3JATB

Cryo-em structure of gmpcpp-microtubule (14 protofilaments) decorated with kinesin
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
total genus 153
structure length 426
sequence length 426
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jatB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jatB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jatB01
5CA1B 1SA0B 1TUBB 5LYJB 3VO9A 5LXTA 4ZHQA 3N2KB 3JAKB 2XKAA 3C8LA 4LNUB 5IYZA 4O4IB 5JH7B 4TV8A 5CA0B 5ITZB 3UT5B 5J2UA 3JASB 4X20A 4O4LA 4EB6A 3WGLA 4I50A 3JALB 4I55B 2XKBA 1RLUA 3HKEB 1W5FA 5JQGB 4O2BB 4IIJA 4FFBA 3RYHA 5LP6A 3E22A 3WGKA 4EI7A 4ZOLB 3N2GB 3HKDA 3JATA 3HKBA 3VPAA 5M7EA 4F6RA 2Q1XA 5KX5A 1W5EA 4M8IA 2BTQA 5FNVA 4KWEA 3RB8A 4DRXB 5C8YA 1W5BA 4IHJB 4X1IA 5J2UB 2RHJA 5IJ9A 2RHLA 2RHOA 5EYPB 2VAPA 4U3JB 4WBNA 5GONB 5J2TA 2VAWA 1Z5VA 4I50B 1RQ7A 2VXYA 4TV9B 1TVKB 2Q1YA 4O2AA 3RYCA 4FFBB 5JCOC 4YJ3B 5CB4B 2GVIA 5IJ0A 3M8KA 1FFXA 2RHHA 3WGNA 1W5AA 4O4HA 3JATB 4TUYB 3HKBB 3RYIA 5KMGA 5BMVA 5LOVB 4HNAA 5MN5A 3R4VA 4F6RB 5KX5B 1JFFA 2BTQB 3JAWA 5EIBC 5FNVB 4ZI7A 5LXTB 4ZHQB 3VO8A 5MN6A 4X1IB 5IJ9B 3CB2A 5EZYA 4I4TA 4X1YA 5IYZB 3HKCA 5CA1A 1SA0A 1TUBA 4TV8B 1OFUA 2BTOA 3ZBQA 3N2KA 4X20B 4EI8A 4X1KA 4O4LB 5IJ0B 1RQ2A 4LNUA 3ZBPA 4O4IA 4EB6B 1Z5WA 5KMGB 4DXDA 3RYFA 3RYIB 5CA0A 5EIBD 3M89A 5JVDA 4XCQA 3VOAA 5LP6B 4IIJB 1JFFB 3RYHB 3JAWB 3E22B 4ZI7B 4YJ2A 1W59A 3HKDB 3WGJA 4X1YB 4I55A 3ZIDA 5LA6A 4O4JA 5LP6C 5JQGA 4O2BA 5C8YB 2R6R1 4ZOLA 3N2GA 4X1KB 3JARA 4WBNB 1FSZA 5LYJA 5J2TB 3RYFB 4DRXA 5JVDB 4IHJA 3JAKA 4O2AB 3RYCB 4U39A 4YJ2B 5JCOA 5EYPA 1FFXB 4U3JA 4O4HB 5JH7A 5GONA 4E6EA 5BMVB 3VOBA 4HNAB 5ITZA 3UT5A 3WGMA 4TV9A 3JASA 1TVKA 5LA6B 4O4JB 2VAMA 3V3TA 4EI9A 4YJ3A 5CB4A 4B46A 1W581 2R751 5MN4A 5EZYB 4I4TB 4TUYA 5LOVA 3JALA 3JARB 3HKCB 4B45A 3HKEA
chains in the Genus database with same CATH superfamily
1YZYA 1P1CA 3RQIA 3DKIA 4MARA 3QLJA 1TECE 4QUDA 1HFWA 1GPNA 2QRHA 3EULA 1PDVA 3IBFA 1TLLA 4OPAA 5EGSA 4I50A 5B1SA 4BXOA 3WGZA 4ACBA 2QG9A 3VZRA 4ZHYB 3BE8A 4DRXB 1W46A 3VNQA 1SUDA 4Y1FA 1XRMA 4YT4A 3BPZA 1DLJA 1DDOA 3QEMA 4RW0A 4HDKA 1CR2A 5K8CA 2BUBA 3T5TA 5EQTA 2HL6A 4TQDA 2ZCUA 2XTAA 4QXMA 3PQ6A 5CAEB 4P34A 3BVPA 3AZOA 1NW8A 3M6IA 2P91A 1C1HA 1E89A 3DE6X 3OX4A 1TAHA 3HUFA 4FYXA 3PFWO 4BC0A 2NU9A 3IT2A 3ABZA 2DKOA 2O1XA 3REOA 3T4UA 4O3MA 3V4FA 3VC7A 1VFNA 3F5QA 3NC0C 2VK2A 1U3CA 4X0EA 1G21B 3QVNA 5DEIA 3DO5A 1SC4A 3TQFA 4E6PA 2J46A 1JYSA 2D5BA 4IL6Z 5SYAA 2HBZA 4M49A 3CHXA 3UWOA 3WHIA 4CF3A 1KWKA 5ESWA 1XQ9A 2NXCA 1LWNA 3PX3A 4L8YA 1QJ4A 3JWPA 3S7ZA 1QP0A 2F43B 3DZDA 2AG5A 2QSUA 4BNGA 3GFGA 1AB3A 4NONA 3SJBA 3FTNA 5AI9A 4GNRA 3R8FA 4FDTA 3JQEA 