA 4AKTA 1TA0A 1KEVA 2I7VA 3REOA 5BYKA 2MQEA 2VNAA 1XL4A 1NV8A 3IAHA 2JJQA 4XDZA 4IMIB 2C7OA 4IM7A 2ETXA 1RHJA 2QX6A 1ZAUA 3Q8HA 1BC5A 3GX1A 3P9SA 4QKQA 3EPJA 1U31A 3H5NA 4WFIA 1UXKA 4Z2YA 3W8RA 4CQMD 5HRUA 2YH2A 2VRWA 4CQLB 3EUEA 2QRVB 4KUEA 3GHYA 5A03A 3I6ZA 4E2ZA 5TX7A 3BMOB 2WE7A 1XMVA 5KDOA 2H5LA 1DFHA 4NZNA 1FJGO 3S0JA 4D43A 4URXR 5ICCA 5DYIA 2FEWB 3VKGA 4RVDA 4PEVA 1RA4A 1GFIA 4YACA 3MHTA 4BV9A 2WIFA 4ARUA 4JFRA 4TN5A 1QGYA 3QKUA 2AR9A 4IEFB 4II7A 4F5YA 2PKEA 3W6PA 3ETQA 2XQIA 3CF0A 3F4KA 4JL8A 4MP8A 3K15A 3DGEA 2X8JA 3ASNB 1VG8A 4PYNA 4WPGA 4ZO9A 3ZY4A 1AV6A 2DULA 3D4IA 1T1EA 4MJ7A 5GVSA 2WKQA 5U9CA 3ZHVA 1GPJA 3UHFA 2H6EA 2XOKA 2C2XA 3VVMA 3EPHA 1QH1A 4CI0B 3HR7A 3DAGA 3T99A 3ZCQA 4LV5B 3P30A 2PGGA 5F78A 1ZX1A 3JPYA 2ZB4A 3U3ZA 2JNBA 4J8PA 1WWKA 2CUTA 3IKTA 5DYGA 2Y1FA 1YB1A 1HE1C 3ZH2A 1GL3A 2EFHB 3MFYA 2P7TC 4EVRA 3T4DA 3D6MA 1NI8A 4ZEOA 1Y9JA 1LDMA 4D7AA 2NNWB 2SCUB 5B53A 1I94O 1X6VA 1T13A 2H4HA 3T9BA 2BCGY 3WGJA 2PS0A 2W48A 5ARBA 5HP7A 2VUUA 3GAMA 4XVQA 2ZAGA 4Q05A 1X8KA 2PT6A 4FS8A 4WACA 5KHGA 2E74B 4Q7LA 5F5LA 3T15A 2BEVA 3UTCA 3MTJA 3MT7A 2Y67A 3OLZA 1B00A 2QTPA 4QYTA 3RRZA 3WZMA 5LYJF 2QVZX 2PSHA 1G5QA 2V9CA 1GQOA 3BEDA 4BQRA 4NU8X 2DJIA 1R18A 4R2IA 3DPUA 4UE3S 2J09A 1ZW6A 2MSLA 3STXA 1P49A 3T95A 2NSJA 5AIAA 1NVXQ 3MXOA 3S44A 2WWXA 2WIJA 4YV2A 3KJGA 5JXIA 3VKHA 2YWGA 1DEXA 1CEXA 4P7FA 2GFIA 4MHOA 1MABG 1G0NA 2F93B 2J5QA 3UKOA 1JA8A 3ZHTA 4EVIA 5TARA 2QD3A 3K5IA 5BMVF 4W5OA 1XJ5A 2RFLA 1M2JA 1RAHA 4LRWA 1DJLA 4TVBA 1B3BA 2IE0A 1P2GA 4K35A 1W47A 4IYJA 5D5HA 2VHUA 1XRQA 2EARA 3CUYA 4L7QA 1J8DA 4O2RA 3VYWA 3HJWC 1JIKA 3T3NA 1RQ7A 1ANKA 4LKOA 1U1EA 3HPQA 4BLRA 1IQ0A 1NLFA 3HJTA 5BSKA 2FRXA 1KK0A 2XZOA 5HWEA 1V8OA 5B1YA 2R0QC 1RWBA 4IXWA 2W2TA 2C1ZA 3A9TA 3RV3A 3M99B 1GNQA 1BKYA 2G88A 1PUIA 3BMNB 2IA5A 2GN0A 2VYND 2ZAOA 2WJIA 3L18A 4PZEA 