3JATB

Cryo-em structure of gmpcpp-microtubule (14 protofilaments) decorated with kinesin
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 153
structure length 426
sequence length 426
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jatB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jatB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jatB01
4FFBB 5CA0B 2GVIA 4X1IB 3R4VA 3JAWA 3N2KA 1FFXA 4HNAA 3RYIA 5CA1A 5LA6A 3HKDA 5CB4A 4U3JA 5JCOC 4O4LA 5KMGB 4KWEA 4M8IA 4DXDA 3ZBPA 5IJ0B 5J2TB 5JH7B 3C8LA 5KX5A 3RYCA 5EZYB 4B45A 3HKEA 4ZHQB 3JATB 3RYHB 2BTQB 3WGMA 1FSZA 4TV9B 3JALA 2R6R1 5CA0A 4TUYA 4X1IA 5LP6A 1W5EA 4EI7A 4O2BB 4E6EA 3N2KB 4I4TB 4EI9A 4X20B 5C8YA 4B46A 5GONA 5CA1B 5CB4B 5BMVB 5FNVA 4O4LB 1TUBB 4F6RB 5MN4A 5EYPB 3M8KA 5ITZB 4I55B 4X1KA 3HKEB 4ZHQA 4O4JA 3ZBQA 3RYIB 3WGLA 5LA6B 1W5FA 4DRXA 2XKAA 3N2GB 3VO8A 5LP6B 1Z5VA 3JARA 3JASA 4X20A 1SA0A 2BTQA 4LNUA 4ZOLB 4O4IA 3JALB 1TUBA 5EYPA 5JQGA 4EB6A 5ITZA 4TUYB 4I50B 1W581 4X1KB 4ZI7B 1W59A 5LOVB 4O4JB 4I4TA 5C8YB 5GONB 3JAKA 5BMVA 3HKBB 5LXTB 5FNVB 4X1YA 4F6RA 5JVDB 2Q1YA 1W5AA 4TV8B 4DRXB 4O4HB 2RHJA 5IYZA 1TVKB 4I55A 3JASB 1SA0B 4LNUB 5JCOA 2VAMA 4ZOLA 3UT5B 4YJ2A 1JFFB 5LYJA 4IHJB 2R751 3RYFB 5IJ9A 5JQGB 3CB2A 3E22A 3N2GA 5EIBD 1OFUA 3VOAA 1Z5WA 2XKBA 4U39A 5J2UB 3VOBA 3VPAA 4ZI7A 2BTOA 2RHHA 4XCQA 5LP6C 3JARB 4WBNB 2VAWA 2RHLA 2VXYA 2RHOA 4O4IB 5JVDA 4IIJB 4TV8A 1RQ2A 3VO9A 4YJ3A 4EB6B 4O4HA 3HKCA 4I50A 2VAPA 1TVKA 5LOVA 4EI8A 3RB8A 4YJ2B 3UT5A 3JAKB 1W5BA 3HKBA 4U3JB 5LXTA 4X1YB 4O2AA 3E22B 4FFBA 5MN5A 2Q1XA 1RLUA 5JH7A 5IYZB 5KX5B 3RYCB 3JAWB 5M7EA 3WGJA 3RYHA 1FFXB 5MN6A 4HNAB 4TV9A 1RQ7A 1JFFA 3HKDB 5KMGA 5LYJB 3WGKA 4IHJA 3ZIDA 3RYFA 5IJ9B 4YJ3B 3WGNA 3HKCB 5IJ0A 5J2UA 5J2TA 4O2BA 5EZYA 5EIBC 3JATA 4WBNA 3V3TA 3M89A 4IIJA 4O2AB
chains in the Genus database with same CATH superfamily
1V1JA 1AHNA 4PI2A 3KXDA 4M1MA 2JIRA 1KD1H 3OTOB 1XV2A 1HLGA 1V71A 4PCLA 5ALJA 3SZRA 1FLDA 1G6OA 2QENA 3WL3A 4IDAA 1QQ5A 4Q1DA 1J7KA 2BBWA 1KVRA 1Q1ZA 4MRNA 1DL5A 1HYQA 1T9ZA 3R4CA 3Q87B 1YB5A 2QTVA 3K6KA 4R7GA 3VQYA 4NH0A 3HKEA 3RYHB 1GTG1 3P2JA 4FZ0A 1K7SN 1Y4DE 4EDHA 3QEMA 1GZDA 1T4BA 1XU4A 2AOVA 1QYWA 2P6JA 1U5AA 3GQBA 4AJEA 3ESDA 1H0HA 4Z0PA 1ENYA 2XWBF 2W7TA 3QMMA 3HN6A 4NAUA 3RVKA 4DLSA 2ZYTX 3R5FA 4DQLA 5ITSA 4EF5A 3H2GA 5EXSA 2GJSA 5IULC 4JB0A 1A5SB 3C3BA 2GM4A 3N07A 3WTCA 3LSQA 1G17A 4OHMA 2DPMA 2IEZA 3CG6A 3HWWA 4J0DA 4L95C 1DDGA 4E31A 4BWAA 1K5PA 1N32B 1Y3HA 2VDRB 3PGVA 2ZJ5A 3PUJA 4KMSA 1KSGA 2JVKA 3M4XA 3ZIAG 2WMNB 5EJMA 1HDZA 3CF0A 2XRZA 4XYMA 1WXEA 1XLWA 4JI2O 5EJ6A 5DCVA 4CKZA 1HDYA 1FJXA 3IMPA 3IHKA 3M9WA 1HNWO 4ISBA 3MYRA 4IIHA 4BP8A 4BNGA 3FRJA 2XOKA 4YAEA 2XQIA 3E9MA 3T0IA 1GN6A 3V6MA 1ZA1A 2DUJA 5LHIA 4UTRA 1AKEA 4CIAA 3AKCA 1CDZA 2QN6A 1C2YA 2QBYB 4ABTA 5IRCD 2WC1A 3IDSA 4XZ3A 4G4SP 3FDIA 3MG9A 1VSQA 1YDWA 2EFGA 4WY2A 3EG9A 1GZHB 1QDEA 3QY9A 3HCDA 4YP5A 2XGOA 4KR0A 4RJ2A 3TRDA 2XCRB 4WKOA 1ZR4A 5I45A 1F12A 4I8XA 5ECDA 1D6MA 2H1WA 4LEIA 4ZGBA 1Q57A 5DU2A 1GWNA 3WDLA 5HX7A 5BXYA 1QFJA 3HP4A 4FLXA 1Q1QA 2F4NA 3B6KA 4JVLA 1XMQB 2GD6A 1BW9A 2XUFA 1KTVA 1WQ1R 2Q5JA 4ZCSA 1B3BA 3PV0A 2DVMA 4EB8A 4X8HA 4BJ1A 2IM9A 4Y18A 3EDRA 5TQ0A 1NUPA 4F93B 4Q24A 3ITKA 2FEMA 4FZ1A 3JZAA 2NSJA 3SF8B 1RLMA 2A5LA 3PP8A 4CGYA 4OUDB 4HO1X 5DHAA 4MVYA 2ZIMA 1JPNA 2F1MA 1KJWA 1W4CA 4C4RA 1XL6A 1LPOA 1KZ9A 2B33A 1T1IA 1WCYA 2DWDC 3LQKA 1N2CA 1N9KA 4YUAA 2CVOA 2WM8A 1IX9A 4JFRA 4KODA 1J1IA 1SU7A 4MOWA 2PMPA 3SNHA 1XXLA 3UN1A 1XPRA 4BX3A 3DOIA 1DG9A 1SBQA 3NW9A 3PFGA 4KAFA 4DBLE 2VPTA 6YASA 5F7ZA 4MZDA 4DGSA 1RADA 1W25A 3LT0A 3GLFA 3NETA 2ZIZA 4PSUA 3Q2OA 1L3BA 3AV0B 5D3QA 3E9YA 1HOXA 2CNDA 2R8EA 4YCDA 3TOZA 1YS4A 5BN4B 1RHJA 2A5DA 3K72B 5EQDA 2BEVA 3WSTA 4CKBB 5EZYA 1C0PA 1WR8A 1ZICA 4MV4A 4F8EA 4FONA 3CCVF 3VH3A 4S0XA 2G04A 1SIUA 4WFJA 3DA8A 2FSSA 1K88A 1X9HA 2EULA 3RTAA 4Z1MD 6REQB 1PIWA 5CN0A 3WYNA 1H8HA 1AURA 5B4TA 1JHYA 4EUHA 2I1QA 3JVIA 4MGEA 4G28B 2DKFA 1NJSA 1OMOA 3KYIB 4PO1A 2E0IA 1A9QA 2OZBA 2YWGA 3IQFA 5DP2A 2D8AA 3V55A 1W44A 4D9EA 2CSUA 3FTQA 3QSGA 3JVUA 1M54A 1SXJA 5CU7A 2ID8A 4WZBA 2RGRA 1U1CA 4G0PA 4RU1A 1Z06A 1DOAA 4L22A 3HPQA 3UFXA 1JFTA 5CX1A 1YRAA 1YIJF 3T7DA 1QO0A 2W8BA 2VNHA 4MGZR 4B2PA 3Q0EA 1G5RA 2IXDA 4D43A 4IJKA 2HWWA 4J7CA 2HLPA 4AKGA 3MWDB 1QFZA 2W6OA 2G17A 1JIVA 2R62A 3CIFA 4MA5A 2Q3CA 3C6BA 3KAKA 4NZYA 1FRVA 4G97A 2I3ZA 1E8NA 4FJ2A 4U02A 3TR0A 4Z5XA 4PLWA 1SHJA 4MR8B 3E20B 2BI8A 2H94A 3D81A 4RZUA 1QYIA 1MV8A 2XJ4A 2WQZA 2C4MA 1WHTA 1OX4A 4O5AA 4OAPA 3PENA 1OU0A 3OP4A 4ND1A 4G4YA 5EMNA 2YWRA 4JP2A 3S28A 1FP7A 1KHHA 1VE9A 1JN0A 1NM5A 1N0VC 2C4HA 2QPLA 3N58A 5B1OA 2YYEA 4QXMA 4GZ5A 4BVEA 3G9QA 4OUKX 1MJFA 1H9CA 1W2HA 3GVPA 2WYOA 1YJNV 2B0CA 5CNJA 4C9BA 3SYPA 2P8SA 3HR8A 2GLUA 4PAMA 4ER5A 4ESVA 3ZVNA 2V4ZA 3CIOA 1KIAA 4QKQA 4FOPA 3I8XA 2G0NA 3FKSD 3AFGA 4QQRA 3A8TA 2OO5A 2DC1A 4LNUA 1KJ9A 2FLVA 3PIIA 2YUAA 5J40A 4S1NA 4LZLA 4XGIA 3M7MX 3V4DA 5KTPA 2QVCA 2BM1A 3AOGA 1CS0A 4XUCA 5DGIA 4BRUA 2EGGA 1N2GA 2OFFA 4BAUA 2Q45A 3FD6A 