3BIFA 3G71F 2CTWA 2QIOA 3LNCA 3AT1A 3AI3A 1J8DA 3DC2A 3DP7A 2VR1A 3EIEA 3DZJA 1PHPA 1FTGA 1RHMA 2VL7A 1WMAA 3IHKA 4TVBA 2G4CA 3BWEA 2OTJV 3UHFA 3UUGA 1KOFA 3LI2A 1R4NB 2ZUEA 1G63A 4V3CA 2A0FA 3FBTA 2VHYA 1X87A 1E1QA 4KPUA 3DXFA 4M22A 2ONZA 4EI7A 5TC4A 4BJ3A 2ETNA 2DTDA 1X8LA 2B5OA 1Y80A 2VJDA 3ASYA 5BQXA 3JQ8B 2YBEA 1BE0A 4ZEOA 1K4DC 2EFHB 3RV4A 4YI3A 5DSXA 1NQ3A 4FEYA 1YZ3A 2XB2A 1ZLZA 4TKVA 2P27A 2HQOA 4P4NA 3CRRA 4FYWA 2GZHA 2H85A 3MCZA 2GLZA 1Q7TA 3RC1A 3H8VA 5ALNA 4PD4F 3COJA 2AKEA 3KXLA 1JQJC 4IWNA 1ISGA 1AJQA 4UHJA 4Z1MD 4EFBA 2FUKA 4BATA 2EGHA 3GZNB 3W2IA 3Q10A 1VKOA 2ZWVA 1DT3A 3TR5A 5FA5A 1LPOA 1RAAA 1RJGA 3PEFA 3ZCTA 4JAVC 5EC2C 5LOVF 5IVDA 3F7YC 4E5YA 3O3OB 1TA0A 4QNHB 3ASNC 5K0ZA 2HAEA 3LS2A 3C8LA 4LNHA 4LCEA 1VP7A 4X97A 1Y5MA 4JI6B 1BE6A 4JZYA 2QSAA 3ZWWA 4LXYA 4TS3A 5DNEA 3KLNA 1QQCA 3L5KA 3TJMA 4BVKA 3GHYA 4LY0A 3ZGNA 4ZJZA 3PPIA 1Z16A 4KN6A 3VR5H 2J8ZA 3DGEC 4W6ZA 3GUHA 1H1DA 3UUWA 4KQ9A 3JCZA 1KPHA 1NNI1 3WBBA 2PUFA 2QV7A 2Z5LA 2X5JO 1BKYA 1T26A 1L5NA 1HF3A 3OUTA 4N3CA 1T5OA 2JJ1D 5FWYB 1Y8AA 1TE2A 1NX6A 3NX4A 2YJNA 5D00A 3LK6A 1F23A 2AG0A 1SOAA 2C9ZA 3PXXA 4KZPA 4OMFG 1QNMA 2WTEA 1XEXA 3MINA 2H2HA 3L8DA 2EFGA 3T1YB 3T7EA 3X1XA 2PX5A 4YAEA 4GBJA 4PLHA 1JQBA 1E3IA 4E22A 2WVAA 1D0VA 2ZTVA 1RSOA 1UZUA 2R8OA 3CYOA 3U17A 5C7YA 1XLWA 4YRRA 2P3SA 3AETB 3MOGA 4XDJA 3NWEA 2V7BA 3EARA 1G3UA 2OMEA 4RWZA 5HFAA 1ZUHA 1NVVQ 3IAFA 4NBUA 3L0CA 3LRXA 1DAHA 2Z8ZA 1SOUA 4R8SA 4C0WA 2M32A 4RZHA 4EP1A 1SBYA 2YNMC 3I3SR 4E1BA 3ZDAA 2ZJ3A 4EEKA 1SETA 2EP7A 4UVEA 1KBZA 3U9TA 4J07A 2FFQA 3TINA 5I9LA 1JMVA 5EESA 3SHTA 1H4QA 1Z4NA 1Y5IA 3AFHA 1L7AA 1U7TA 3MCUA 5A4AA 1SB9A 2JJ2A 3ZV6A 1G8YA 1FA9A 3OJLA 1SHLA 1PE0A 2WMYA 4ZCMA 1QVFU 3KFVA 3G0CA 4MKXA 1GNSA 1ONOA 4A8JB 4MVJD 3SKXA 4TXHA 1XKXA 1P7PA 3MTGA 4GO1A 5DNVA 5L3GA 3ZRSA 4MSUA 2YW2A 2IODA 3OPNA 1Q14A 1T4BA 1I0HA 4AS3A 4WDQA 1ZP6A 2WT9A 2YOGA 3LWQC 1JEEA 1T36A 4ZEVA 5KHGA 2D62A 3TF5A 4D56A 2JNBA 2NO7A 2C4HA 2W2KA 1RC1A 3KUUA 4ZQGA 5TGTA 1J20A 3BZWA 5D87A 2QE7D 2CXOA 2R1TB 1W4ZA 2HNKA 4IO1A 4PCVA 2QN8A 2CMGA 2O6LA 4CS4A 2V7WA 4E6EA 3KTFA 4FWIB 3V8BA 3IQHX 3PJEA 1L4EA 1FFWA 3GP5A 2Q8VA 2IP4A 4H15A 1KK1A 4ALLA 2FZGA 2YWEA 1FOEB 2TS1A 3N27A 5K2OA 3SYAA 2WKQA 3H3XA 1QVWA 5FNVF 2ES4A 1LDBA 5TARA 4PX2A 2EU8A 2OCBA 2B4QA 2RH9B 5DGDA 1ORRA 4INOA 4S04A 1CZHA 4J4HA 1NR5A 2Q46A 3JWEA 3GTZA 2ZYAA 2YV2A 3RREA 4J1QA 3ONWA 4HI0E 4JVOA 5CA1A 4EQ6B 2XZTA 3AINA 4U1RA 1R2QA 2R5NA 1JN0A 1WS6A 2P35A 1W3EX 2EJBA 2H9YA 5GTDA 1SKAA 1ZH0A 3DVSX 1OW3B 2LDBA 1ZWZA 1VPLA 1YITF 1G7RA 4E31A 1Y3IA 4ARUA 2I9PA 2RGEA 2GTSA 3H6KA 3RN4A 4KYTA 4WLVA 2AJBA 2NUTA 3KUXA 2Z1NA 2XNDA 2DSNA 2NU7B 2AHOA 3BGOS 