2YYAA 3JCZA 4TSKA 3L9WA 2EW8A 1BE6A 1B43A 2DWQA 4DR4O 2BGNA 1ZIYA 4NNPA 4MVOA 2MYPA 3BILA 3TLGB 2O2XA 2PUWA 4J16A 4HAYA 1DCMA 1H69A 2IUEA 2I1QA 1D4ZA 1KEZA 3WL5A 2C3PA 3A0RB 5ES3A 2OHGA 3DBHA 3WNBA 2QHXA 1NXVA 5H2FZ 3AKZA 3AOGA 3FPKA 4WUTA 3GIDA 5CD1A 1NR7A 2UV8A 1KPGA 1XTVA 3T3PB 3VU8A 3VNVA 4M6WB 4XFKA 2AE1A 4BVHA 2WINI 3HJRA 5FO0A 2DR2A 1HETA 1E1CA 2H5IA 3CX4A 2P4KA 4JT4A 3ORQA 1B8OA 1MB4A 4HVCA 1NU8A 1T2EA 1TO1E 1JG6A 2VAVA 2YZKA 4JB3A 1RTTA 2O8NA 3SR3A 1R73A 4C6SA 2BGGA 3IP9A 5EJFA 4E2WA 3EZGA 3FTCA 3T52A 3TGPA 1EEXB 3KSRA 3CCLV 2OXCA 3EFEA 3SXPA 2JFVA 3H3XA 4K8OA 3AGPA 2PEZA 5JMTA 4DXWA 1G6OA 3IAYA 3R66A 1CVRA 1GZ4A 1FXHA 2W90A 1QIHA 1X8JA 3GLHA 3ZEAA 5HYVA 1E5TA 4M9CA 3L0YA 3QKRA 4BCCA 2J0SA 3ACBA 1I9CA 3VQXA 5L7YA 3AX6A 4RY9A 1CQIB 4PN7A 2AVDA 2WPNA 2F4VB 2FPPB 3LYBA 4JUAA 1D09A 1LPAB 1XDUA 1ORHA 2IYEA 2GF0A 1EP3B 3G8AA 3GVPA 3HFJA 3SLRA 5KI6A 5ALGA 4D8VA 4E11A 2UYGA 2ZSHA 4IOKA 5FNVB 4PNPA 4KOEC 4C78A 3T1NA 3T06B 2ZIOA 3CSDA 1D8AA 3G68A 2W2LA 3R3ZA 1U7UA 3H7AA 2XKAA 3IV9A 4K9RA 1KORA 3BTVA 1AE1A 1N9GA 1T9DA 4L75A 3S1AA 2OZBA 2J9RA 1QRAA 3QQPA 3Q85A 5DGHA 1OAAA 4YC7A 3KKNA 4CE6A 5JAIA 3RSGA 5BV1A 2LNDA 3CKLA 2IV2X 3VV3A 2JFQA 3VR2A 4Z8XA 4QPJA 3K5HA 4KE6A 2ZM5A 1EFVB 1PGPA 3DEAA 2XLBA 3MCTA 4LCEA 4UFPA 5B6JA 5CFMA 3UPUA 2Z01A 4HXGA 4BO9A 3EF0A 3GTZA 4ZTZB 4U3JB 6NULA 1R6KA 4IGGA 1JQ0A 1TT7A 2E0IA 2PYIA 1FUUA 1Y98A 3D7NA 1LFDB 4DF3A 4C7UA 4QNRA 2PU7A 3OD4A 2AF4C 4GUDA 4YFVA 4LQLA 3RI3A 1LJ8A 1MEJA 1S3FA 4MDFA 4HX2A 3PJRA 1SQFA 1CC1S 2ZBVA 3FLMA 4LGCA 2HJRA 3H9BA 2EIMB 4EQZA 1JJ2U 2QUHA 2Z8YM 1FDSA 2C99A 3BC1A 3NEJA 3LNMB 1BU8A 4IOMA 4MYUA 2IT1A 4O5AA 5DM2A 4HB0A 4CLDA 1XEXB 2H1SA 4EB0A 5KTYA 4UUJC 3N0TA 2HPVA 4C9BA 3MT0A 3KQYA 3SJUA 4YCSA 5B6IA 1A9PA 4FOTA 3WVNA 1AZSC 4A0FA 3CM0A 4NZMA 2QRKA 3MILA 4YFYA 3SQOA 1ZCFA 2O07A 4CDRA 2X14A 5IVPA 