3NFRA 3PPVA 4I2NA 3HWSA 5AXBA 3CCRV 5T3YA 2CGNA 2VATA 3JU3A 3SEAA 3BJIC 1Z56C 2QP4A 3HXKA 4LV8B 2MCFA 1LJLA 3RS0A 1BT8A 2HMTA 3CEJA 4TWBA 5FX2A 1YIOA 2P1RA 2HMVA 4Z4GA 2Q9BA 3OQJA 2BGUA 3QNWA 5BZBA 4MEAA 4MUJA 1SCIA 1QGED 3RKRA 4D42A 4E4EA 3D0KA 4MVJD 4ZO7A 4YAIA 4JKOA 3WRWA 3K1ZA 2WA4A 3KM0A 2ENWA 3L0IB 3QBJA 2PO5A 4FYJA 4TSKA 1I6MA 3ED5A 1Y9ZA 5J2UB 2HXSA 4RETA 1N75A 1W36D 4YV7A 2YIBD 4DR5O 4QPJA 3FCSB 5HKOA 3SZGA 2PEZA 1EM8B 2VXYA 3AILA 3RA5A 4IVRA 1OT3A 3D7LA 2Q6VA 1FJ2A 4MQUA 2LW7A 1BXRA 4TPKA 4WECA 5FPYA 3HS3A 1HT0A 3HCNA 4YAGA 3TS1A 3DV0B 1TZJA 1V7PC 5HJ7A 1ZIPA 3FNIA 1W8DA 4N7BA 2QTOA 2X0FA 1AKNA 2EHDA 2R8BA 3A2LA 3D7MA 3I23A 2Q1WA 5CVVA 3RV4A 1X2BA 1DV2A 3KQUA 3GEDA 3PQDA 2UUBO 5E8RA 3M5DA 4H0NA 5GV7A 1QHNA 2UXDB 5IYZB 3EBPA 1V54C 1KQOA 4AZSA 3HA2A 2YEVA 3DLBA 4Q3OA 1M72A 5DGXA 3MRSA 2E82A 2O6LA 1E8DA 3V97A 3EHBB 5FPHA 3SDZA 5IVPA 2AMTA 1SM4A 2J31A 4YC7A 3RSLA 4ZT6A 3IAS6 5KYWB 5L7YA 3LWVC 5IAKA 5J4HA 3SYLA 1CZLA 1E89A 3FPCA 1G9XA 2IP4A 2IXGA 1SU8A 3NBAA 3GOQA 5CPBA 5CT5A 2OB2A 4NS4A 5D8DA 5IM4A 1AT1A 1NJ5A 2DBVO 4O8ZA 2WLIA 2HFEC 4B3XA 2JKYA 1QBGA 3ZZ1A 3CCLF 1AGRA 1B76A 4C20A 3P9YA 1I7FA 3LQFA 2P7HA 2CJFA 5T8KC 5CLQA 2C54A 8ABPA 1VHWA 1R4MB 3PAFA 4X7BA 2PKQP 1NY6A 2F17A 2I4LA 3FZQA 4MRMA 5AK4A 1V5FA 2L42A 3OP1A 4YRAA 2XVZA 2D06A 5E4JA 4WUVA 1R66A 1FFWA 3WXMA 3FETA 2V6IA 4KWHA 1WDWB 2Q4DA 1N6IA 1T8TA 2IYWA 3I3OA 4F84A 1DZIA 4KDFA 5HA5A 2IJIA 1ADYA 2NU8A 1GKKA 3T9BA 3WYEA 1VQOV 4ZICA 2BSQA 3F9RA 2ZRIA 4ZHQB 1EWKA 1MOPA 1LR1A 1H2NA 3MINB 3N8IA 1GA1A 2BTQB 1XNHA 4Q6WA 5DIZA 1G3MA 3ZD8A 1M5IA 1C8BA 1DQPA 1U3GA 4ZVNA 3SLKA 1VF5B 3ROGA 3GD7A 4Q4CA 4PV1B 1E6MA 1Q5OA 2R7AA 1KECA 4MSWC 1MORA 1T36B 1WB6A 1XRNA 2FK8A 3MJSA 3U3DA 3UCFA 5L4SA 3MUNA 3LV8A 1LBQA 3NR7A 5THXA 3OIWA 4LMAA 3D2AA 3EFOB 3WL8A 1C5KA 2PA0A 2XE6A 3VYSB 4HNGA 5HM8A 1HFJA 4Z51A 1AP6A 1VGVA 1Q6ZA 1CY7A 1XCLA 1GM5A 1JLHA 4ZHYB 1CS4C 2DTXA 2GM3A 2WU8A 3CTMA 3Q88A 3VI6A 2PMKA 1P1RA 2Q5CA 1JS1X 1JAIA 1V43A 3EQ8A 3R3YA 3ROZA 2YUIA 1XZNA 3NGXA 1SOAA 3CGGA 3NNSA 5KTOA 1WZEA 2JAOA 2DN9A 1DRUA 3DGEC 3L6UA 4QJ5A 3SMQA 2AK3A 5FJJA 2YQZA 5ESWA 1YOVA 3KQNA 1O6FA 1RW4A 3F6SA 4MV7A 2VYNA 3W79A 5ALIA 1A7UA 1I32A 2D0IA 2JFZA 3NB0A 4XOIA 5IDQA 1BJTA 1Z6PA 2B9ZA 1T9KA 2WG2A 4FLVA 2XCLA 2GASA 3M83A 4QYXA 4AZTA 3UMFA 5JWHA 2A9QA 1AMUA 4JSYA 3THYA 2CXRA 3O3MB 3TO5A 2G82A 5TLSA 3LG2A 3GLHB 1ES9A 3L4KA 4NV0A 2DX7A 4BLTA 1R7RA 2EFJA 1NTRA 1TJ5A 4PFSA 1NBWB 1E7RA 4EFNA 5DEOA 2G5CA 4HUJA 1EVLA 4K3UA 5DTEA 3BIOA 1G19A 4NF2A 4LECA 2HS3A 3PFWO 3FMPB 1ID1A 1EB9A 3CEMA 4BKRA 3RUCA 2NU7A 3D6JA 4P3XA 2QW0X 2IY7A 3F0FA 4RDXA 1J21A 4WZZA 1BGYH 3FAVB 3QUTA 4M89A 4Z9YA 1JFFB 1QIDA 4U00A 4EJSB 1H2EA 1Q43A 1P7YA 2C5FA 2YFKA 4QEDA 1FXKA 4RVNA 5ECWA 4HDMB 4E15A 3SWWA 2Z1NA 3H1AA 2FRXA 3BSYA 4M83A 4L6IA 4BVQA 4YQEA 2JIZG 1BE0A 1NVMB 4Y2PA 4WKBA 5LXTF 3I45A 4BCCA 1LB1B 2HZ7A 4AY5A 2WVGA 3CNEA 5AK5A 1FDOA 3S55A 1NKSA 4LBYA 5A03A 2JJ2G 1G5HA 2AW3A 2FFAA 1MG5A 3HFGA 5E3IA 1YF3A 1QQAA 4EIWA 1EFDN 1JI3A 4NULA 3S81A 4I55F 2VCYA 1HNWB 3TI7A 2GZLA 5HXUA 2GF0A 4G4XA 3VVMA 1U1GA 4DR7B 2G40A 1YO6A 3D02A 3GF4A 3HYRA 5PGMA 2B9VA 5LDHA 4HG2A 1QK4A 1VJGA 5BYAA 2RHTA 1Q6IA 4I7ZB 1C2TA 3AUKA 3WZ2A 1XRLA 1P9RA 1B2RA 2H4YA 3LVFO 4E5VA 1ZW1A 1JIXA 2H4WA 3ENVA 3QV2A 4GKKB 4FFLA 5KYTA 1GJRA 3PUZA 1QMGA 2CE2X 4YP6A 4A0FA 2HPZA 2XTAA 3RYFA 1BMFA 1ENZA 1I1OA 3ND7A 2W11A 2Q5EA 4D44A 3EJ6A 1JH9A 4KXFB 4PNHA 3OOSA 3M99B 4IFTA 5DFAA 3CZ4A 4AWBA 3PNBA 4E33A 3MMNA 2O2CA 4L2IB 1AVMA 3OPYI 1GGVA 3OJCA 2J6HA 4FYPA 3SIVA 4OI1A 1AR1B 4CKWA 2EZ9A 5IT9A 3Q2IA 1V8FA 3IT0A 3ZWXA 4F8YA 3MDSA 1EVJA 5BSFA 3N76A 3EXHC 2QX6A 1N4DA 3APOA 2QY9A 3N6XA 1T1EA 4LW8A 4W6ZA 2KYRA 5F4BA 2M9MA 5EWMB 2PZAA 1E2IA 1GADO 1PHRA 4KJZA 4UMEA 5HPYB 5CLLA 3DWIA 1NQVA 4RWZA 2QTNA 3K0HA 2M2IA 1GTL1 2Q0OC 1GKYA 1UXKA 2QQ0A 3FPKA 3ICOA 4LHEA 4WASA 4AM8A 3CRW1 4LZNA 4BB0A 2Z2JA 3L6BA 4JJ4A 2QMEA 5BVHB 2GDZA 2X0RA 3TR6A 1ZUIA 3FMFA 3JWIA 1M34B 2XMDA 4IDQA 4BNDB 5K6TA 4X1IA 3CH4B 2OLEA 2SICE 4GNKA 1ICEA 4ICGA 1AO3A 1OBCA 3PITA 2QAJA 3CW8X 1AR4A 4WAUA 4KN6A 5ES4B 3UAYA 1MRNA 1IB0A 1V8OA 2AHYA 1X8JA 4C6TB 3C85A 1TUBB 3BTSA 5DLPA 1MEJA 4MRRA 3RSZA 5B7PA 2EX3A 3BAFA 3KQPA 1F4MA 2A0XA 3NEPX 1M2VB 4BPRA 1E63A 2O20A 2PMBA 2X8JB 2Q3LA 3HBLA 3LCMA 3LYHA 4NX2A 1L5RA 3SOZA 3WWZA 4E09A 5I7SA 5F2OA 3S3XA 1VIBA 1E69A 3GRCA 5CPFA 4NZ9A 4ZIRA 2GLXA 3BTUA 1NXTA 2O5EA 1NVDA 2COEA 4X3OA 1LBSA 1E9DA 3R74A 3ZK8A 3OJ0A 2NO1A 3CNQS 2HDOA 1BVYF 2DBYA 1PT9A 3GXOA 4HEJA 5BSRA 4YV1A 3DZCA 3PXDA 3T06B 3WFIA 4XPZA 3CFYA 4OUDA 5BXZA 1L4MA 1QS0B 2D4HA 1C9NA 2BGNA 2H2DA 4FJ0A 4JUIA 5B1EA 1RP3B 4AQ7A 3IO3A 1M93A 4TS3A 3VO2A 3UQ8A 1R6NA 3EVAA 1SUDA 3EORA 4D02A 5BMVA 2ET6A 2OGTA 3H1LH 3PE4A 1Z4QA 4L8FA 2NU6B 1OPRA 1UP7A 2BGJA 4F04A 2XXAB 1ZRHA 4J7ZA 2ZUEA 4NTXA 1NYTA 2ZSAA 3IVMA 3EVKA 2FJPA 3BL6A 1E1RG 1Z5UA 5B3JC 3KQSA 4FYYA 3UOGA 4DR3B 2EKQA 2WTMA 3U3RA 4NXNO 1J2JA 1TPZA 4I1UA 3H11A 4ZXPA 4B8YA 5FULA 3FYHA 1I94B 2A0UA 3ADKA 2I1VB 4KQEA 3I09A 3TW0A 4O4IB 4W82A 5LUBA 3CXCF 4EO4A 1QO0D 