3T38A 3OT1A 2QP4A 5DXJA 1DIBA 4ZU3A 4LIPD 3SGLA 3C3EA 4D74A 3VTAA 3K0GA 4L8GA 3QI7A 4D6PA 2DVMA 1S3JA 2QN2A 3O5AA 3C7CB 2CL5A 3I9JA 4PYJA 3W2FA 5LKAA 5EL0A 3TCUA 2L82A 3U3XA 4Y9DA 1PT8A 3DQQA 1P33A 2W6ID 5K8IA 4UEOA 3H2YA 4IIXA 4C20A 4PJ0Z 2ATEA 3KXKA 4YIOA 2QA5A 3UHJA 5CDHA 3L0ZA 2VPYA 4WUVA 3RIYA 1PQYA 1FS6A 4BFTA 2XWSA 3P0ZA 3VOAA 3QLVA 2VWKA 1IRXA 5SZKB 5EKSA 1U11A 1FDWA 2ENWA 2OM6A 1EVJA 2X6AA 1YXBA 5GAJA 2LCQA 1BMFA 4XAQA 4M8NE 3OZSA 1JILA 4NOJA 2DUJA 3WDMA 2YHIA 3ELCA 2DHEA 5CFMA 3VRHA 4ALMA 4ROSA 3VZPA 1M5IA 2PVPA 3RS3A 1PG2A 2QKAA 1ROPA 4G1MB 4GX0A 1VMDA 4NCIA 3W2GA 2XODA 4ADSG 4DNFA 2GSMB 1V6CA 2ZTUA 4EJ6A 4FGKA 4UTZA 5AKKA 4DMUB 4MWOA 2OWOA 3CZAA 2FYUH 3PFIA 1NPTO 4X6LA 3CZ4A 4BNXA 2BOVA 1W44A 3TJZA 1UJ4A 4BW0B 2XGOA 2PL1A 2QRJA 3L93A 1XMJA 5EP2A 3RRZA 2VJPA 3JVIA 4MKGA 1L7VC 1D5CA 2FVYA 4YCDA 2NZYA 4UUAA 2LCAA 1ATIA 1R50A 1G7CA 3U7FB 2A1TS 3DOOA 2CD7A 3JQFA 4KMOA 2HPZA 3RRNA 3IMGA 3UMYA 1M0SA 5I7FA 3M82A 3ZYZA 3NBKA 1KDOA 5D86A 4YJ3A 4X94A 4LZLA 4EPXA 2MSEB 1TZMA 1X13A 4BNHA 4DLWA 2BISA 3BQMB 4IS3A 3VA7A 2OG1A 3WIUA 5CNJA 3Q4GA 3EN0A 1X86B 3CCRF 1RCUA 3NHYA 5HVNA 2GRJA 2P6OA 1Y0BA 1GV1A 1O5IA 5DB4A 1XMVA 3O8DA 4TKLA 3PGJA 4I50B 1Y3HA 4DJAA 1RXSA 1CQJA 3QXJA 1NMUB 4WJKB 1T2AA 4Q4LA 3ICEA 4DQVA 4X88A 1SO8A 5DU2A 2Z95A 1NLFA 3OQMA 4HVAA 1LI4A 1D4FA 1MF7A 5AVMA 4A0QA 4KHPB 3L4BC 3RROA 4X1KA 2OM2A 3KZ1E 3YASA 1K7DA 3QEMB 4PIPA 2OZEA 3OPYA 2HM7A 3WGJA 1GO3F 3VNRA 1XLUA 2BMVA 2QRMA 1JKMA 4EHAA 1XD2A 2VQEB 3QXGA 1AKTA 2HPHA 3I01M 1WXIA 3HSKA 1T0HB 3NGLA 4P4SA 5TPWA 5CB4A 1YI0A 4RF2A 3UN1A 3WLRA 2ZIUB 3K9BA 1D5WA 2HWKA 5AESA 4NBKA 2NU9B 4ZI7F 4W9NC 4L5AA 4CLRA 1TM4E 3RR2A 5EY5B 5FWNA 2A3RA 2FNAA 1U9IC 5BN3A 2GHIA 3MTDA 3ISJA 2L17A 3R3WA 3PHBE 1KNQA 5KC9A 1MEJA 4CETA 4BIIA 1YMQA 2XCIA 4C2UA 3WLTA 3C3SA 2WSIA 1CZOA 1J7HA 4OP2A 1IVSA 1CHNA 2HK9A 1FBTA 4KDRA 1GQQA 3KOOA 4C7UA 5JS1A 2KG4A 2IBTA 2G7MC 1J7JA 1MABG 4FBGA 1P75A 3U26A 1MG5A 1C5KA 2YWBA 2VDRB 1FEZA 4UOQA 3L8YA 1KE2A 2F8SA 3W1VA 4A5SA 2BLLA 3IQEA 4M46A 5K6RA 1L1QA 4CODB 2QBYA 4IRMA 4WK2B 3RSFA 3GH1A 4G5OA 3G2KA 4UUJC 1PQUA 2OCGA 1Y7HA 1QFJA 2ZJ7A 1P0IA 4B3XA 3KBBA 4GP9A 2WLSA 2XVAA 2Q2NA 2EWVA 4GR9A 4KPUB 4C4TA 1AI7A 3TGWA 3K5PA 2XMPA 3VPBA 4XIJA 2GXQA 1G8JA 3CR8A 2AW5A 5E2IA 2UYNA 1JKJA 1ZNWA 4UNPA 5DYGA 5CH3A 3VAYA 1A4IA 3Q98A 4MRMA 1UI9A 1KJ9A 2P4HX 5AQ1A 3G5LA 5B1YA 2ILMA 4LX0A 3LF2A 1MMFB 4BKRA 4UJ5A 4EF4A 3C5WP 4FB5A 2MR5A 2FQQA 4P30A 4R40A 1WEHA 4CG3A 2ZS7A 1O7JA 3C3BA 3NH9A 1S9HA 4MGYR 3V3TA 3CW2A 1Z5OA 4QDTA 5AW8A 4IIBA 5HCUA 4OF4A 4EM6A 1DKUA 2QUJA 4LDQA 1FNNA 2VRCA 5IVPA 5EKUA 1EFRG 1FP7A 2GYWA 3RK4A 1LDNA 2OIGA 3ZR4B 2BM9A 2VAWA 4GICA 3UPTA 1SCKA 