1YIJV 2DWEC 2CL0X 1RACA 2BY4A 4EHDA 2ZUTA 4ZFNA 3RSLA 4HZ3A 2NSLA 4TMTA 3L72H 1Y7PA 5LR6A 4U6SA 3RA6A 4KH1A 1QO0A 4OJQA 4HNAB 1W0KG 1QHNA 4UNSA 4B31A 3IUBA 1GGVA 1X8XA 5JHHB 1ZMRA 3FLAA 4KU4A 5CIYA 1AILA 1IHXA 2XXJA 3TO5A 4BU0A 1UAYA 2H1IA 2IG8A 2AN3A 4L5IA 1M66A 4NZ9A 5IBPA 4C82A 3JQGB 4YRPA 3F67A 3MCUA 2FZ4A 2Q50A 2R1ZA 3OQPA 3OTWA 5JSYA 1U7OA 5K51A 4X1IB 1JHYA 1NMSA 1Z4IA 1K9MH 1E2QA 3FYUA 3PITA 3BQMB 5I8PA 2F62A 4IG9A 4QRDA 2FEAA 3IRUA 5BV8A 4G63A 5REQA 1TQHA 5JJKA 2VDWB 5DK4A 5TS3A 1V54C 1MNAA 3WZ2A 2EKDA 1I9GA 1NNLA 1PE0A 2GLTA 2HJ9A 2ZIZA 4HFMA 4UHJA 2PE5A 3LCMA 3R7BA 4JEMA 1E4YA 4HH1A 1LU9A 3JASB 1M8FA 1KDOA 1CQJB 3D1LA 2GJ9A 4TWZA 5FR2A 5T4BA 3ABSB 3PC4A 1ORWA 4BMNA 4C08A 1X1QA 4ND2A 2VDLB 2B35A 4F96A 2QLBA 3Q9LA 1FFSA 2CN1A 2ZT8A 1JU3A 1HL7A 4PQRA 4DA6A 3KVNA 2WSMA 4ZQFA 1H66A 2PY6A 4J41A 3AFOA 3CRZA 3ELYA 3B70A 4FW8A 2SNIE 4W4KA 1XA0A 3ELWA 3UB2A 2IZ0A 1HNWB 4X64B 1NVAA 2JJ2D 5IJ0B 4J0HA 4J94A 3TOXA 1VIAA 4FQ7A 3UT5B 2WB2A 1T9AA 2Q7HA 4TUYF 5ALWA 1AV7A 2HSWA 1HTWA 1LW6E 1TMOA 5HF9A 1H2LA 1S72F 4OXIA 5L53A 5EZ6B 3RS5A 1CZLA 1TYAE 3TTSA 3MINB 1XFAA 4GYCB 3G8BA 1GZHB 1CXZA 2Q3MA 5BP7A 4QYIA 2HKIA 1L8XA 1TK3A 3KJNA 1ZD2P 3THXB 4WZBA 3ELUA 2DFTA 4FHCA 3DB2A 4HDKA 3J81N 4IS3A 3H2YA 2A1IA 1W25A 3U9SA 3WYGA 5ITWA 5JXJA 1YA6A 2ZUEA 3HBLA 5K0BA 2X9GA 5HWSA 2IJJA 5L3ZA 1ZUD1 3DNFA 3D6FA 3KLMX 4J2OA 3MRSA 3GP3A 3MMSA 1GPNA 2Q46A 1T3HA 4JQZA 2GBIA 4WH0A 4EKNB 2PQ0A 3GO4A 2WPDA 4YIHA 1PGNA 1AZLA 1MD9A 3Q7IA 5DYTA 1QYDA 1VMEA 2RK6A 4IZ6A 4Q4JB 2DQSA 4QFDA 5BUZA 3N2IA 1Q1ZA 2C5FA 1CERA 3KRTA 4UASA 4UVAA 4EO7A 5TLSA 3LPMA 1QG4A 1I8TA 2C42A 2EKPA 5K8CA 3X2QC 5JW6A 1YFZA 3CXUA 4YIKA 3P9KA 3LAWA 4I5GA 3GEPA 4C0AC 1JEDA 1N34B 3C90A 1K3FA 2PWZA 3H99A 4LHVA 5IAEA 3ZGLA 2UVPB 2Z09A 4BP8A 4GFDA 4NYJR 4G8DA 2C4WA 1RRMA 2GTIA 3DKIA 4V0RA 2QP3A 1EVQA 1RMTA 4QVKA 