1VZ3A 3SLRA 4C03A 5JMWA 3PX7A 1PM9A 1NW4A 2WV7A 3BCRA 5TT0A 1U0SY 4RBNA 4DLZA 5A4DA 2GN8A 4LYDA 2EP7A 1KJQA 2ON6A 4AX4A 3N87A 4EKWA 1JTVA 3PJEA 3E05A 2QJFA 3HBFA 4CODB 1I01A 4PSKA 3DAYA 1UBJS 1V3TA 3NVDA 2G77B 2RGAA 2Y1OA 4J16C 4EA7A 5HYVA 2P6UA 3GRAA 1S2OA 1J1ZA 3GJ6A 1DAOA 3RUFA 3NAQA 5L3FA 1G8FA 4RF5A 5A7HA 3T94A 3SPJA 2GEBA 2PH5A 3RYTC 3HJCA 2IHZA 4XDKA 1JR3D 1K68A 1NG9A 1Q95A 3PUYA 4BZWA 4X3PA 4R01A 2EBOA 3ZHQA 4PGHA 4PVDA 4GP6A 3AF1A 1XZHA 5A9SB 2C2ZA 4IIJA 2JBWA 1Z8HA 3X1YA 1SC5B 1E0KA 4XJVA 1UPCA 4OGKA 1OAOA 1V45E 2RI6A 3W3AA 2CF6A 3HN2A 4FZRA 1Q92A 3W04A 1OX6A 4IDGA 5C34B 5U4QA 4O25A 5GTDA 4EVRA 5CEJA 2ZSEA 3KSZO 2WFAA 1H6BA 2P5OA 3DD5A 4LDRA 4PLPA 1BCRB 4Y9RA 2VF5X 3OQOA 3Q8XB 4RTMA 3FOWA 2ZW9A 4WACA 5ALOA 4AMGA 3HJHA 4DMMA 5K3EA 3T1OA 1OWNA 2O54A 2ACWA 2QS9A 4BBZA 1NZFA 1C9DB 4ZEOA 1XL4A 1WD7A 1YXBA 1IU9A 1YR2A 1I5EA 2UVDA 3FWZA 5FWYB 2UZ1A 1BD3A 2HB6A 2WJ4A 8MHTA 4KNVA 1Z22A 3U81A 2H7VA 4XD7D 3X44A 4O4LB 1Q50A 2Q1SA 2Q46A 2QROA 1X8KA 3JZMA 3ANNA 2BTEA 1W4BA 3JTMA 1UAYA 2IU3A 4RXUA 1DAFA 4QA9A 1EE1A 4X1KA 1Z75A 3WJRA 2ZCEA 1NIJA 3ISVA 3ZRWA 2ENUA 2JGRA 2AQHA 3KC2A 4B84A 2QX7A 3DTVD 1MAHA 3JVEA 1U9JA 1V8DA 1XTVA 4DRXA 3BB1A 4OIMA 5ALZA 4BVLA 5AW7A 5JNRA 1XXHB 2Z57A 3G02A 4RA9B 4JI5B 2C92A 1U2RA 1NYRA 3ANLA 2LGQA 1DADA 1IQUA 4OL0A 3QK7A 2VH2A 4RF2A 5DO9A 4ZJYA 2HLHA 4Q7QA 1DGQA 1JQAA 5IY5C 2FH5B 2Y71A 3F8SA 3ND8A 3QHAA 3E7FA 2OBMA 3EOAI 3I0ZA 5FFFA 3PX3A 1W581 3TLAA 3ZIUA 1SUCA 4R41A 4JVMA 4KUGA 1XUOA 1NL3A 1GXSA 2YYYA 4NJEA 3RT1A 2BI7A 1W5AA 4RFVA 3G2IA 3AM4A 5DI3B 3UK2A 3C87A 5BMVF 1W2BU 3OCJA 1DKMA 2DQYA 3EVCA 4BTVA 1GEEA 5JISA 1OIXA 1BMDA 1H0KA 4ZU6X 4OMCA 4FN4A 4ZAZA 3ZWPA 1VIDA 5K7SA 1Z74A 3GX1A 3ZY5A 2VOEA 1FDWA 1KI6A 2WSIA 4ZDKA 5C81A 2TECE 4DDTA 1Z5WA 3A7EA 3CRCA 4JI1B 5DHSA 1PTJA 2IDKA 3O8OA 1RZRA 4JPRA 1KR2A 3R40A 3TQRA 5EIFA 4ARCA 1NUUA 2WQ6A 4JC5A 1TLFA 3WIEA 2AYYA 2VP9A 2B4KA 4XIYA 1ZGAA 5CITA 2EF0A 3TTVA 3PXEA 3RHSA 5KTSA 4XUEA 4US0R 1XCBA 2EX1A 5TGDA 3VC3A 1KEKA 4EH1A 1SCUB 2Y6UA 3F98A 5ENVA 3COZA 4B87A 3QG5A 4WCFB 3FAKA 2IXFA 2IAFA 4KAAA 3CMEV 1NQWA 3OO0A 1OJHA 1DG3A 3BFPA 4RDIA 1D5AA 2GSMB 1M6EX 4MGIR 3JR3A 4JLPA 5MN6A 2JH8A 3P5SA 3QWHA 4PO9A 4WADA 3U80A 1I24A 3KUDA 4GOLD 3CC7V 4TTPA 3E9ZA 2V7EA 3HEBA 1P77A 3BK1A 3OFNA 4L5JA 2WIFA 4C4AA 3DLHA 1HURA 1Z7YA 2HMSA 2XMGA 4K1LA 4O2LA 5LOVF 1BQEA 3IYLW 2MR6A 2CXSA 4M8SA 3OUTA 1SELA 4PI0A 3K5NA 2JGDB 3DL7A 1W0JG 3AL2A 1C4KA 1F2UA 1AR5A 4KYVA 4UHJA 1K7FB 3SZOA 3TTTA 1H3FA 1D4ZA 3L92A 5GVSA 3LA8A 4WOPA 4REOA 5H2FZ 4J9UE 5LQKA 1VMKA 2Q3BA 1ZFNA 3DMYA 2C82A 3AINA 3VM6A 5L3SB 3R2JA 1VMDA 4DLLA 1W4RA 4M7PA 3R75A 2ALJA 2ZR8A 3MJHA 3CVYA 2MIIA 1HQCA 1Z2PX 4Q39A 5LZ2A 3TRIA 1JIIA 3LYLA 5HVNA 4RQEA 1PLJA 3I04A 4QHYA 1YJBA 3VR6D 2X0JA 1FSZA 1BDMA 3CN7A 3DZDA 3F4KA 4LE1A 3A9CA 4PGAA 4PM4A 4QBIA 4R1OA 4RK0A 4W1QA 5I3CA 3MWGA 3KQKA 4HXEB 3HUTA 3MTQA 4C29A 3OCUA 2HNKA 1TK2A 3PSHA 5KNCA 1XT6A 3EEYA 3NVAA 1EWYA 1KA9H 2G9IA 2HU8A 1I14A 4PIMA 2PMCA 4RACA 1NVWQ 4XVRA 4B6PA 1J8QA 2FW8A 1M76A 1O5IA 4FU0A 1E7WA 1QF6A 2Z6AA 2PUGA 3JZFA 4P0TA 1UK8A 1KE1A 3H2KA 1XIVA 2FZEA 1NM5C 4H4CA 5FIUA 3TD2A 3QUCA 2Y0IA 1H7MA 2B8NA 3C5VA 4TKVA 3K6SB 4NXMO 4YXWD 3I01A 3UYKA 2P68A 3GCZA 4HDMA 1WMDA 5SYAA 1IPEA 4NESA 3NJ8A 4U7WA 5F76A 1T3GA 2F3SA 2Q4TA 3DOCA 4HEHA 1DEAA 4N6GA 1T4DA 3R0PA 1VQ7F 3HAXD 5I7EA 1NQAO 3IE0A 1CYDA 3FOCA 3M1AA 2AFHE 3L6EA 4KGVA 5I4BA 5IJZA 4HZUB 5FTWA 3G85A 3G6KA 2I2WA 3T5CA 4IXDA 1J0EA 5HK9A 1KAQA 3FNHA 2WF5A 2P69A 3O9VA 5LHGA 3MJVA 4OB7A 2PX3A 3WOVA 2QR4A 4Q1VA 4K35A 2OECA 3VHXB 4JC4A 1WHSB 1AQIA 4DIBA 3Q1KA 3DZFA 3GEGA 1VCNA 1LNZA 4C81A 1YI1A 2X1LA 3A4VA 4KK3A 1T26A 4TL7A 1ZCZA 4IRXA 5EO3A 3S2FA 2UVQA 4TKUA 4LWSB 5K09A 2YXLA 2B35A 4FE7A 5CRIA 5H0IA 4KR7A 3LC1O 2X8LA 5EHIA 1ZWLA 4FZVA 4A8HA 4FEYA 2RH9B 3RADC 2NUPB 5K6AA 1I80A 1JXMA 4IUDS 4J3FA 3EGCA 4EZEA 3KV3O 2RHOA 3HJWC 2UDPA 5E2IA 1ZIYA 1L7PA 1KU9A 2P6NA 4DBVO 3SC6A 4OHWA 1LRLA 4X91A 4XD7A 4ZV9A 3AVUA 2UXNA 1I08A 1HT3A 1ZS9A 2X58A 3VISA 4V0QA 2P9QA 3F90A 4UULA 1YVDA 4C3VA 1VQ5V 1AUOA 1R3DA 1JDJA 1WP7A 2OHHA 5KEIA 2VSFA 4ZT4A 2FWAA 1WSWA 3E82A 4J76A 1O97D 3O9MA 3WISA 2ZJZA 3ZCRA 2ODTX 4EEQA 4TKZA 1U02A 5KUKA 1GP2A 1D8AA 1JECA 3FXAA 3LT4A 1IQPA 5U9CA 1IEXA 1AP5A 1UBSB 3FUTA 3BKXA 4BUJA 1GZ0A 1XP5A 4FEEA 4GE3A 4RWEA 1QQCA 1Y0BA 2PTGA 1PFUA 3D6NB 1UT6A 1OCEA 2DQZA 3D8NA 3KAJA 4TKLA 1XJQA 1RWNA 2DYSB 3PXXA 3LBAA 1WP9A 3K70D 4C43A 4X93A 3A3YA 1E7KA 1R0RE 3KFVA 3HBNA 1J5EO 2ZF8A 1XROA 2OV4A 4Q7MB 1H8ED 2J1LA 1YAJA 2VZLA 4NXNB 4B7KA 4K6CA 4MS4A 5KOIA 2IU4A 3LLVA 5EMLA 3CCSF 2YDYA 1AI4A 1XJ0A 5B1AB 2YVKA 5TQVA 1AHIA 2GN4A 3GB7C 1FFTB 2AF3C 2H7CA 4Y2GA 5LPNA 1Y4UA 4XARA 3IT2A 4DFDA 5JPDA 2XLCA 3SX0A 2ZREA 2ZJBA 2XOKG 2C7RA 2HJFC 3KTFA 2Q07A 4ENUA 4YLYA 3MGCA 2QTZA 1CULC 2VEDA 2CH7B 1X86B 3TJZA 5L4LA 2E37A 2A5YB 2G7MC 3LDTA 4RHCA 4CDNA 2AZ0A 4Q0MA 4Y6PA 3ZLUA 2JHGA 4B4WA 2XEDA 4GI7A 5AI8A 3INRA 3ESQA 3RPEA 4NNJA 3AEIA 1SVUA 2AMJA 3RAJA 3TFOA 3G0OA 3MTJA 4GFDA 2EIKC 1JG4A 2FQYA 3V34A 5BMVB 1K34A 4E4YA 