5DBEX 1V6SA 5HF6A 1EKXA 1S0VA 1MLDA 3PNKA 2CCJA 3ELDA 1WSBA 3I28A 1XA4A 2WLHA 3K0CC 3Q0IA 1B8VA 4TWKA 2QD1A 4ZIRA 3L01A 2ONKA 1PD3A 3LC0A 1Z6ZA 4Y6LA 3RRMA 2UUCO 3CUVA 3D5TA 5BWBA 4MVJP 5LVAA 1PQWA 2EQ5A 3OE4A 3UO8B 3TXXA 2PMBA 4OOFA 4OAQA 1M7HA 4DV7B 1P74A 5SY9A 3VSAA 3L92A 4ZT7A 3CMAV 4J7AA 2O2SA 4CV0A 4D02A 4F9FA 3KUDA 3DT9A 3QW4B 1TO6A 3OETA 4L8LA 1TJPB 2DW4A 4XH9B 4PF1A 2AZ2A 1XEXB 3MINB 3UGQA 1ODJA 2R5WA 3ETDA 1M74A 3W04A 1U3FA 1U9ZA 3CFYA 1LPSA 4MYCA 2Q3LA 1S02A 2X8BA 4YRMA 4XX0B 4TTAA 1BX3A 2H4JA 1VG0B 3A9WA 5B1BC 4DC9A 1T4CB 2XSZD 1E1LA 2AFIB 1TDJA 2PJDA 5AXDA 2JRIA 3CJHA 2PUCA 1Y34E 5IW8A 4MW2A 2I3GA 2FMFA 3PDIB 5KNBH 2O7VA 1TUIA 1ZNXA 3ISTA 5SYNA 1FNBA 4OK6A 4L28A 3ZLBA 4B5LA 4WAUA 3VYWA 2YIJA 1ODTC 1L7QA 1T10A 5DEDA 1HNZO 3X44A 3TD4A 4UVIA 2PHZA 1I4TD 1TYCA 3ET4A 1Z0JA 2HJSA 3FMFA 3GBPA 1PQPA 2Y0IA 1BKSB 4B8ZA 2J3IA 2BGTA 2FTKA 2OBXA 3FDZB 4ZQFA 1UR5A 4IBOA 3AEQA 4ODIA 2HDNB 4QSMA 1TJNA 2CDBA 3ROEA 1F7UA 1BYUA 3I0NA 3W8DA 2AC4A 3V33A 2I66A 2CH7A 3MPUA 2CLSA 4EARA 2Z3YA 4QJ4A 5JPCA 4EHIA 3R9XA 1WVIA 1U1CA 2JCBA 2ZD9A 3FYEB 1QC5B 1GTJ1 4M2LA 3KWMA 1FNCA 4E5DA 2GZMA 5LMZA 5TF0A 1T36B 4B32A 3H4TA 3E8GA 4ZRDA 2ZZNA 4H1HA 5EIFA 1SUIA 3FSGD 5EGNA 1GAJA 5HG0A 4WZBB 3HUUA 3D7NA 1Q1QA 1Z63A 3NBXX 5F2VO 4ZU6X 2A7WA 2E89A 3NETA 2DTXA 3FI9A 3QTCA 1SCNE 3ZPXA 3DE0X 3OJCA 1HT1E 1RM5A 1VL6A 1Q82W 3NEPX 3BXOA 1K4CC 1AP6A 1B42A 2AZDA 2HU2A 4WXHA 4GHWA 2ZWAA 1TNDA 3KOUA 2NMUA 1FNJA 2FPIA 2D1QA 2W22A 2XE6A 2GNAA 1WTAA 3BKWA 4O2LA 3CCEV 2QVZX 4YRNA 1LPPA 3D64A 3BEDA 3ICVA 3LPCA 3KYBA 4HNHA 1U0NA 1L7OA 5FPRA 2FZ5A 1VQKF 4MHTA 1JA9A 2IDKA 3ZQ6A 4E7OA 1SGWA 2DMRA 2LFSA 4KKXB 5F2OA 3CONA 3OCYA 1E2MA 3QKUA 3ESBA 1ZAUA 1G0NA 5LQNA 2ZYUX 1W9MA 1JLSA 2YICA 2AZXA 4H7DA 4FHFA 5I51A 1VYUA 5DZSA 1QHHA 4ASUG 3FLBA 1K5SA 2ACKA 3HWWA 1EFDN 4Y8VA 4OLJA 3K5WA 6AT1A 3D6MA 1U9CA 4G9GA 1LPNA 4REOA 1CIPA 3OT1B 2NM0A 3H87A 1MDFA 4OPHA 4A27A 4MW7A 1YOBA 1KDZA 2WNSA 3NH6A 5HWSA 1W34A 3NAZA 3RC3A 4U00A 3RVPA 4RMHA 4AMUA 4KPEC 1BN6A 1DE0A 2V6GA 5BMVA 4LF5B 1H5NA 1OT5A 2VHUA 1NQAO 2KI5A 1GN9A 3C0KA 4LMRA 1YJ9F 2D2XA 4QREA 5CCBA 1SA0A 5KVVA 1GKUB 3OOHA 2KPOA 2R62A 4F04A 4QUHA 5BW4A 1IY1A 5KQGA 1SD5A 1YQ9A 3CXCU 5ITVA 5KYXB 4BEVA 1BN7A 1NL3A 3L0YA 5HW0A 4Y2VA 3OOEA 1P0FA 3AEUB 3WLFA 2EW8A 3C8MA 4KV7A 4MWGA 4IZIA 4YC7A 3QFFA 1LI5A 2C94A 3EVKA 2PZMA 4TUYA 4FFWA 5JASA 1B8UA 3R8CA 3SF0A 5BXYA 1IOWA 4FNOA 1XX6A 3UAXA 3MLEA 5A4FS 3GYQA 1U2PA 3F1KA 3WG9A 1RE0A 3RSZA 3MXTA 5IANA 4NBWA 2YHIB 1JJ2U 4PSDA 1SPBS 4NNPA 3LUAA 4PX9A 4URZR 1U97A 1QH9A 1W5BA 3WI7A 2GZ2A 3LWBA 3ZDCA 2KM1A 1YDXA 2Y4UA 2GJKA 3A14A 3BXEA 1F2VA 1JW9B 3MJEA 3COZA 2W8BC 4B0OA 2HA4A 2UUBB 