4OX9O 1DLIA 1B74A 3R0XA 4XIJA 1N2XA 4ZI7B 2R7MA 4ZU3A 3UMBA 5JLJA 4ZIRA 3WIEA 4H1VA 2HV8A 3KQPA 3IR7A 4RLQA 4IXMA 3BTOA 3WZLA 3TD2A 2G7ZA 3U7RA 2E87A 2XUHA 1TNDA 2V5VA 3TXYA 3W9YA 4O4JB 1MORA 4F4IA 1C5KA 1ZGGA 2QAIA 3MJEA 5M34A 4NATA 2DAPA 3ZDRA 4OJTA 3CCBA 1ZIDA 4RMJA 4W5QA 1E3TA 4QT0A 1TQ2A 2EBUA 2FWRA 1CUXA 4EGSA 2QPTA 1GRVA 5DYNA 3TJRA 1RM1B 1BX3A 2CVFA 4WZBB 4M8LA 4TVKA 3KKEA 5AKLA 3G49A 4NWIA 2OXTA 2Q3FA 3SKXA 1YAJA 4EIWA 3O4GA 4I1IA 5KQMA 2WB4A 1E7MA 1R3JC 2I3AA 3AVQA 3LLCA 1P2VA 1BWRA 1ZM4A 3MJDA 3MW8A 4R8KA 2X0IA 4DJFC 4ZJUA 3B52X 3VR6D 4AY5A 4KC0A 4YMHA 1WMBA 1K3EA 3EBPA 3OJOA 5M2QA 1SK9A 4EEXA 1O89A 3A7DA 4DR7B 1VQ6V 1N5RA 1V5FA 1YJWV 1PYGA 1HG1A 4HAUA 4N3AA 3D1VA 4WF9V 3Q3JB 4UNIA 4Y67A 1D4FA 1E9BA 2HHLA 1SQBH 2AHOA 4Y9TA 5HIJA 4ALKA 3CMAV 5EZYA 2J46A 1NHWA 2I54A 2GN4A 4DV5B 2RJZA 2QLFA 1K1EA 4OYYA 4RHTA 3GZNB 4D81A 3SS9X 5EP3A 3ABTA 2FSHA 5BQ3A 2PS1A 1W85A 2W2QA 4LK3A 3L4KA 2WYUA 3CA8A 3RVDA 3M49A 2GD2A 4AF7A 2RARA 4A15A 1OT3A 1GDHA 4DO2A 3AGKA 5FUWA 5JISA 1XXLA 2Q1SA 1QP8A 2CNLA 2YZMA 3DW1X 2X1MA 4Q1FA 1NVUQ 5JPCA 3P3NA 3E7WA 3MDSA 4BFSA 4WKCA 4MQEB 3FJ1A 4NEGA 4M8KA 1YUMA 1BEZA 4M0LA 4B75A 1Z17A 1GZ3A 1VBNA 5AUOB 3NNDA 2A94A 1EESA 2C94A 2JGEA 3ONNA 4IIHA 2ADFA 2C2OA 2QXYA 2PCJA 1GCIA 1J6UA 5ILQA 3RC2A 2WHPA 4WXMA 1KKCA 5EPOA 1IV1A 3IGFA 2AVNA 4JYAB 3OF3A 1IL0A 3NFYA 4X1IA 4DPLA 5G4KB 2FN4A 1E18A 2AYZA 3S2FA 3ZRSA 4BBZA 2WFZA 5DM6V 2YHBA 3QMPA 5FT9A 4TYNA 4INOA 4NCJA 2P27A 4BNHA 2WV9A 5AK0A 4AJ9A 4IHJA 5L3FA 4IH1A 4U7GA 4O33A 4JK3A 2GR9A 4FEGA 3RVKA 4MUAA 4KW7A 1P1RA 3IVGA 1THMA 1Q1AA 4DY4A 4ZCIA 1OA0A 2JGDA 1XJWA 4OQ4A 2COEA 4HX5A 4UTNA 4NARA 3CVYA 2QQ0A 1RRVA 2PPLA 2Q0OC 2JVJA 3KWMA 4DT1A 1HE8B 1IPAA 1YD7A 4LISA 4YP0A 4CEIB 2BM1A 3OIVA 2X2FA 3ESDA 1ISGA 4YONB 4WJKB 4KPFC 2H7VA 2XUPA 4HNTA 2QM7A 1I6MA 2Z4RA 4ZVKA 1AQYA 2BW0A 2I7TA 5BSFA 