4PRLA 4KXLA 4B6EA 2I2FA 2NU6A 1OZGA 2VDOB 3K92A 4G86A 4Q21A 1ID8A 4RSMA 2VP5A 3ZI7A 4TOIA 3IBTA 5BQ5A 3ZYZA 2PSEA 1BMFD 2VQDA 2ZSJA 3KT6A 3VKHA 4NU8X 5J4VA 3QPWA 3SKYA 1KOGA 4QPCA 1OI4A 3ENKA 1WJZA 1T8YA 4ACAA 3I8SA 2I4IA 2Z8ZA 3AERA 2AWOA 3A05A 3CCUF 3KIZA 2YQ5A 4HDAA 4L07A 4DW0A 4G0YA 3MLBA 2JA2A 3KQMA 4O4IA 3SYAA 2PLAA 2CLIB 3JQQA 4QQFA 2Q2WA 5FL7G 2CLSA 5AOCA 1K1EA 5ALHA 1QAMA 2FN3A 4DDHA 3NVKI 5AG2A 1XNQO 1LV7A 2NYRA 1ZEMA 2G1AA 4RY0A 2C7BA 4DR6O 4AJLA 5HF9A 2PKEA 1EJ6A 3FR8A 3QSYA 4IIEA 4HL6A 3L79A 1U3UA 4DCSA 4RH1A 4ZN6A 3VC2A 1TJ4A 3R9KA 1Y1PA 1YL6A 3IEXA 1OXBB 2CK3A 3KPVA 1GO0A 1L0NH 3NI2A 3VDRA 4BQRA 1KEUA 4YMIA 3H75A 5AKEA 4LNUB 1XDZA 1ZISA 3DOEA 1UDWA 3SIWA 1BE1A 1X1QA 1MO4A 4RXMA 4L15A 1AGNA 4BE4A 2WE8A 5KVAA 3VQVA 5BYKA 4XCVA 3ZV5A 1INLA 2EKPA 4QU0A 4FPPA 1OXVA 5H9VA 3DOOA 3WGOA 5LP1A 3WP0A 4IHKA 2YXDA 3CF2A 1YR1A 3IA7A 1XDCA 1EQUA 5D2CA 3DO8A 4JI5O 2EKDA 3VSDA 2AG8A 3Q0TA 3RREA 4KLNA 3WLIA 1G5QA 1UXOA 3FIUA 2IUFA 1R4NA 2ZB2A 5CCDA 1H2KA 3DAFA 5LXTA 5L3CA 1YFZA 1JX9A 2BEWA 3O74A 1JJ2U 1QIFA 2Q1UA 4HFJA 5ALMA 1UC8A 3A58B 4NFYA 2C9ZA 3EGVA 4ZYYA 5KHLB 5AKGA 3FFAA 2BONA 5E9JA 3C4VA 1P91A 1UZNA 4EKDA 1YZQA 5ELXA 3QF4A 3O3NB 4KTVE 5D86A 1GPUA 3P30A 3JYCA 4JOCA 2QVXX 4EKIA 3ZQ6A 2WFMA 2W2KB 3WRXA 2XCTB 4MQEA 2A3RA 3EWIA 3SSOA 5FQOA 5GP1A 3AIKA 2QWPB 4LZWA 2PSDA 3OJOA 2H0QA 2X9QA 1Z8FA 4J2HA 2OZLA 4WCEV 4LYAA 1ESZA 2UVPA 3WGQA 2ZCVA 1G42A 3CD6F 1BRTA 3K0FA 4NCKA 1PJZA 2FPPA 2IP1A 4RKRA 3RDPA 4UVBA 3BRQA 1UBKS 2PAFA 4LC1A 3K59A 4Z9AA 4IEEA 2IJJA 1H2MA 2L82A 4LY3A 2HQRA 1XK7A 1U3TA 2AI2A 2RHCA 5IT5A 2X8BA 1YDHA 3HUDA 4DUGA 4MKZA 3CG0A 1XXHA 1XEQA 3PGXA 4ZI3A 2IJKA 3GEBA 4GQIA 3EQ2A 4QBTA 4IXMA 3CURA 1QD9A 2I29A 3E86A 3SJ7A 5A2GA 1PEKE 1Y8QA 3NIFB 3VR3A 5A5GA 3W8DA 1UJMA 3L46A 1W5EA 4W9NC 5JDIA 3CJHA 1CZKA 1SQSA 2CHGA 2X42A 3LD9A 3UMVA 3VZCA 4MRMB 1ZOLA 1ZJ4A 4UEOA 4NSNA 3EH1A 2JL1A 4PPGA 4XGQA 1U2ZA 1WXQA 1HY3A 4YQZA 3EMBA 2QAGC 5TQJA 3S1LA 1MC1A 4CV0A 4DEXA 2WLTA 1QYVA 1M0WA 4WGGA 1RM1B 5AI9A 2QKYA 2Q7HA 2XRFA 3HE3A 4WUTA 4WW0A 3VQTA 2I2CA 2DY1A 2QNRA 1KZ4A 2WWGA 1CEYA 2CE7A 2E5FA 2HS0A 1OPXA 2XKAA 1XMOO 2XDWA 4K28A 4U0JA 3O83A 4R31A 4LQ4A 5EXEA 2B7BA 1I5YA 5HMMA 4RW0A 3LFUA 2QN3A 2R6HA 1JIJA 4D9HA 5KNBA 2QW8A 1JXAA 1XRRA 1QXSA 5T3UA 2RCVA 5AKJA 2DR2A 1FTQA 2GBLA 1MJ5A 1VTKA 3NO4A 3SJAC 3P9XA 2QRVB 3AL3A 3VQXA 1T1JA 4TUYB 1ELOA 3KE9A 4G5OA 4RK1A 1BVUA 1DARA 4UB6Z 2I4RA 3O8BA 4Z0HO 1EHCA 4HJXA 4NL4H 1FMTA 4YEDA 3H16A 3RABA 1P8AA 3THOA 1U1FA 2DPYA 1QKJA 1M0SA 4PPYA 4RMNA 4YFYA 5HG0A 1IC6A 4D97A 2P2LA 3AESB 1J23A 3PX2A 4R9NA 4E14A 4GM1A 5FUYA 1KOFA 1PWXA 4Z54A 2RJZA 4WCFC 1B8OA 2VSXA 2PL1A 3AMVA 5LYJA 3E61A 4Q02A 3X1WA 5CFOA 1T29A 4J7XA 1II9A 1TGOA 1PUIA 3GLHA 3VYTB 5BV7A 3K9FC 2I91A 1SZQA 4LDPA 1HNNA 2IS1A 1FP6A 3GJXC 1QX3A 2O48X 3G23A 4ZHSA 1TUEB 3MA0A 1JV2B 2KSQA 4OYRA 3ZHOA 4JS0A 3AG2B 4UV9A 1GLNA 2QLNA 4MUNA 5H1YA 3CUWA 3NUQA 1VHAA 4BYMA 2JG3A 3K3PA 1BJRE 3T9EA 3S1AA 2CEKA 2X2OA 3RG2A 3C98A 2BT4A 3VH2A 4QDUA 2FG6C 2IYZA 3OIFA 5AM5A 1C8KA 2Q7OE 3MMZA 4AC9A 2JLCA 3TAUA 3PL5A 3F5QA 2UZ4A 1IVNA 1CV2A 2DMXA 4F72A 3NH6A 4RF3A 4ZGWA 5CTAA 5KVCA 1BL8A 3UMSA 1IPHA 3A1VA 4LF4B 1ZUNA 4DCGA 5FPQA 2ZGVA 3T5TA 3OMXA 1ZU4A 4RJIA 4J0QA 5G02A 1T4MA 2H1FA 1OHHG 2ZDGA 4PLTA 3GDFA 3LUKA 4DG9A 1XCMA 1G6HA 2JBHA 2CYBA 1SKMA 5GJBA 4Z2WA 1L4LA 1Q0QA 2JGIA 1WZ2A 2GUZA 4FM9A 4H60A 1S5LZ 1ODFA 4OFZA 4BNMA 4E7PA 5A1TA 5JS1A 4JEIA 4MLPA 4UFZA 4WZAE 4LJKA 3JAWA 1BO6A 1GVNB 5LQAA 2DM6A 2HA7A 4OPAA 1Y74A 1I1NA 4KR3A 1ZD1A 3GVHA 4O63O 3BILA 5T5QA 1B26A 1GN9A 4GZMA 3QBDA 2VYVA 3V4RA 4OXQA 1GZSA 1VKHA 2V59A 2R9AA 1ZSYA 3FPBA 4E6PA 1ADBA 3NTRA 2OORC 4IUCS 1M1KW 4KLAA 4M0PA 2BGLA 4W4LA 2WDPA 4JJFA 1WY7A 1M8FA 5I6DA 3AR4A 3UV3A 4P86A 1X38A 3GT7A 1KR5A 3C7KA 3IHWA 1PWYE 2B30A 3LQQA 4QDJA 3ROFA 2ZBFA 1WXGA 1KFBB 1ST3A 3OCVA 4EFLA 1J5PA 3IP6A 3IX7A 1JRLA 2P2YA 1XEAA 2VP6A 1SKYB 3MK31 2JDIA 2HK8A 1MZPA 2WALA 1R3UA 3R24A 4R2IA 3G13A 1W4LA 4EHLA 1J5EB 4TYWA 1KQFA 4G9GA 2FPGA 2ECPA 4FJ1A 2V4MA 4NTZA 5DH9A 2I99A 3BMXA 3D4LA 3T9AA 3DEHA 5IEJA 1U9IC 3NGLA 3C8HA 1TT7A 4EJ6A 1FBTA 5H5NA 1QJ4A 2WTXA 1V9LA 1A4RA 4OH1A 4YRTA 1ETUA 1S72V 3ZWWA 4DSAA 3W5JA 4G89A 5LQDA 2D6FA 1YASA 2H5LA 3T4EA 4LFCB 2O3SA 4LPSA 3FZYA 3PNKA 2NVUA 4PWTA 3PQ7A 3QFFA 4EYQA 3U5ZB 1ULTA 1LUWA 5DTMA 3PQCA 1AK2A 2X7XA 1FXWA 4ZVKA 5L40A 2DKNA 5FPPA 4ZYLA 4N5NA 4C2BA 4PZEA 3ZLVA 4IS3A 4JASB 1KGSA 1FYFA 3L7LA 4D8YA 4L4XA 3U7HB 4MW4A 4MCJA 3UJ9A 2ILTA 2QMUA 4KRXA 1C50A 4KMRA 1Z4LA 5FOQA 1OTXA 2PGGA 3RFFA 1DE0A 1COZA 3FKSA 1XBTA 4YP7A 3AF3A 1Q7EA 2J87A 2JCGA 4MUBA 4WNAB 4OHCA 4IHJB 2O2YA 1QPGA 5BSUA 4J9VA 3DFZA 3JYPA 5LQRA 3SR0A 2GYWA 1P4AA 3BORA 5AIAA 3BFRA 1LI7A 1FY2A 1TD1A 5ILQA 2CLOB 4ZWNA 4LXXA 2E4UA 1NH2D 1ETHA 1N0UA 3AG7A 1P2GA 1M8JA 2PX6A 3RVSA 3PJRA 5CG2A 3TOCA 3G6EF 1VQNF 3FI0A 2A5GA 4EB6B 1LDYA 1HDRA 5FTMA 1DCTA 3DDSA 2RNBA 2PTMA 2F9ZC 3FA2A 3VJLA 4EL5A 2HYIC 1ACMA 1QK5A 1Z0UA 2RHWA 3B5EA 1FLVA 5LOVA 5EJ2A 1UMBA 3GAMA 1E5XA 2KG7B 4POAA 4YRKA 3I2KA 4C01A 1QFYA 1W5BA 