5CXUA 2K4MA 4NR0A 5M04A 4E21A 1FTYA 4EFLA 1KK3A 2E55A 4AJJA 4RAIA 4UC0A 3M1XA 4UVBA 3NHJA 2HHLA 3AKYA 1E3TA 2A7XA 3KU1A 5EKXA 4MRSA 4RCYA 4DRXA 1VYHA 2Y1LA 1NE2A 2IBSA 3E15A 3UCEA 5HJ2A 5KYKA 2FPXA 3I58A 1RJEA 3ZI4A 2IH5A 3GLGA 2BELA 2XHEA 2E74B 3F7TA 4Z7NB 2BV3A 2E18A 2X9VA 4TTPA 1RLIA 3P19A 4DSNA 3MHHC 3ACBA 3NJRA 5DYWA 2CZCA 4UNQA 3VVLA 2IPXA 2CTPA 2ZOVA 2ALEA 3JVDA 2P4UA 1EN5A 3KK0A 2I7CA 1W36C 2VVTA 4A0GA 4PHCA 5HQTA 1G21A 1R8QA 1JBEA 4RLQA 3A9UA 4HNUA 3SX0A 1CQJB 1DUIA 1P7VA 1R10A 2AD1A 2JFGA 3K04A 2W6JA 2AQIA 4X1KB 2RONA 5CYPA 2FOIA 3VX4A 2WSMA 4XVCA 3OPYB 2VZLA 3QWAA 2J4CA 4B4UA 1P7GA 2GPTA 2PQMA 5FOQA 4EX7A 3DTUB 2XRYA 1RLJA 1G98A 3EQZA 5U1PA 1IAQA 2SBTA 2F43A 2WUVA 2BFFA 5TPWB 3QTTA 1O0CA 3AJ9A 3DDWA 2PD6A 4I55B 1ESNA 4L3VA 2ON6A 2QMQA 1JIIA 2AXNA 4WKBA 5ECDA 3E7PA 1NBHA 3J7TA 4QT0A 3C9TA 1XYGA 5BN3B 2YDYA 1XK6A 2BD0A 4OXIA 1KEUA 1L5QA 2XITA 4JYYA 4FZ0A 2GN9A 3QE4A 4N0EA 2Q4TA 4QDOA 5AJTA 4C3ZA 3J81M 3D1JA 4OKSA 4DARA 3T5GA 3KT0A 4MEAA 5F5LA 3AVUA 3PNMA 3SU8A 4RKQA 1BFDA 1RYYA 3EPRA 4YXWA 5JDCA 1NUSA 2JGLA 2VNSA 1KC8W 2AEFA 5J4HA 1ID1A 1NW6A 1SHZA 2KGWA 1P8AA 3A7EA 1JZTA 1DBIA 1E0JA 3I2IA 1M2KA 1OIWA 5K0JA 1U1FA 5JJ5A 3Q7TA 5E7QA 3IA2A 2EINC 4K35A 4L9RA 4MP8A 3R7BA 1R0BA 1QTNA 3KDSE 1OWNA 3OE7D 2R6AA 4UW9A 2VJBA 3NTXA 1KAOA 2C4TA 3RKUA 1YHYA 3CLVA 4P53A 4CMJA 1Z15A 1UJMA 2GHRA 1FL9A 1DEOA 4R1OA 3IUQA 4MKFA 2RKOA 1W0KG 1OXXK 1FXKA 1AF7A 1SBNE 2ZB2A 1Y8QB 1YXMA 4NEGA 4LZPA 2C57A 4H9GA 1G42A 3K7EA 3DEIA 1D4ZA 5JARA 4AURA 5LQRA 3WC4A 4P4LA 4EKIA 1CQXA 1IQUA 4XGIA 2F7SA 3INNA 1RADA 3AF2A 4CN8A 2MTBA 2UUPA 1RW4A 4RZ2A 3WNBA 1A97A 3BXXA 4Z3KA 2XAQA 2C07A 4WK0B 1QTQA 3ABLC 3LDDA 2IBZH 4ILKA 5FWYA 4RVHA 2XOKG 3LQ2A 1TTQB 3MWJA 1LV7A 4JB2A 1S72V 1QV6A 2OHXA 1QVGF 1SHKA 3TQCA 5EFZA 2V4MA 3NB0A 1ZGGA 3VQWA 2RAFA 5I9SA 2DOSA 3NK6A 2OYRA 4C9BA 2WNHA 5BSWA 2LDXA 3W8NA 4CG2A 5TLSA 1R5JA 2VZ0A 3MJ4A 4JS0A 5LBTA 1GZ0A 4FLZA 2QEXF 1PFWA 1PT9A 1FX1A 3GG2A 1XZQA 1DBQA 3PEUA 3VTZA 2BFOA 1VL5A 4QU5A 1Y66A 5I6DA 3RWBA 4LS3A 4ZIRB 4ZAGA 4QU0A 4TXLA 2VIIA 3AU8A 3FNQA 1BC5A 3NW9A 4JC5A 3F9IA 4LYYA 2NR5A 2CB0A 4I9GA 1WVGA 3U4GA 3NHUA 3OQ1A 3ABUA 3QP9A 4PDRA 3OSZA 1X3SA 2UUOA 4JWKA 3CT4A 4V1CI 4YO8A 3HRIA 2FLWA 5K51A 3I9NA 1PEKE 3PHIA 3EUEA 3WKCA 1EB8A 4GOLD 2ET6A 5JNSA 5KNDH 1J5XA 1EE1A 1EJBA 1QFYA 4FCCA 3F2IA 2FUEA 3LBYA 1P6QA 5KWEA 1RQ7A 4XSGA 3BJMA 2O2JA 1C7JA 3VU1A 1ACMA 1S76D 2Z43A 3Q5DA 2DZDA 2OT5A 3B1XA 1L0NH 1GCOA 1TUGA 3AG3C 1XV2A 1KAEA 3WB1A 3NS7A 3ZGOA 3O82A 5JC1A 1WXXA 4LGVA 1XTBA 1FXSA 2IS1A 3E20B 1YKGA 2Y0DA 2ZCJA 4OO3A 4RKFA 2WP0A 4A8JA 4QEZA 1UDCA 1A0OA 1UKBA 4CF7A 3CJHB 3HCWA 3K2IA 1L7EA 1QLJA 1OUMA 4F5WA 4NENA 