3EVKA 2QAGA 2W6IG 2QR3A 3UPTA 1D07A 1G3QA 3FE2A 2ZOVA 2B7LA 4PNHA 4RPHA 4WRRA 4INAA 3TL6A 4YXFA 3TETA 1QC5B 5D1NA 5GZ1A 3H01A 1VLJA 3KD3A 4IGIA 3QPBA 4NCAA 4N03A 1GKYA 4HPXB 1ATZA 4MP3A 1SMKA 2NO5A 4AHCA 3BWDD 3FHOA 2P91A 1YVUA 2C84A 3VOBA 3I9MA 3K0CA 4UM5A 2C7RA 2ZJ8A 1V54B 3QTCA 3LZCA 4H9GA 4LZNA 3K0BA 4KAAA 4NFYA 4RJJA 2XXAA 5F1OA 4B4WA 4KNVA 3D2BA 4G0UA 2Q1XA 2RG1A 2L18A 3UGJA 2GVZC 4G5YA 1VQPF 1VQ8F 1PLKA 1TU4A 1V5GA 2FWNA 4KVZA 4AP9A 4ER3A 1SAYA 3RJZA 4WBXC 4K2HA 1OSNA 3DSRA 2H06A 3BFKA 3KCQA 4IQGA 4DM7A 5A9SA 2PL5A 1RI5A 5AOAA 3H19A 1SKUA 3KWFA 4PZ0A 4JBXA 1G8GA 4G36A 3UQYS 1U8ZA 4OP3A 3USZA 3NYQA 2ZRAA 4UBLA 3DVQX 2CHTA 1F2VA 1JFRA 2LV8A 3ANYB 1UINA 3JYPA 5EPEA 1MW8X 1Q81W 4MPDA 2WMNB 1U98A 4QPDA 3SSNA 1DDGA 2R65A 1DTWA 3JV7A 3LS2A 3OO1A 4RU1A 2VSYA 4V24A 1KECA 4Q00A 4Q3KA 1LDYA 1GR0A 3M6VA 3PFKA 3HL0A 4U5XA 4LC1A 1GQQA 4N0MA 3UKJA 2XY4A 1ADCA 1U2TA 5J5AA 3KCXA 2OHWA 3CZ4A 1YVWA 1Z9BA 2CLHB 1Q0PA 3LSYA 1CZUA 3VNSA 2OIGA 3W79A 3D4PA 4O2AF 1TA8A 2RH9B 2KSDA 2XB6A 1V47A 1Y76A 3LUTB 3JD1A 1CIJA 2OPBA 3KSUA 4H27A 4OLJA 5B1DA 4AXBA 3EVZA 3LCUA 4L4SA 4CF3A 4ZYUA 4RL4A 2QLTA 1G8PA 1W88A 5BR8O 2E3JA 1SKMA 1BHO1 1M10A 4GD3Q 3ID6C 1X0VA 5HFJA 1N8TA 4FJ2A 4UTZA 1UC8A 1GLNA 721PA 1U3VA 4C2UA 3T1OA 4WNCA 1NXSA 3S0WA 3P96A 2AFHB 2ZRIA 1CRLA 2INGX 2GSMB 1M2VB 3FMPB 1L7NA 1Z7EA 2IU6A 4X1KA 3W05A 4EF5A 2WV7A 1EFAA 1QHTA 1Z13A 3A1CA 1JVNA 3TFOA 3E9ZA 5K6TA 1D5CA 2ZR0A 1QDUA 3MJCA 3LT4A 4FI3C 1IV3A 2Z3YA 3K2QA 3SE7A 5A2QA 4II3A 1ENOA 1R8XA 4PAWA 3G8DA 1Z22A 1N9GB 1X7YB 1GV1A 2XW6A 1V55C 1N2CB 3RPEA 4OMCA 2GLUA 2WU8A 4V1CB 4NCXA 1C7JA 3UC9A 3WYAA 5HQ3A 1IQPA 1FRFS 3QU2A 1NC1A 4K6HA 5ED0A 2NSHA 1N0UA 3BCCH 1PJLA 2AMLA 3LUPA 4E1BA 3CYQA 2K5UA 1KJ8A 3WADA 4D92A 3CUTA 3I2FA 2FPLA 4R68A 5KHAA 3H11A 3PQCA 4QDJA 3RUDA 3AB3A 1BOFA 1H4TA 4H16A 5TJHA 4ARAA 2V03A 3P32A 