4HVTA 1IRIA 4WLOA 4X85A 1BHSA 1O96A 2I54A 4M99A 5ITWA 4MP8A 3SS8A 3X2QB 1FCJA 1GHTA 3LA6A 3ML0A 1PFWA 4GMKA 4BJHB 5D3MA 4ZPJA 2EFYA 1YRQA 2ILMA 4J1NA 5ALPA 3NDRA 4MRPA 4AI8A 1Z2EA 3NHBA 4EJ2A 1T9DA 3D5QA 1W40A 5HY1A 1VQ4F 1E0JA 2EFDB 2ALEA 2F1OA 3KU1A 2ZITA 4F2PA 5AM0A 4YX9A 3GDWA 4EITA 5BPFA 1DPFA 2I2BA 1SGWA 2DPLA 5JFTA 1MB3A 2GEKA 1JBEA 3JR7A 4MTLA 1O5OA 2GT1A 4XVQA 5FWXA 3WB1A 3RTCA 5KOJA 1Y5RA 2LVBA 3FSEA 3BWDD 1XZJA 3NX4A 4GXNA 3S0WA 4KX5A 5E0KB 3TSOA 3U3MA 1X7YA 5D6NA 2PWYA 4Z1MA 5AW6A 1C29B 1TNDA 4FXPA 2XMRA 1WKVA 2I34A 4YROA 3PFNA 3UJ8A 3GPDG 1UJ6A 2R7MA 3E9QA 3L05A 4QD3A 3RFCA 1ISRA 1T2NA 4O33A 4PZCA 1ZI8A 3SE7A 4H3KB 1D07A 4EUEA 1QPBA 1XTKA 4LHZA 1RXUA 2P22C 5TV2A 5C3MA 1LPAB 4G1MB 2CTWA 4YWJA 4B3CA 1AMNA 1EPUA 2YVQA 3W5CA 2O8VA 1OVGA 1DAIA 2H8GA 4QYIB 4I8DA 5HOQA 1FXKC 1CEZA 1UADA 3Q98A 4GBED 5LGNA 2XF2A 1FDSA 1J9EA 1XAGA 3FPGA 3V8VA 5LN1A 5DK6A 3X1MA 4G2TA 4J2TA 2AH5A 1MVOA 2B92A 3VTKA 4BW5A 3ZWBA 2DFVA 3V8PA 5FNVA 2OCIA 1YA6A 4IVPA 4P4UA 2NMVA 2GM5A 2AB0A 1XVAA 5EJ4A 5DEDA 1HORA 1R88A 4E21A 2GD1O 2ADPA 4O4JA 4YIPA 4D56A 4EG1A 5HGXA 3OZGA 1A77A 2OIGA 3AEQB 4IUYA 2GCIA 4RK4A 1R0LA 4Z8YA 5CFZA 4FM2A 3W34A 1W2GA 3TPZA 2IYRA 1U1EA 3UQYS 3X1JA 5ICGA 3QU9A 2W6ID 3ETNA 4EG4A 4Y1FA 1PV0A 2D2XA 1GL9B 1Z34A 5DCYA 3UHAA 1GPWB 2UZ1B 5A7FA 1RPTA 1T3LA 1X1AA 4RVDA 3ZRSA 1C1XA 2P6OA 2WSLA 3PQ4A 4IOJA 5JQGA 3UGQA 3FWNA 3WLLA 1ZVQA 1O4VA 2BEUB 1KDRA 1XWIA 4EMBA 2XE8A 1GFIA 2MOKA 1KRWA 3WWDA 1FNJA 2BOBC 3S99A 2M6SA 1S4MA 2IIBA 3TD3A 1DBWA 1E1YA 4DV3B 5LNK6 2BEWB 5HFNA 2H1SA 4G65A 1LY1A 1PDOA 1B43A 3KZCA 5EWRA 1S7CA 4B6QA 3B77A 5BYJA 2AZTA 3GJ7A 2C9BA 2HU2A 1Y82A 4NOJA 4KQMA 5JUWA 4C8IA 3QU2A 3TZCA 2H9IA 3IDAA 1VI2A 3OW2U 1RKUA 2QD1A 4FHCA 3ZHYA 1EG7A 1ISGA 1DQRA 2HJ9A 4CM1A 4WESA 5AQEA 4OHYA 1MRZA 4NJEB 2XB2A 4ARIA 4GC5A 5E6SA 1RABA 2VTEA 1OLSB 2UVPB 3AVPA 3DL0A 2H16A 3B6JA 4G1FA 4C8EA 4RMHA 1HDIA 4XWYA 5CK4A 5DASA 1Z2GA 1IN7A 1I7LA 2ZIXA 1Z28A 3RQIA 2VK4A 4M1TA 5LD2C 4AY6A 3KTOA 5SYNA 4DO2A 3QOFA 1L4NA 1K5QA 3CPWF 1ZXBA 1YVWA 1LX6A 2PUWA 2XY4A 3N6VA 4FMDF 3IVAA 1NNSA 4IEFB 2Q1XA 4XYGA 4F4DA 1U2TA 3SJUA 3O8OB 5FJ4C 3D4OA 4MVJE 3DPUA 1CB7A 4YHBA 2AWNA 2IYUA 2DZDA 1HSZA 4QPNA 1W48A 2RK4A 1NKVA 4YJ3B 2R4UA 3NHMA 1PUXA 5LB4A 2GEJA 2PD6A 2VS0A 1HTBA 4RV4A 4P6VF 3TLBA 2WZBA 2LBWA 3QPUA 2B8WA 4DNXA 1PJ2A 4F5EA 4W5HA 3OR6C 2YY7A 1VQVA 2V8OA 3TAXA 4KXNA 4G26A 2W6IA 2FZ4A 3QJYA 1KI1A 5EZ5A 3VYUB 1P7GA 3D31A 4AS1A 2HMAA 1ZINA 2GZDA 4M0LA 4TWJA 3L1VA 4H0LB 1VIVA 4ILEA 4QNMA 5ISMA 3T34A 1AGXA 1UZAA 2QORA 2DHCA 1DUIA 1XD9A 4DPLA 1RMYA 1XF9A 1ZXXA 3L4EA 2WT8A 2C5BA 1IIRA 4QE7A 2EJCA 3L1HA 3KKMA 4M1WA 5DIFA 5IVKA 1CP2A 1S8FA 2AIRA 1ZY2A 2JGAA 3AQ4A 4RQFA 2JIZA 1A8UA 3PHHA 3LMKA 2WHQA 1JJAA 4L4RA 2O0HA 4KMOA 5JAOA 3N9IA 3D3KA 3R5HA 6ADHA 3LFOA 3QW2A 4Q05A 8OHMA 4BXOB 2YZNA 2HT1A 1IG0A 4TUYA 2W4QA 2A0WA 1RWVA 2AZDA 1K8XB 2ZU6A 4AKTA 3CT4A 4YMVA 2O0MA 5KWIA 4WA8A 2XTNA 2ZJ0A 3CF6R 1BQ0A 1ODIA 1CYEA 1THMA 1Q7RA 3VPDA 2HBYA 3G1TA 1PHPA 4XJXA 2QZ4A 1NVTA 4LYFA 4S1TA 3UYLA 3F2VA 5A4MS 3ZG6A 4J6FA 1SCJA 2CHFA 3L70H 1BCCH 1V8BA 3DGEA 1OXSC 5G0VA 3NHSA 3W5HA 3CCQV 4JQZA 5EHNA 4ZJZA 2I9KA 4LAFA 4D41A 3HYLA 3QP9A 3NCHA 1X7DA 1FSPA 2JLAA 3A27A 4KOEC 4J16A 4JQYA 4OHKA 1IY9A 1VBFA 2JFGA 2VXCA 3INGA 1T5IA 2Q7XA 3DNMA 3GQVA 1KYZA 3S4YA 1KO7A 3MCVA 2D13A 2IW5A 3A1FA 3V6LA 1YDEA 4AUEA 5IFLA 3UKMA 3E9CA 2AKAB 2X13A 1WAMA 3F7TA 5EMKA 3GFVA 4PA6A 4NXMB 2WE7A 4V24A 3UTDA 1SN7A 2I5PO 4P35A 3WYAA 3NHLA 4MQ5A 2XT6A 4C78A 3LKBA 1QRTA 2DF8A 4MTXA 3M5PA 4TQ9A 2GK7A 1EUDB 2W6PA 2HTFA 1MSDA 1CEEA 4IV0A 4BNTA 1L7MA 3RJTA 3FOZA 2O8BA 5B1BC 4J7JA 1G6Q1 4ID3A 3QXSA 621PA 1KI9A 4E5UA 4D4KA 1NVVR 4Q12A 4CYMA 4DB2A 3L72H 1QNLA 3AEUA 4YJKA 5SZIA 2QKAA 5LBQA 1AXRA 2X1HA 3UAGA 1ZONA 1EAYA 1G1XB 4IHAA 3GAAA 1Q7BA 3M4YA 4UKDA 1TJ3A 4DV4B 4G0ZA 3Q6NA 2ZKIA 5KYGA 2IUYA 3IH5A 5CYPA 1C0KA 2G9ZA 3LF2A 3UO8B 1QTRA 1X42A 1RAFA 1QNFA 2JLBA 2QN1A 5AKKA 1KOLA 1R9GA 1LH0A 1T8RA 5HKKA 2WLMA 1TO2E 3DP9A 4H4DA 1DRWA 3STXA 4I4NA 4TX1A 4I9WA 3DG9A 4NU6A 2VAPA 1TVKA 1U1DA 4DLKA 5LBUA 5CFNA 4ARVA 3IHLA 4MW3A 1PN3A 3OOYA 3VPXA 4BJ3A 4OXNA 4JEHA 2AJDA 5KAPA 4MVJG 2OHFA 3QV1A 4KIGA 4OBBA 4GOOD 4CLRA 3RAEC 3K2BA 1QGUB 3GJTA 1B15A 5CFMA 1P8JA 1UFRA 1Z25A 3HBJA 1SQ6A 2W2NA 3F97A 4UBOA 5BSVA 3FG9A 4NAVA 4M7RA 1G1MA 3TH5A 3NOQA 2P2ZA 1RWPA 2QJOA 3EEQA 3Q3GE 3Q85A 1CY2A 1UI9A 4FDAA 3UMRA 5HQ3B 5CM2Z 5B2ZA 4D4MA 4E88A 5LC1A 4UNRA 2G0AA 1TZMA 4GZRB 3NATA 3RRMA 2ZR2A 3GU3A 3VI3B 3VSCA 4ZYXA 5L4NA 3ABKB 4ZDWA 1A2QA 2GUGA 4GVLA 1O95D 2RQ6A 4YRMA 3GUZA 1OYWA 1TC2A 4QFMA 1N5KA 4R16A 4MB6A 4DV6B 3BHMA 4MW9A 2FSVA 1FQKA 2WKQA 3EEIA 3D2LA 2R72A 1WVMA 3IV6A 4PRKA 5IVDA 3GWKC 4BAYA 1DJLA 5FADA 4CPDA 4CH3A 3DMRA 3VAYA 5JJIA 2EC5A 4Y2JA 3W0LB 1KC1A 1E0AA 2VRCA 4KHPO 1WPQA 2OTJV 1Y1LA 2RDMA 1HXHA 3UT6A 4PF1A 1NDHA 2IF2A 2XQVA 3HKDA 1U3DA 2WWTA 4ZU3A 5KOYA 1RI4A 3DB2A 3ZTWA 1R4AA 2OFWA 1Q7CA 1QIEA 1VF6C 3SC4A 1W52X 2K6GA 2OGWA 4P7JA 3OVMA 4DAEA 4C14A 2QAIA 3RFVA 5F3DA 1RBYA 1E4YA 2P3LA 4AZVA 1KI2A 4DA8A 