2VJCA 3WGMA 1F4LA 2V7VA 1QIKA 1E2FA 2D2FA 2ZK7A 3DMTC 5BN5B 3GVXA 1RJFA 4P9PA 2QUHA 5BY1A 1QLHA 1MV8A 1GO1A 1SZCA 1H6AA 3U6BA 2QU7A 4XSHA 4QGAA 4KNVA 4L4ZA 4HZIA 4NECA 2R1TA 4CPDA 1P8JA 1Y4MA 1GZ5A 5KTMA 2JAXA 2O1WA 3LOUA 1FE8A 2EWWA 3L7CA 3BRQA 3F5SA 3VKUA 4UVCA 4CBCA 3B51X 4PGAA 2CH7B 1Y37A 3HTNA 1H3EA 4KJXA 5JAIA 4QIWF 2PKXA 1G8SA 3BXZA 4GLBA 3B1YA 5FEUA 5KWIA 5A6SB 4X85A 1QUEA 5IUJC 1RZRA 4ZZ3A 2Q4EA 3CC4V 3ZIUA 2C84A 1Q7YH 1ZN2A 2LXNA 4IOJA 2XMCA 3OLWA 2F59A 1C4OA 3GMSA 3WNZA 5FUWA 4QXQA 2P75A 1CUHA 1LBSA 1VP3A 4EQ6A 2ZR8A 3ZN1A 1VLMA 4PM4A 2IYTA 1QGUB 2I3BA 4QDZA 1F51A 4RSMA 4U3FH 1T6NA 2OXCA 4DMRA 4XCXA 1RBQA 3L07A 1Z6XA 5EIAA 5K6TA 1WUTA 2QLJA 2Q1YA 1LS1A 2ODQA 4XJXA 1IEQA 1YQEA 3U1TA 1CB7A 2NU7A 1KI8A 1WIWA 3G0IA 4L22A 1VQ7V 2K1SA 2V03A 4BCBA 4A0SA 3CC7V 1W57A 2HCTA 4WCVA 1SELA 1UFOA 4IIJB 1S9DA 4GM4A 1NTKH 1T9DA 4B2IA 2V8OA 4JV5O 2EZUA 1RPOA 3SHVA 1IJBA 3ICQB 3G89A 2D2CB 2EIJB 4GI7A 4WD3A 5KAFZ 3ZDBA 4AS1A 3HPQA 1NXTA 3NHKA 2O2XA 2XXAB 3RVOA 3DFUA 3PN1A 2E37A 2NT3A 4UTVA 3IEQA 4RTRA 4K5QA 4PBTA 3FSEA 1V55C 4WF9V 3A58B 3IJEB 5DH9A 4YDQA 5J9PC 1XR3A 3IKLA 1Z8NA 4O2BB 5FFMA 4W1PA 4UKDA 2PLWA 3IJ4A 5D5HA 1QHEA 3QO8A 1T1GA 4LJ9A 4IOMA 3VC1A 1DOZA 4BE4A 3R6TA 5ADUS 5KHKA 4GOOD 3DC7A 1NFFA 4MV5A 4UCRA 1ZX3A 3RVSA 3AFIA 2X5NA 1H2KA 2DR2A 1L6RA 2R11A 1ULHA 5I5GA 1FP6A 4IQ4A 3SC4A 4O4JA 3LBNA 2PX3A 1RRMA 1IBMO 3V4ZA 1TLFA 4UV8A 5IF9A 4JR0A 1LSJA 1J9ZA 4GXQA 1OR8A 1XZDA 4LYFA 1ZH6A 2ACWA 2HS0A 3S8EA 1KMIY 1N0JA 4J0FA 4NOKA 4NPCA 4FGLA 1Z2EA 4LAFA 2YV3A 5CNIA 1DAKA 1UBGA 5CX4A 2HX1A 5FXMA 4I3GA 2J5XA 1IC6A 4MINA 1CUJA 3F46A 4EECA 3FKSG 5JYCA 3HSYA 1ST3A 1NH2D 1YB7A 4PO8A 3AK4A 4BS9A 2I62A 1KQPA 1YQQA 2QRGA 3R1IA 3M5PA 4TM7A 3J81N 4YCSA 3HJNA 4EUFA 4M87A 1KRXA 3D36C 4DSOA 5IWCA 2NZVG 2V5AA 2Q45A 2QX4A 3JPWA 3DAYA 2QM0A 2D8AA 5L95A 2A9QA 2HN9A 2OIEA 5IWAO 4RVFA 1VJGA 5FL7D 3DEHA 5BYJA 4F7DA 5JNWA 2I3AA 3QVSA 5JTUA 4Y0VA 5F51A 2QN3A 1VHWA 1MC1A 2J0VA 2ZDGA 3HAXD 5KU7A 4I8IA 3WK4A 2I1WA 3KKPA 5LBUA 2AX4A 3KAQA 3QXXA 4Q34A 5BSGA 1C4KA 2Q3BA 4IRXA 3ZX5A 1CUUA 3UEOA 4CMCA 2B98A 4UCWA 1Z8FA 1XP8A 3P27A 1OAPA 5SZJA 1Z0FA 3GLGB 1CK4A 3WJ1A 2VBCA 1D07A 3MS2A 2P30A 3UPDA 1GGJA 1SFRA 3KKNA 3ODGA 3MILA 3MJRA 4J3FA 3HP4A 3QH4A 4EMTA 3DKRA 1ECLA 2XCOA 1CT9A 4G4SO 5ELXA 2O8FB 3QFTA 1NMQA 1H8EG 4WZ6A 3E9MA 2FX3A 1ZOPA 3UA4A 2JW5A 3B2EA 1J2YA 1RDFA 2BFNA 1Z33A 4FNMA 1NJGA 2H63A 4RQUA 1KQSF 4GKAA 5GGXA 4OMCA 1OJHA 1QIDA 4YAKA 2VUIB 2CB9A 4QUBA 4ID3A 4I9UA 1Z2OX 4IGEA 5HDBB 3U40A 5CLQA 3S40A 1EM1A 5HMMA 2ARHA 2AN9A 1FUEA 3BABA 5A5DA 4JDUA 4MWSA 4PWYA 5JZ9A 4KSBA 3FZNA 1WQ4A 1T3SA 4LXQA 4QHYA 3O9MA 3GPBA 1AUQA 2H2FA 3PIIA 1IZ3A 3S55A 4GWLA 