1G2OA 2J6BA 3HR8A 1OZGA 1GRRA 2QDKA 5J4KA 1E9FA 2LUOA 2FI1A 2GYYA 4L02A 1H2EA 1JT9A 2WWIA 2R70A 4PAQA 3OMAB 1KO7A 3CLUD 3NNNA 3QJGA 2OZLB 1XHFA 2XR1A 2I78A 3CWQA 3EAGA 1DINA 5CFQA 4YPFA 3P52A 6Q21A 5AVVA 1PTKA 4NU5A 4OF4A 4LYAA 1HKHA 4ZV7A 1VPWA 1KAGA 4B3RB 1P0MA 1QCDA 1XTSA 1Z0DA 1HE5A 2XITA 3F71A 3E82A 1VKZA 3LDAA 4KYTA 4LFAB 3VSEA 5I4CA 2NU9A 1WMEA 4DREA 1VE9A 1KK1A 3KT3A 1JLHA 3CH7A 3RTAA 1HORA 3E3AA 2AQKA 2PYLA 1L4BA 3W5JA 2OE2A 1KHTA 1NT4A 3NO4A 4AJ4A 5LD2B 3ZBUA 5DZSA 1C9EA 3K8ZA 4KAJA 3OUFA 1EQ2A 3ZN0A 2PGAA 2J0EA 3K70D 3L74H 4K0KO 4MPRA 5F21A 3GLIE 3IPRA 3SJAC 1WXIA 2V7GA 4FLEA 4MUJA 1JKIA 4W7IA 3Q7RA 2PSJA 1MGOA 2EP7A 1N9ZA 3FHCB 4Y1GA 4BO2A 2C3UA 2LBXA 1M90H 1BMDA 2PX4A 1OLUA 4MXDA 4N0QA 5EHQA 5G02A 3AVWA 1Q6ZA 2N9UA 3AT1A 3HBJA 4WBNA 4OHOA 4FCTA 1P1FA 2XE4A 2YN2A 1X7WB 4C0HA 1QFZA 4JTCB 3IR5A 1B15A 1Z5GA 2FPGA 1V3QE 3GLIB 3LL7A 3GN2A 3ZHUA 2DXIA 3QYPA 3KYCA 2XPCA 3KT6A 3IYLW 4M0KA 3M4YA 4GZMA 2A9OA 1XQVA 2C29D 1PT7A 1RQLA 2I2WA 1AJPA 2PWBA 1GEEA 5DJ5A 3NEPX 3SLGA 3SR0A 4HNRA 1XBIA 1ZK4A 2ATEA 2IZ7A 2UVDA 4BRUA 5A2GA 4YAUA 4Q03A 1MC4A 3THWA 4IDGA 2ISQA 3PPYA 4Q20A 4HDNA 1V1MB 4OUDB 4U7TB 5FNZA 3SYKA 3THSA 4AN0A 4CLXA 1G7TA 1QVFU 1PNTA 1SUPA 4B3DA 2DFVA 2DQ4A 3P94A 1UAAA 4MVCA 4XB2A 2X8WA 4L4XA 1P4HA 4S0XA 3BBLA 3GT4A 5K3BA 2GCGA 1TE2A 1YJWF 1M2OA 2B7BA 1Q6HA 2HA7A 2AG1A 2YNMC 3KUUA 4R01A 3WU2Z 2BPOA 1A1VA 3RE1A 3QPUA 3ZZ0A 3EVEA 3MWYW 1VP9A 1KEUA 1N2SA 1X74A 4IOJA 1L5ZA 5DULA 1L9XA 5D6NA 1K6MA 4L2IA 2JFHA 4X1KB 3S40A 2EFCB 1GP2A 3ND5A 2AFRA 4US2R 2NTNA 4N48A 3BZUA 4J75A 2PYJA 2R62A 6REQB 3BGWA 4DK1A 2AOUA 1T0JB 4JOQA 2EFEB 3IESA 3LFTA 1W4RA 1EUQA 4BX3A 2AN5A 3R23A 1ZJYA 1K7XB 2XUOA 2ATVA 2O0HA 4QUHA 4W6QA 1PK8A 4YJFA 4KBFA 4PS1A 4HEA1 3BYQA 1PD1A 4I6EA 1FU7A 2PVPA 4DV1O 5H3LA 2WLLB 5H4HA 2PSFA 4RKYA 1T0AA 3CUVA 2W4QA 3VPSA 4G56A 4PC3A 