1J42A 1LK0A 4QEZA 5BR8O 5BWOA 4GLBA 1JEYB 3B3QA 4UARA 1OH8A 4JJKA 5JSZB 3IR9A 3M4SA 2REBA 3OEHD 5K5EA 4JASA 2N46A 4IFIA 4UVEA 3EC1A 2NO5A 3JQDA 4P31A 3RC7A 1LSOA 4J0JA 4NFHA 3G71V 4YDQA 2VYVD 3UAWA 2RIPA 4G09A 2Z95A 3D54A 2NIPA 1NPYA 2AHRA 4P53A 5EUCA 2ZCUA 1NMZA 1V5WA 2JW5A 3GUHA 4KV7A 1U8UA 4JI0B 1IV1A 3W6PA 4DR5B 3BAZA 3PQEA 4F9FA 3ASNB 3C3TA 4C4WC 3EY4A 3K8QA 2A6PA 3KEMA 5DHUA 2BKLA 4EG8A 1OREA 1TM4E 1CQJA 2AFIB 4BRZA 5HFMA 1T6ZA 4HWKA 4DQVA 1V1RB 2XZLA 2O5RA 1X7GA 2EW1A 4S2EA 4QUEA 4CI0B 3AF5A 1UC5B 1TT5A 2W71A 2WP8J 3H19A 2PLFA 2I4NA 2P4QA 4EENA 1Y63A 3L43A 3F74A 2V3CC 2GPBA 3L8ZA 2WA3A 2IOHA 3NU1A 2WKPA 3O4RA 4ZIBA 2RFLA 2YWJA 5FL7A 4ZVPA 3JV7A 4M0CA 2NUAB 3LHFA 2A14A 4MGHA 4G63A 2HSZA 3P9IA 4G0QA 5LZ5A 2XHZA 4YO8A 2CYCA 3B48A 3ILSA 3UOWA 3ZO8A 3WAJA 2VP4A 1AM4D 1VPVA 2KLBA 4DR6B 2MT9A 1Q6YA 1NT2A 2VAXA 3AKEA 4GKVA 3HR0A 2JHCA 1SKUA 3G8AA 4H9GA 4MRAA 1JAXA 2O50A 1D6NA 2K2QB 3B2QA 4LE2A 5T4HA 4BX2A 2HR1A 1K9MH 1XILA 3FVVA 2OGSA 4N23A 2RHHA 1CZRA 1YAHA 3C3MA 5H9CA 3G59A 2HSDA 5CVUA 3VR5H 4D81A 3QKTA 5JEDA 2FUG1 3P4EA 1F1JA 1OXTA 5K4GA 1NU1H 3WJPA 1U96A 3U7IA 1JYEA 4GKJO 3TW8A 4QXRA 5JCJD 3A3NA 1PK8A 3GJ5A 3R7LA 1N5LA 5C1DA 1MOQA 2PSFA 1Y7TA 3DDOA 2ONJA 1Y3BE 4EJSC 3EUAA 4EKGA 2WF9A 2WTEA 4DMUB 1U6KA 3COPA 4H6PA 5EIOA 5FXMA 3LWRC 1LX7A 4HQFA 4P3OA 2GHYA 2ZR7A 4B5LA 3GBVA 5I47A 3V2GA 4TWAA 1S5PA 4FFVA 4NC9A 3L1UA 1BGWA 2OHOA 4NK4A 1DIHA 4KREA 2WWIA 4PN7A 5KLVH 1LPBB 1KBQA 2FUNB 2UZIR 4IR7A 2RGWA 3HBMA 4EGSA 1T25A 3GHHA 1H2SB 3MDOA 5EJ5A 4C3ZA 1J90A 4D9KA 1E59A 1ONBA 5AUPB 4YAOA 4F1WA 4KIJA 3UCEA 1C7RA 4CQLA 4TLDA 1HKUA 1SZDA 1URFA 3BXEA 4MICA 2A0LA 1H42A 3RNOA 4OU5A 4ATNA 2IELA 4B32A 4WFKA 1GTSA 2QN7A 1Q3KA 3ZGXA 3TZKA 3T3DA 4GXRA 3ZE2B 4YUWA 2P6RA 3AXSA 3RC8A 2CGOA 3HNOA 1MZFA 5EFOA 3KQTA 4RGBA 5KREA 3RRXA 4PQGA 3O9OA 3C9SA 3IV7A 2QTHA 4NG5A 4MXDA 4FEAA 5DVZA 3TKLA 3NHWA 2WSSD 3S5UA 4E5DA 1A8PA 1RJ9B 4J3NA 2B7LA 2EYQA 3DTUB 4YXWG 2OORA 4RKQA 3LZ6A 3JXEA 3O90A 3CSDA 3VR3D 4MNTA 4HX9A 4LMPA 4U2KA 2R5FA 3MWKA 2PH7A 4PO8A 4ARZA 5CDHA 4CTOA 1KNQA 3QWIA 1Q7GA 1QCYA 3NH9A 4PHZA 3PRHA 3U3JA 4EBBA 4RTJA 1UFIA 3H5RA 4JGSA 1MAWA 4B7CA 3ABLC 3ICCA 2CMFA 1NVPD 2WAYA 2ZSHA 3QTLA 5IAGA 3TAHA 5HTKA 4HGNA 4PN3A 4YV2A 4GS5A 4RO2A 1F20A 2HGSA 4D8XA 4EMTA 4MKFA 4I4CA 3CEHA 4UPVA 4QYMA 1FP2A 4R51A 1ECCA 3ZE9A 4JIGA 3RVPA 2P06A 1R8YA 4I6JA 4FE4A 3K5MA 2J9YB 4IG9A 2JFUA 4JLDA 1OFGA 3FDZB 4WXHA 3OZRA 3CLRD 4OFBA 4UMVA 4B9AA 1PXWA 1C1HA 4P84A 3ETHA 2HCTA 5IT9M 4XEUA 2PKQO 2R8ZA 2HRBA 2OZVA 4Y1GA 1E62A 1JBQA 3EFHA 4OX9B 4GI2A 4N0MA 4MYTA 2WJIA 3AYZB 1V5IA 2WWRA 4OAOA 2NACA 1NVEA 3FLBA 1TTTA 5DTIA 2H4XA 2EVWX 3BEHA 4TVOA 4MLDA 1NHWA 4LFCO 4UU7A 1MB0A 2DB3A 2CMDA 4RQOA 4ALNA 5DM0A 4L0CA 3O4VA 4UNIA 2R9RB 1ZL2A 2G9UA 2Q8QA 3QVWA 5DNAA 4F4CA 5LD2B 4HF7A 4WCVA 4NG4A 3O4IA 4PGFA 2E1PA 2RKOA 1VPEA 3RBVA 1NXOA 1SBIA 3WWYA 1W55A 4GECA 1C0IA 2XODA 1H6CA 3C7CB 3MMSA 3AR7A 2V6BA 4JELA 5AW5A 1F4NA 2FRVA 2ZTLA 5JASA 1NN1A 1G6UA 1Q16A 4G23A 2BPOA 1KKMA 3ESAA 3BIWA 4RD0A 1A4XA 5LU8A 4BO2A 2CLEB 3EODA 4UBNA 1Q22A 4Z99A 3R7SA 1XQ9A 4A15A 2G5PA 1T8WA 3K0GA 4BQSA 3V7NA 1JHUA 1AY0A 3F3YA 1Y1KE 4Z7OB 5HSGA 2ARKA 3B3JA 4DV1O 1RU3A 2H08A 2P78A 2XV1A 1UWCA 2VP0A 2OYSA 2BFWA 2O8CB 2IE0A 1FJGB 4A92A 4Z9BA 1MA3A 4L5AA 1CEXA 4S05A 4FOLA 2YMLA 5LBTA 1KHTA 2K7ZA 3I2FA 3K14A 2HBRA 3O8DA 3AR2A 3F3SA 3JQAA 2OHVA 4KUHA 1FXWF 1MT0A 1BMFG 1WDTA 4UDYX 5FA5A 5A5FA 4TV9A 5TF0A 4YP1A 1O94A 1TUEA 1QOZA 2Y0DA 4CT4B 1ZRNA 5IZCA 3ZGLA 1P4RA 1V55C 3MGBA 5K9ZA 1M56B 1YS1X 1L5GB 3UUFA 3VPGA 4NPAA 2GUWA 2Q0XA 2C1EA 1X94A 1YZYA 3P94A 4DXWA 4Y0NA 4WWHA 2OKCA 3K57A 5D84A 4OQFA 3FHJA 2QP3A 3OLYA 4Z53A 1MABG 4G1UC 2DERA 2ZRLA 2JFWA 3AWIA 2XHBA 5CA0B 1JD1A 2KM1A 2LPMA 2OCAA 3D2CA 4AUNA 5CM8B 3T1HO 4AMBA 3BZBA 5LNK1 1QX4A 1P0CA 1VG9B 4NCBA 3R3JA 2V7VA 1R15A 1A1VA 1GUYA 1UZMA 4RHUA 2VYCA 1YHZA 1ZWIC 3OBYA 2EBWA 4F4IA 4UVCA 4E22A 3RARA 2FV8A 3EFEA 2Q4OA 2QVZX 1PSZA 1UT8A 3E0XA 1A71A 5IT9N 2VHJA 3OZXA 3L8HA 5CH5A 4CM7A 3RK0A 3IJEB 5SYMA 1RR6A 3DL2A 1L7AA 3LLUA 2PT6A 2HA4A 4RDCA 5ENDA 3ZH9B 3TQIA 1PKEA 5FWAA 3UCSC 4F21A 5JROA 2O2DA 4W5RA 4WSOA 1M1KH 1YULA 4P3NA 5EI5A 1IRXA 1M6NA 4CTJA 1T0BA 1Q0SA 3SSAA 3SQLA 3CNOA 1T0JB 1ANKA 2J0QA 3PLRA 3H1HH 3T4DA 2DULA 1AKMA 4QIHA 3V7EA 1O97C 1G7SA 1VIMA 3M5WA 4OG2A 2R25B 1ESNA 5LA6B 2IIQA 2N74A 2OK7A 1IZ8A 3TNLA 4J7KA 2DJIA 2F62A 4QYTA 4TWKA 1LA2A 1WW8A 3A04A 4OYHA 1AB3A 2VUHB 1Q86W 4P4SA 3PC4A 5EWJA 1FNCA 2FPRA 5E38A 3V8QA 2C77A 4I0XB 1O58A 1SCNE 1JDBC 2JBAA 2VRCD 4XVUA 4R8KA 5KNBH 4EFKA 3LWPC 1R9JA 1LS1A 3C24A 2QLFA 3K2EA 4JBGA 1YTFD 4RO0A 5IS2A 4YY3B 2NUTA 1X0XA 3N4ZA 4ZI7B 3A3KA 4R9UC 5HFLA 4B4KA 5I7RA 3HDQA 1SBHA 3LO8A 1AQUA 1WB5A 3EIHA 2PX2A 3HI4A 4UVHA 4XSVA 2GLZA 1JT9A 1E1RD 2JEOA 4YCNA 2WJ3A 2GYYA 3VTZA 4YPVA 3HDYA 4D80A 3NCTA 3C1OA 2VKTA 3VX4A 1T2VA 1QG0A 2XYQA 2GAIA 4MO2A 1XTIA 3WKCA 5KO2A 1LXCA 1TRKA 1ZL0A 2L26A 3KLPX 3PUXA 1K98A 2B1RA 4KQ1A 1GO1A 3OH8A 5B64A 2XE4A 4G0WA 1AKRA 1L5SA 3DE5X 2AL7A 4MVJF 4AZWA 5LZ9A 1NLUA 2AD5A 2GZHA 