3A6EA 2BFFB 1VJ1A 4A2WA 1LPMA 3MPOA 3CE6A 3PGXA 1NHWA 4DWWA 4NABA 1QMPA 4P7KA 1CS4C 3OCXA 4A16A 1H2XA 1ZNQO 1K9VF 2A0UA 4E32A 5JS8A 3KFXA 3T1OA 2CSLA 2AUNA 2DMXA 5AKGA 2FTKE 4Q3KA 4J4BA 4L72A 1CB0A 3OZRA 2EJUA 4DXDA 1UFQA 1NQWA 2WW8A 4BLTA 3C5HA 2YUTA 2IXGA 2LFRA 1NTOA 2Q8QA 3AG4B 4W5NA 1A2OA 4MROA 1YRAA 1PGPA 1ETHA 4BEJA 4GWKA 5HM8A 3OTQA 4ARSA 1DB3A 4Y1EA 4XQ9A 1VE7A 3F0EA 2WG1A 3ORFA 1H4TA 1RQRA 3OEEG 3PZBA 1VQ9F 2VWQA 4NYIQ 3FXAA 2EERA 5HJ7A 4OFBA 5HQ3B 1W5FA 4HVCA 5B53A 3NKVA 3KXPA 3ZWAA 3BN3A 1CR4A 5A7HA 1P6XA 1W49A 2UAGA 4WGGA 4ZVRA 1DKOA 1BKDR 3AJDA 3FYTA 3E1YA 1HTBA 3FPFA 3QY9A 1EBFA 2EARA 3Q0EA 4DK1A 2WIJA 3AO0B 1E9VA 1GSAA 4QOIA 1OROA 4JEIA 5AFSA 3KKMA 3FJYA 5DGCA 3UMCA 2B1RA 4FK5C 1K9SA 4OHMA 2ECPA 1IBKB 1FXKB 1YC5A 1GILA 4OIMA 5D51S 1UOEA 3EDCA 3IMCA 3E0XA 2EGGA 2QPAA 4ND1A 4RSGA 1JSXA 2WLKA 1G4AE 3RBZA 1EVIA 3ML1A 3KP1A 5CLLA 1P5ZB 2OV6A 1RCFA 2FSVC 4TYYA 3L6OO 1NI3A 1YCGA 4QDKA 2F1MA 3QLUC 4GCZA 3QEKA 3KQPA 4RKYA 3UBMA 2LBTA 4NU8X 3CJRA 3DE3X 1U0FA 2AQHA 4FGSA 4MUMA 2YXDA 3PNPA 2DQSA 4PZAA 2Q0SA 5AVQA 4OQDA 3T35A 4OJQA 5CW1A 3CVJA 4DLLA 4MVJA 3COVA 3QG1A 2SKEA 5DBIA 3I2GA 1VFPA 1RWVA 5KJ1A 1M1XB 2KLHA 3NT4A 3RASA 1VBKA 1DP4A 3H2IA 4YGXB 5E4YA 3E9DA 4JYMA 3PNLA 4LF7B 5ALUA 4AO6A 4CCWA 3IOBA 1VMGA 4M1MA 1KI6A 1CDEA 4BMCA 3EEYA 1T13A 2PV0A 3GDFA 5B58T 2N47A 2FHPA 4XX0A 5C1IA 4LCJA 3TPFA 1BYIA 1DRVA 3ZGVA 3Q1LA 4DR3B 1T4CA 4QYXA 3M2PA 1B16A 1NR1A 2QUAA 2AFIA 3U31A 2FF7A 5EI5A 4B3BA 2J9YB 3PDIA 3LT2A 1S5HC 5LQUA 1RTKA 2FR8A 2OOKA 1NU1H 1TYAE 3QBDA 2XCLA 2O8VA 4YLYA 1M6HA 3KPVA 1B15A 4L74A 2CZWA 4D92A 1VMAA 3EXG1 2G9NA 2GSWA 1DT5A 4K2AA 1IBRA 5G1PA 4YRIA 1TVCA 5LA6A 1VLQA 3FDZA 4YV2A 1U7OA 4EA7A 4UTNA 2YR0A 4DM3A 1I6WA 3OLQA 3EVTA 1CJSA 4WKCA 3NHLA 5BT8A 3PKJA 2POQX 5IAEA 9ATCA 4DA0A 2HGSA 1L5YA 1J33A 3IVAA 4AY5A 1WULS 5HTKA 3FCXA 4W1RA 3CWCA 2DFDA 4NENB 3RIXA 3NLLA 3R0PA 4MCJA 1O2DA 2QRPA 1E0KA 2H8KA 3JZMA 4D44A 3RSQA 1QC5A 3SAJA 3K8OE 4D4LA 1QDLB 5EZ6B 4RIIA 3WVNA 4ENTA 2PSEA 4YMUA 5B3SC 2GLUA 4A10A 2LJ2A 2GDSA 1MUUA 1JR6A 4AJ1A 4WZBA 1F48A 2D1FA 3GUVA 2JZNA 2NG1A 1F8FA 4FW8A 4TRNA 3FD6A 1KKUA 4DY6A 2UYYA 4AYWA 1X9HA 3FOZA 5JMPA 2FN3A 3B38A 4OSPA 4TLMB 1P2SA 4TSKA 4OMUA 1ZBQA 3U7RA 1QK3A 4MQEA 4POAA 5E1BA 3BIOA 2OESA 4HYQA 5JPDA 3VDXA 3SE7A 4K6FA 2IITA 2HK7A 4M9CA 5CDFA 4KR2A 4TMVA 4C0LA 4BYMA 4MUXA 3TZ6A 3WX0A 2RH4A 2IEAA 1B14A 4LE1A 3MHTA 3UM9A 4IPTA 4DA6A 4M9ZA 2HV8A 3FB5C 4X45A 3KXDA 1Z5VA 1YB4A 4NMMA 1Z22A 5ED4A 3CG4A 3W7WA 3GT4A 5ALOA 4FX5A 1FRNA 4Y2HA 1THZA 4F2HA 2VCEA 4E07A 4RL4A 1KEKA 3MWKA 2Q5FA 3I9V1 4KJZA 4FSXA 3S2FA 3FB6C 4Y6GB 3K9CA 1EE2A 3GFBA 2AZMA 3A1EA 2YHBA 1TA9A 4EMSA 1GGHA 4IHJF 