4BLQA 3ASZA 3CXRA 9MHTA 3K06A 1YBAA 3L92A 1K06A 4BB0A 1E9RA 2O8DA 4FFWA 2NOAA 3IAFA 3TNJA 4MMXB 4JYMA 1J4AA 2KYRA 4RLSA 4IJMA 1W96A 1LFAA 3R0ZA 4ES6A 1CIVA 4XR4A 1N4CA 3UY4A 3ZI4A 4X45A 1TVMA 3KTFA 5KNDD 3BS4A 2RGEA 1KAQA 2EZUA 1KJ9A 1WSBA 4LOIA 4AW9A 2JHGA 3ZHXA 4K86A 1ULSA 4BP1A 3UAZA 4XGRA 2VZ8A 4D56A 3HABA 3TG2A 5K8UA 4MUEA 3I6YA 3A27A 1OASA 4IDCA 1UZAA 4H6VA 4KO8A 4CM6A 1TTHA 3PVZA 4YDHB 4YECA 1VPTA 5BN5B 1KVTA 1F8YA 2C9DA 2JEUA 1BO6A 4QOHA 4PLFA 3AR5A 3D6AA 3P9YA 4ZO8A 4LC9A 1PVVA 4QYXA 4QDKA 3C6ZA 4XWTA 1JIUA 4W5JA 5JXGA 1N32B 1YIOA 2Z2KA 3VR5H 2BYTA 1OFGA 1T3LA 3O7WA 1WRBA 3LVQE 3L8DA 5AHWA 2XGMA 5AUQA 3VMMA 4IIUA 1Y4SA 1RBQA 3L02A 4L16A 1QP7A 2YN0A 4AN4A 1SXPA 2OV6A 3Q0EA 3VVLA 4JVNA 1R00A 1T6YA 1TF2A 1PR9A 1UJBA 1XEWX 1UKCA 2JRCA 3H04A 1EDZA 3OCVA 3ZQ4A 4CDMA 1ZEJA 2O59A 3SPGA 1X7XB 4H60A 4N41A 4WGFA 3T5AA 3OFSA 2V9ZA 3SHWA 5JI2E 4OM8A 4DV3B 3JVVA 4EUSA 3B2EE 5BZBA 3JZIA 3NBZC 2G9NA 3QXGA 2P2LA 3DMGA 4MRVA 2OORC 4JNKA 1CQIA 4UCRA 1HF3A 3NVKE 1WA5A 4KXVA 3KQOA 2I6QA 4ZAWA 1QIDA 1ESCA 2CBGA 2RDCA 3OGIB 1E7KA 1QGAA 1V26A 2FGKA 2J87A 3FJOA 4WFBV 3DR3A 4AZSA 1DBSA 4LEIA 5AWFC 2J3HA 1XVVA 5TVGA 3PNQA 3OT4A 2ZIXB 4CCYB 3FUXA 4MJ3A 1H5NA 5JYDA 2C59A 4DQVA 5J2UF 3AR6A 3LOUA 1WNSA 2VHEA 4BFWA 1Q86W 2ANBA 3FNFA 1SCAA 3NHUA 3OR7C 3F7VC 4P4UA 4AYXA 1H8EA 1Y8CA 4OPMA 4I99A 1FRNA 2QM8A 3VU1A 5LOVA 5LZ4A 3E7XA 5CAEB 4H13B 3CCQF 2Q07A 3E89A 4YJ2A 1VMIA 2H52A 3AU8A 4QBFA 3PGA1 1MOFA 2B9ZA 2COKA 2IPNA 2GRJA 5A0TA 2QL5A 4LZAA 1EWYA 4UD6A 2AZ4A 2RAVA 2NADA 3NUQA 1PEDA 2P6JA 1SRRA 3AEUB 2FR8C 2MHCA 3HDTA 4PO8A 1AXEA 3T0FA 4F3NA 1QAOA 1U9YA 1HDJA 1T10A 3G2LA 3V9PA 1E6EA 4YJGB 1JTVA 1VRVA 2KS6A 4A2WA 1KEEA 2ZTUA 2HXYA 3IL2A 3A4MA 3HFSA 2R7KA 2XOXA 2ZIEA 4G9EA 2NZJA 4X65O 4M7OA 4M98A 1XUQA 3N8NA 4DG9A 2Z2YA 4EOGA 2JCSA 4QJ5A 3SR2C 1M1ZA 2GVDC 2Z8ZA 1PGOA 2OXFA 2QP9X 