4TLLB 4JF3A 1YMVA 2JCYA 4PZZA 4KBFA 4HN2A 4JX8A 1NVKA 4BVAA 1XREA 4BKUA 3C15C 4EGJA 4DDWA 3V1MA 4W9NA 1PP9H 3H86A 2HREA 3O85A 4ASUG 1T2FA 3KOWA 3PD1A 3MJDA 1JMVA 1XHLA 1ZGHA 1J8MF 2CHQA 2LWIA 4HQNA 2B83A 4U7PB 4FC6A 3WKBA 5B3LA 4BV9A 2HUPA 1G3IA 4FOTA 1DBRA 5E1DA 1L0LH 3OLZA 4GWLA 2PWBA 2AIFA 3LBYA 4JKYA 4L9AA 5FAXA 3WJ1A 1OIVA 3RYCB 1T24A 3D8RA 3R7AA 3CJTA 4DIKA 5JAZA 2ZE8A 4MYUA 3SYNA 1KB9F 3WVNA 4AJHA 2CVPA 3S2SA 3W06A 4K6KA 1CKEA 1J9ZA 1I7SB 3NQ41 1WPXA 3C3WA 3X1KA 3HJGA 4ZCIA 4M7OA 4X0EA 2O0JA 4H1UA 1XP8A 3UH1A 5M04A 3W1EA 4DDMA 4ZFNA 4GYKA 2Y2VA 2WPDG 3L71H 3ACCA 3NYQA 4QQ8A 5AOAA 5CCXA 3AVWA 2ZODA 1AHHA 3RKSA 2W98A 3IOYA 1IIBA 5IAOA 5JADA 1US6A 1R74A 3RE1A 3DPIA 4N5DA 4OGGA 4QNNA 4DYLA 1QHXA 3BMNA 4XGRA 4C0AC 3HCWA 4O2RA 1Y67A 4W1RA 5AVVA 2J3MA 3QO8A 5LP6F 2JJ1G 2QUKA 4PYKA 3P0RA 1KYYA 1U3WA 2X9LA 1KY5A 1YU9A 3CZPA 4QICA 5HKKD 1QDLB 1GGMA 1QGYA 2PRKA 2XMBA 5MFZA 4DKJA 1VL0A 2ZI7A 4XX0A 1PL4A 2PU7A 4ZODA 4XWKA 1SPBS 1MJGA 3Q3EA 1PR1A 3K9QO 4J0IA 4QOSA 3VNBA 1NRXA 4DNOA 4LF7O 1JZTA 4IOLA 2QD2A 4I08A 1XLVA 2Y3IA 3V7QA 1GPYA 3I32A 3KB6A 5E1MA 3UPDA 4KVGA 4JP8A 1QHGA 3KSRA 3DZIA 3UG6A 1A9XB 1B3QA 4JJZA 3WC4A 2QRNA 2C9YA 5JHHB 4UVAA 2EZ8A 1K73H 1X8XA 2O7RA 3FIJA 1ODLA 3I7TA 1OHHD 3AHIA 3OICA 5HJEA 5F9MA 1ZVJA 2QBYA 1OAKA 2HH9A 4PZAA 4XM1A 1W96A 4DHWA 2EP5A 2VBGA 5AFSA 3D2BA 5GINC 1DBPA 4P9OA 3I62A 5EIHA 3KR9A 1ORHA 3I42A 4WZBB 3C0KA 3O0TA 3C6MA 4DPKA 1M57C 2XI4A 3C3PA 4OATA 1FFBA 2QSJA 4CIBA 4PEVA 1VL2A 1CUXA 1JKIA 4NAHA 4HAYA 3I3SR 4JLAA 3IDOA 1EZZA 1R6TA 1RBQA 3L8YA 1JPUA 2FMHA 3ZW7A 3AM5A 1VE6A 1TLTA 3G1UA 1Z0SA 3OPVA 2YNMD 1NWCA 3CE2A 1IBKB 2PYIA 4NMLA 4PC1A 4TTVA 1RC0A 3G88A 4Z3DA 2IHJA 2VT6A 3UMJA 4F85A 3GB9A 3L04A 1SEVA 3BB3A 2OAGA 4PHHA 3W4KA 1ODJA 3EW9A 3KZNA 3E2MA 4EAQA 4MTOA 2ADQB 3WWCA 3AYXB 2XLBA 3DMHA 1ZVKA 1P7BA 4EVIA 1NW7A 5I7UA 1SVOA 3FNRA 3C5WP 3ET4A 2AUNA 4INJA 1NTMH 4OU4A 2DSNA 3L8MA 3EZFA 3GUCA 2BFEB 1XN4A 1ECJA 4AUKA 4CKCB 2GARA 1Y8CA 3H9UA 3AY3A 2PI4A 2ZIFA 2VNJA 4WNIA 4P38A 3AK1A 1RQLA 3OZSA 4BEVA 1YK1A 4QOFA 2IS2A 5IVIA 2Q67A 4YFVA 4BT4A 4UU1A 4Y30A 4XR9A 4E5SA 2OP0A 4GPEA 1DNPA 1EFPA 2NLOA 2Z1UA 1Q0UA 3JSLA 1PBNA 3E7PA 3ONVA 4CCYA 2LIVA 2Q5FA 3FUXA 2ZINA 3TGUH 1KKCA 1BNCA 1P7CA 3L49A 2PGLA 4G5FA 4CTMA 4CKYA 5B1SA 3IBCA 3DT8A 3OHPA 2IGBA 2ZKLA 3BMCB 4NKGB 1KDPA 5JCZA 2YWHA 2VHYA 3JQEA 5JTTA 1A9ZA 3I76A 3MCZA 4PBSA 1P19A 1HW7A 1J06A 3K79A 1WA5A 3RS8A 1XTSA 3H2YA 421PA 7ADHA 1K8AH 3IMGA 1UK9A 4CZZA 3QENA 4ZZ3A 3HZRA 4H3VA 4BIIA 1Z7WA 1I7DA 4AW9A 1OLSA 1U90A 1OF1A 4BFWA 1BXGA 2WJ6A 3X1ZA 3ZOKA 2Y05A 2BSKB 1CSEE 3DEYX 2W2VA 3UFXB 1U2QA 4E2LA 2JEZA 2IEGA 4QO8A 3I55V 3C9UA 3OQMA 4K9NA 2IH1C 3AR5A 3FVTA 1XMQO 4JJGA 1GAWA 2O2GA 5FBZA 3CO0S 3PR2B 3TZ6A 3UUGA 1N34O 3NHJA 3PDUA 1BE8A 3GWGA 3L7IA 1SQGA 2IHYA 3WLPA 3DV0A 1TTPB 4NBKA 2V4DA 4B62A 3COVA 3R0XA 3GMSA 4GWGA 2OYCA 5K99A 3PIDA 4WXRA 4YIOA 1T5EA 4G27B 4FLYA 4BVHA 5IXSA 3DOUA 2QP9X 3OPYB 2J07A 5DMHA 3DEIA 3T0GA 2N9UA 4IL6Z 2VHQA 2VI5A 4X44A 4WL0A 1KBOA 1JFVA 3RLFA 4BN5A 3DDNA 3CSXA 2WM3A 1VQ6F 2OT5A 3HMKA 3DNFA 5B58C 2ISQA 3BE4A 4X92A 1IHDA 3ZDFA 4CMGA 1YVPA 1S3JA 2HJHA 1O9HA 2JIBA 3JAMM 2RHRA 3LQRA 4CG2A 5KYWA 3O26A 1QIJA 1CF4A 3GRRA 2HY7A 4PYIA 1XAIA 3HB3B 1K4YA 4O0LA 2WLIB 3ZOPA 1IZZA 1Z83A 2FSPA 2GRJA 3EPRA 4DNFA 4ZGGA 4LWZA 3C6YA 2OKGA 1CUZA 2V6MA 2ZEJA 3B52X 3PUWA 2VQEO 4NZZA 4BGUA 4DCOA 4FFPA 3JWHA 1KMCA 1GCGA 4O4JF 4K1XA 5DM60 4UTOA 3J81M 1KWGA 3B6ZA 3NORA 3QZUA 1I0HA 2YV2A 3C7AA 5EHQA 2PD4A 3E81A 4WBXC 1N7HA 1G2OA 2DFKB 1UANA 3FSGD 4XXHA 1Z5VA 1EP2B 1FTGA 1M6WA 1PJSA 4ZOCA 2OLKA 2XUJA 1Z2NX 4YASA 2XAAA 3CCJF 2IS4A 3AVQA 2BFCB 4WFGA 4QJBA 3P9PA 1WPRA 4IZHA 4RIGA 3ZS8A 2JDID 3L9WA 4BO6A 2DUWA 3E23A 2GKSA 1MOSA 4CLOB 1ZP6A 5BVHA 1KS2A 1NPTO 3WB0A 1ADGA 2P9YA 4JUAA 4NATA 1J8YF 2XSZA 1K2WA 1H22A 3FOBA 4QTYA 1KDOA 2DQ4A 4M21A 4YJ3F 1PL0A 2IU0A 3ZZTA 3KLNA 4G5HA 1E58A 1OFUX 4NBTA 2QOEA 3AZPA 3H2ZA 3VGJA 2A0YA 5CB4F 4RCZA 2KPOA 3B9PA 3QKRA 5FOXA 3KTDA 1Z4PX 3FUCA 3M49A 3OEEA 4LBVA 3GLQA 1VSTA 4K88A 4DV0B 4PLCA 5SY4A 2JIDA 4WEOA 1PF5A 3EVNA 5EKXA 2IQQA 3D0RA 5EXXA 2CV1A 1M7HA 1EHIA 2ZUBA 3PZRA 1E1CA 4KPUA 3EW7A 3BIJA 5EWLA 4Z49A 3OTFA 2HP3A 1KBZA 1P2UA 2O8BB 4R0NA 1EFKA 1XA4A 1R4ZA 3OQPA 3AU9A 4PG5A 1VYHA 1EGMB 1IBCA 1TFUA 2BN4A 1YH3A 3R8FA 4JR0A 3AW8A 2ZVJA 2XR1A 4N12A 3BZWA 5EEGA 2NPOA 3SIXA 4DCMA 2YC4C 2ILVA 3EA4A 3LUCA 4X1YB 3OOJA 4OHBA 4BEWA 1E9EA 2QSAA 1T2DA 2JJ8A 4NHEA 4N8EA 3W5VA 1P31A 3CZ9A 3HFJA 4IX1A 4WRRA 4XTRA 1TYBE 2RHGB 2ECKA 1EN4A 3O2NA 2XRMA 1Z0JA 3DQQA 4QAQA 4TXNA 1SCBA 4YRRA 2PQ0A 3STTA 3GEEA 4NNPA 4NYJR 3WXMB 1CY4A 2G6TA 2V97A 1CJMA 3FBWA 4EQZA 3J81k 2C3OA 4ND2A 2A9OA 3HCPA 2ONYA 2EYUA 4L8VA 3AG4B 2P5SA 3NP7A 1NLMA 3JW8A 3SBDA 3WK9A 3QXXA 3ZWMA 5DZSA 16PKA 1ZN8A 3CHYA 4CLHA 1KY3A 4JI7O 1GFZA 5EQTA 2VSQA 3WX0A 4WHMA 1HPLA 2FWMX 3I73A 3HO6A 4AX8A 1HG1A 2BDTA 3MS4A 3PWKA 4MUMA 5HCIA 4K0KO 1KSJA 1RBMA 2DAPA 2Q3JA 3H4TA 2GPSA 1ZEJA 2BGIA 4W5OA 1KSHA 4NS1A 4JJ8A 5IP5A 1E1RA 5FYQA 4LH6A 3KKNA 3N8DA 2OTLF 4NI5A 3VNAA 1VJRA 