3ZJYA 3WV4A 2IOYA 4REQA 4EGJA 3SM3A 1QCEA 2PY5A 1F51E 3Q7EA 4BR6A 4MITA 2AW9A 3NLLA 2YWHA 3JRNA 3WWCA 5IX8A 2X19A 4BFVA 3M81A 2XMBA 3B6NA 1R6VA 2G0AA 5H5JA 3PV0A 4E31A 4O08A 3QVNA 1T0UA 2O3UA 2EGUA 3EYWA 2XMQA 4S0ZA 3ABIA 1JBQA 2UZ1B 1ZAYA 1E79A 1GPAA 2V74B 4OV6B 4ZDWA 3T4EA 2W6NA 3I09A 1OILA 1FZTA 4DV7O 3C5EA 3OKFA 3P0IA 3QKWA 3JSNA 2XMCA 4BW0B 1TLTA 5LZ7A 2C3YA 3NDRA 2OCHA 4KQ2A 3A1NA 4EKYA 3LDTA 3TD3A 1E5DA 1KYWA 2NO6A 2VPQA 3OOWA 4UU0A 3FOFC 1CRQA 2C96A 1CFZA 4AP6A 5F52A 3LO8A 4KXUA 1S8OA 3IELA 5IVDA 3BH7A 5TSDA 2A5LA 3S7ZA 4RVFA 4GDMA 4B79A 4RFSB 2C98A 3WA7A 5KLVH 1R6TA 1FAFA 2M1XA 4Q02A 2F1HA 4X65B 5EBLC 5FAXA 4ZKEA 2IU0A 1TMKA 1MEEA 2WG1A 4HYQA 3GP8A 1NUTA 1S5PA 2O4UX 1ZNQO 3ILYA 3KB2A 4RA6A 4YEDA 5DHAA 2FZKA 5JNLA 4HY3A 5I3ZA 1S7GA 2QT1A 1AH2A 1YDHA 3QHPA 4DLLA 3S1SA 3ZWWA 3TDKA 3BWXA 2WRZA 3DVAB 2X15A 1Q11A 1H8EG 3DL4A 2CVPA 3R6TA 4LXGA 4TRRA 2O8DB 2VSOA 1I80A 3BN3A 1GUYA 1RMYA 3BREA 4LQ4A 4MYSA 1EUDA 2KMLA 4RD2A 2R00C 1EZVH 1VPLA 2ZVYA 5NULA 1CY4A 2GWHA 1BE8A 2PRYA 3WGLA 1XMOB 3EJWA 2LIVA 3PAFA 2VGNA 3BCUA 3G8CA 3DHEA 4MAFA 4MUIA 4OP2A 5TF4A 3USCS 4BQQA 3PTLA 3T3EA 2NZWA 3V7NA 1COMA 4PA7A 2IHYA 1T2NA 2FGJA 4L9WA 3HXPA 3TD9A 1T2FA 1XDSA 4PE5B 1K33A 4Q4HA 1OYOA 4Y1RA 3STYA 2NQ8A 3HWWA 1VCNA 2GTSA 1RSOA 1SY7A 1KMQA 3GC6A 4FFVA 4CL8A 4V0ME 3AVVA 4K9NA 2GBLC 3AZOA 3Q2OA 3VBCA 1A69A 5ITVA 1W4CA 1BQ4A 1UJWB 3C14C 3OKPA 4QARA 4LI3X 4PYJA 2IK8A 4L4UA 4ZZ1A 3BT7A 2XVAA 4ND8B 3E05A 1ODFA 1QX4A 4FLMA 4KPUA 4MGKR 1QYVA 3I39X 4JR2A 5FHQA 3TKAA 1D2HA 2GZ1A 4D44A 1VQ7F 4W9MC 3F4LA 3SC2A 2PX6A 3FOEC 2JFBA 2ZODA 2OM6A 1TU3A 1KL7A 2ZJ4A 3LUBA 5E1MA 3RRBA 5F9HA 5B3SC 1U2SA 3B1JA 1HK7A 1KSJA 1OBOA 2VRCD 4Q93A 1NJ5A 2H16A 4NIMA 4WXEA 3WGNA 5D2CA 3RAJA 4HO1X 3VI3B 4A03A 4P84A 2IVZA 2Q3HA 2AI3A 2QY6A 1P8JA 3SC3A 4OLBA 1LPBB 4RTMA 3D8BA 2PRZA 3W1VA 1FVHA 4RK7A