4AP5A 3NIDB 3WWOA 4JT8A 2WUGA 1I7NA 3EGOA 3OY2A 2AJCA 4LOKA 2BDUA 4I0XA 3F6MA 1BOFA 3JALA 1JNXX 3A4MA 4IRMA 4MTCA 3QX3A 2XVMA 1YOVB 1O6BA 4K9KA 3T7IA 2ODNA 3Q8MA 1ZLXA 2J5XA 3E84A 3PCTA 2FMLA 1F5SA 5CEEA 4X20B 4X7RA 4FMCF 2YJGA 3E2IA 2X0EA 5FI5A 5K0SA 2CAZC 2M1ZA 5GTHZ 3FAZA 4MGYR 4RJLA 4X90A 2V6GA 4FMPA 4Q6BA 1R5NA 4YT8A 3VKVA 3HXMA 4MVCA 2MHCA 4BT5A 1LZKA 1E1LA 1K5GA 1OJ7A 2YFYA 4G9BA 4RX1A 4E5MA 1NYQA 4OMDA 4CUZA 5F7XA 1PZGA 2Q62A 4P54A 3VPBA 5JSFA 2C58A 3O93A 4YRPA 2G4VA 4BLSA 4BB9A 1K8QA 4D5GA 3SDSA 2B2XA 2NU7B 2VPZA 3H83A 2RGBA 4F0JA 1Y4MA 3VSBA 3U16A 2REXB 3ZKWA 2O1WA 5EQFA 4DLYA 5BQ3A 5DTJA 3MAQA 3E5NA 1XQ8A 9GPBA 4Q7KA 3GJQA 2ETXA 3NTXA 4IQFA 1SNYA 3R5JA 2I2DA 4MUHA 5HNKA 2PRZA 3KFLA 1HE3A 5EKUA 1OAPA 4ZQGA 5KYVA 4CL3A 3ZNPA 3OQBA 4MJXA 4PAWA 4DIFA 3W8RA 2QSZA 1ZL8A 4IT5A 1XKXA 2CUGA 1K86A 1V6CA 1XHXA 2PI5A 1HNXB 3AEYA 3I9JA 4LGMA 3SYRA 1FFDA 3TTSA 3UK7A 1GZUA 4LXGA 1EBFA 3O8LA 1Y6FA 5E1BA 5FEMA 4AD8A 1VFNA 3F73A 1KJNA 2RHMA 3D4NA 4JYZA 1C8VB 1PBTA 4PAGA 3LIPA 3PVSA 4H08A 4NEGA 4Y2UA 3U9TA 4WBNB 3G2KA 4WCDA 4MARA 4TYQA 3G5TA 4OYYA 1Y34E 3M82A 4Q1BA 3VYRB 2JHAA 3H1EA 2Q7GA 1CUUA 1O94D 3IDFA 4ZHVA 3CKMA 2GPJA 1YACA 4MWEA 3K9CA 1ZG3A 2QI2A 5H9WA 3KCXA 5DHPA 5ENZA 3A6GA 3ZXUB 3KV1A 3D3IA 3GP3A 1L8AA 1E6CA 1X1RA 3AB8A 4I1VA 5E4YA 3T3MB 1TK9A 4LWPA 3VFDA 2BGWA 4R7CA 1CJKC 2OGZA 3D4BA 3PJGA 2H7YA 4UUJC 1GR1A 2OCXA 4MWGA 4L7VA 1ZSPA 1G5PA 4LRYA 4KZKA 1JVSA 3AUYA 3NVMB 4DIEA 2XXAA 4UHEA 3KHSA 1ZNYA 2NYAA 3AY7A 1TMGE 4KO2S 4BEBA 2RKWA 5JJEB 3JQ8A 3VDNB 3IC9A 1F0NA 1XB2A 2H2IA 2JGUA 3IKJA 1L5WA 2JFQA 4C06A 3U7RA 5J2TA 4N5MA 3NK7A 5LJLA 4HDRA 2I22A 2Z5FA 2R48A 3NWBA 5KWSA 3DCJA 1FNNA 5CLGA 3D4IA 4GM0A 3F8TA 2ZXWC 3QBVA 3WMFA 5GINE 3P2IA 1OX4B 3PUIA 3OQVA 1GN4A 1SU6A 1QCCA 4OXIA 1E79G 2LKDA 1T34A 1HSOA 3MERA 2PO7A 2YY6A 2QDXA 1AKUA 1YUBA 1U8YA 3MWYW 3N0WA 2FZ5A 1QHHA 1V1MB 2QRPA 1GAXA 2CFSA 2GBGA 3CISA 5E1OA 1GR0A 1CRWG 2FX2A 1RIFA 2HWKA 4DCCA 1K8RA 2WILA 5GJWC 4EYSA 4HXGA 1W4AA 3HXTA 4BNWA 4XRGA 2OBYA 4DR4O 1MGPA 2P9ZA 2GXUA 4FGKA 2X8JA 2BSAA 2BELA 4OI0A 2G9VA 2FWPA 2C7VA 2NAFA 2VO1A 2H8EA 1L8OA 4A0GA 2ZYWX 2JFNA 3GRZA 5CMUA 3JQ9C 4GUNA 1GCAA 3UK6A 4ZIRB 3LDAA 4MK4A 5CD1A 4ZC8A 3CKLA 1JQEA 2XMZA 1JVMA 3EWAA 4X5OA 1RMQA 2OTJF 1QZUA 3N74A 5LIPA 3AJ9A 1QGZA 3EB9A 3JZIA 3LBNA 4N8SA 4NONA 4YMSA 5BQPA 1R2QA 1SXIA 3ZQUA 2XA9A 2OM6A 3B1FA 1Q86H 1CQZA 3OMLA 3TD6A 4CQJA 3PYXA 4HCJA 4II3A 3FYUB 7REQA 4A36A 2DMRA 3I39X 4TRNA 3AJRA 5DHFA 1JU4A 1IXMA 4LXTA 1BHJA 1R73A 1CR4A 2DHDA 2NZ2A 2JLXA 4XI9A 4KP7A 4D99A 2VR1A 3DZBA 1Q1NA 1FU8A 4G0XA 2ODWA 3ENWA 3L7QA 1J2RA 1MX3A 3OC6A 3SYQA 2AOXA 3H0EA 4OQZA 3C2QA 3MGAA 4HNSA 4PU0A 4JZ2A 4URWR 3WSVA 1YJNF 3Q4HA 1LLUA 2FVXA 3QFRA 4L8YA 3BDVA 3LOUA 1JJ2F 4ND4A 4NTWA 4KFSA 1EK0A 4JNKA 4WEQA 4EKEA 3VTAA 2XBMA 2Q28A 1KMMA 4QQKA 4AZ0A 2YVLA 2QJWA 4TMVA 1NN0A 1V7CA 5AHKA 4F6CA 2WSSA 5MHTA 1RQXA 2RN9A 3ZJYA 3G71F 5JSKA 3OONA 3OM3B 3NM4A 3OM9A 3BICA 1EI9A 1G3UA 2PL5A 1WCV1 1Q12A 3SU8A 3UB4A 1XZPA 1GK9A 2NV6A 5A4IS 3EPJA 3FYIB 2NZUG 3K8YA 3OTWA 1UMKA 3BWCA 4H7DA 3DZJA 1EU1A 3GJRA 4BQNA 3K70C 5JAQA 3CS5A 2JRLA 5AKLA 3TR5A 2BKUA 4U7FA 3LDDA 1ZX3A 1VCOA 3WB2A 3MGKA 5CYGA 5TVGA 3RS5A 4MVJI 4BMSA 1BN7A 3IOCA 3BCHA 1J2YA 3HO8A 1UFKA 3GZ4A 3KUUA 2DLNA 4GOMD 3RE3A 4ZI7F 4X95A 4PA9A 4MYRA 4HYTA 3R9IA 3WLJA 1SC3A 5DBEX 2YMPA 4MUAA 2HFKA 5GZ6A 4CLXA 1P49A 1RQ2A 1N0WA 1R5BA 4FR2A 4IWNA 1VLMA 2Q2QA 1Z5PA 1YB2A 3IAYA 1H8EA 2GCOB 2X0KA 4RK5A 2XIQA 5IM4F 3R5KA 5JJBA 1FU4A 2P11A 1BXKA 1Y4SA 4L27A 5EP1A 2EAUA 3TIGA 5JOQA 3HKBA 2V0GA 3GLHE 1EVKA 3R6WA 3H3XA 3L6RA 1TZ2A 3M1XA 3BHNA 5BY1A 2HPVA 2OCGA 3NKFA 3T7SA 4H7PA 5EXTA 2FUEA 2P9CA 3H5VA 3GTZA 4Q1AA 5T67A 1K3FA 1SESA 1O89A 4DR2O 3NG1A 1EHYA 2JGEA 3ANSA 4AXBA 4A0HA 5CK5A 1DTEA 5B30A 4K05A 1SD2A 4PX9A 1VG8A 4PG4A 4G8BA 2PEYA 2GK3A 4CR7A 1E32A 5MGNA 1VSUA 3EGEA 3G0IA 3O5AA 4FBLA 4IKPA 1VQKF 4U7GA 3HDTA 4ZAVA 4G0OA 3CXHF 2QL5A 3JYHA 4XQEA 4YAUA 1KH1A 1BTOA 2V45A 4Z2YA 2P79A 4ZEXA 3U4DA 2IH5A 4YCLA 5IBCA 2CTQA 3CG4A 3NAMA 1HEUA 1PL6A 4FYXA 1FZTA 4PX5A 4WJKB 1AILA 4X94A 5FWYA 5C4GB 1E3WA 1WCXA 5J23A 3ZH2A 2Z4SA 1M75A 3WMGA 2HRDA 2C8LA 2GHQA 3DTTA 2H8KA 4MQ4A 4TT8A 2QL7A 4WA7A 1BDIA 3V8NA 2KX7A 3E8SA 1IZ3A 2ZXUA 1AQLA 5ADVA 2QD3A 3AUXA 2IYFA 3R77A 3EQ7A 1DIGA 1OZFA 4HB0A 4ZCPA 1IEVA 4Z1MG 1AKVA 1JHOA 1GGKA 4IP0A 1IBLO 4KXUA 4CDMA 4Z1OA 4JBHA 3EX7C 3WL5A 2QM4A 3L1JA 2O1SA 1QHIA 4DL9A 2RAFA 2OD7A 3N2KB 2AA3A 2P90A 1FS5A 3E5RA 2AXQA 4YMUA 2X0LA 4F96A 5INTA 4NB5A 1T1RA 3TRHA 3U7FB 3IKEA 1GPAA 5BSEA 3MLAA 3KJNA 3D36A 1NMQA 2C00A 1P5ZB 3LVQE 2A9KA 4DR3O 2YRXA 3V32A 1RMTA 1J7HA 2ZYRA 3P96A 4IJ6A 2AEJA 1RI5A 4P9NA 2WFLA 5EGSA 5EZQA 2D59A 5FCDA 2VXBA 4EJSA 5JS6A 1NMXA 5HCNA 5H6QA 1ZLZA 4NK5A 3N28A 2Y93A 3U1BA 3O8CA 1SVNA 3TXYA 3GLGE 2X0NA 2G1PA 1T9BA 2HKIA 3FDJA 4DDVA 1TAHA 2QTAA 3SYMA 1HL7A 4Z2AA 1A50B 3VQWA 2X14A 4NEHB 3CRNA 4DY4A 5JS7A 5BVGB 1KWKA 1KI6B 2FZKA 3ANMA 1L9XA 2W6JD 3ZDYB 1TE2A 2OHJA 5ELMA 2H5EA 3B2EE 1RQNA 3PNYA 1XTRA 1QUEA 2LCIA 3L77A 3PEVA 4BZQA 2CZWA