3GROA 4AZ0B 2R6R1 4GAEA 4EFKA 1TAEA 5KTKA 4MLDA 2R8RA 3U0BA 3R0QA 3TLGB 4B7CA 2YYSA 4OYYA 2W8ZA 3DEAA 2H4XA 3DE1X 3NUGA 3VDQA 1QO9A 3WJAA 1ESDA 4EGFA 2QTSA 3ODPA 3R5XA 1THTA 2XUPA 4G0OA 3KVNA 3ZEAA 2B0CA 3FPCA 3LQQA 5KYXA 1Z74A 1T8RA 4IXTA 5AVVA 1RP1A 4MMXB 4DEYA 2XT9A 2HA6A 4BFZA 5AQEA 3AEUA 2NGRA 4ZGBA 3GJ0A 3FNIA 3AB7A 4L87A 5FT9A 1R3IC 3GLSA 4I4NA 3OG9A 4MW5A 2IBMA 4P54A 2QLBA 4RPGA 4OH1A 2QM7A 3JQBC 2P9YA 4DWVA 2B6NA 2Q50A 2FPKA 2HSWA 3DDOA 4HJRA 1UK6A 3GJZA 3JAKA 3P9YA 1HFJA 3ES9A 1WP4A 3HP7A 4X65B 3R5JA 1J95A 4O4JB 3KLPX 3PGKA 1JIKA 2IZ0A 4D6XA 3LU1A 4UNSA 1WD5A 5K99A 4LC0A 1LRLA 5EA2A 4A5OA 1Y7PA 4JJIA 3E8FA 1VIAA 1GQYA 3AFGA 5TJHA 4JC8A 1OBHA 2BJHA 4PSKA 1HL3A 4P1ZA 1SUFA 1L1EA 3ROQA 1G8PA 2HEGA 4CKXA 1C14A 4YONB 4J9ZB 3FLMA 1W87A 3P0FA 3HI6A 4PYMA 1BXGA 1VQPV 1KIAA 1YDHA 1BT8A 1E1YA 1DJNA 1YNOA 2A86A 1NJFA 3UMRA 2Z6VA 4OHRA 1IPAA 4ZYYA 1JDTA 3WL6A 5EQDA 2DT4A 1RM1B 3ZIDA 4INAA 5GTHZ 1YDWA 1VQ5F 2Y69B 3WLKX 1ZOIA 4M0UA 3P9KA 2F9MA 4X9XA 3B3QA 2BEWB 5DNDA 1WVMA 3M2TA 2NSYA 3OZEA 1PPJH 1KU0A 2BF4A 1VQ1A 2FKAA 2D74A 3KTOA 4B45A 3VU0A 2H06A 2P4EA 2ZDHA 3JQ6A 4D6YA 4C30A 1ULAA 1JLRA 2XGSA 4DV6O 2I78A 4WSOA 1Q92A 1RWKA 3EVBA 1RLOA 5HGXA 1J9EA 2B69A 5HCNA 3RIHA 3E58A 4LWOA 2O57A 4P6VF 1UBEA 1E9CA 4L8VA 3BZBA 3O3CA 5EKDA 3ELWA 2PWYA 3LNNA 4RJJA 4PAQA 2N74A 1B0AA 1FNKA 1V41E 4HAIA 4X64B 3C9RA 4JLSA 4H35A 5EB1B 1D5AA 1WUYA 4PV1B 3DXXA 4JI1O 4KHPO 2YJGA 2CDCA 1ONSA 1X8XA 4I55A 4ICIA 1OTXA 3J80M 1BQ4A 2ZU0C 4G07A 5TV2A 4EG8A 4WFKA 2A3NA 4OIFA 5EJ2A 1R0SA 2JBHA 5BMOA 3FFWA 3R5TA 2VQEO 4LRTB 4W7IA 1HFEL 4E5MA 2RGWA 1DXYA 5JZOA 2PD3A 2MSNA 4XGKA 2ATXA 2WC1A 4FMCB 3PQ5A 1ONBA 3WB0A 5AOCA 3VR2A 2ACEA 4YRPA 3PC8A 2A0WA 5LZ7A 5EAIA 1XZMA 4D3SA 4TL6A 4EEQA 4Q9AA 3H1KH 1D6JA 3H5VA 2R6DA 1D7OA 3NVAA 1KC8H 5IEJA 2I22A 4XM2A 2NPIA 4XVUA 3OEWA 1TVKB 4KP4A 3HLKA 4LBVA 5B1DA 4L2IA 4QFCA 3DAOA 2UYQA 1XZJA 3ZGLA 1KZHA 4D98A 3ZH9B 4N49A 3WMFA 3RCBA 1KYQA 1P29A 3HPRA 2JAWA 2CLKB 2HLDD 2WWGA 3P8ZA 5EBWC 3NASA 3Q8KA 4JP5A 1MJ5A 1KP3A 4DR7O 3B1FA 5AWFC 2LBPA 5DVZA 4BKUA 4NS1A 3VO9A 2QQGA 4HRVA 4RHEA 3VOSA 4JUBA 4JI7O 3WGIA 4FW9A 1K5PA 4B3FX 1Y8QA 3EA5A 1N57A 4MUBA 4CMEC 3BTVA 5IYCO 1RTTA 4CR7A 3LFTA 3TNDA 1XUQA 1TLTA 3HL0A 4RYDA 2FG7C 1BGVA 1XL0A 2KYRA 4OQEA 3ADDA 5KSZA 1TYDE 1OFUX 2VGNA 5LSAA 5AM5A 5CHEA 2X8WA 1MA0A 2OO5C 4K9KA 2Z3VA 6NULA 4C0BA 2J7PD 1DIAA 1BW9A 5EK0A 4OSEA 1FLNA 2ZJ4A 4C5BA 5DFAA 4UBKA 2AN1A 3G0OA 4ZT5A 2D59A 1M2FA 4B9EA 3E81A 5HRUA 3M34A 4RDCA 3SIVA 3LBFA 2XSZA 4U5XA 5AJZA 3ESQA 3PX7A 4XYMA 5E3JA 2H52A 2D0IA 3LQ4A 5ER6A 1NJ6A 3NDPA 1JHQA 3G6EF 4WV3A 1B93A 4FN4A 5DHPA 1PWHA 1L6IA 3TSZA 4RFVA 3CUSA 2PKWA 3A70A 4JI2B 3PGLA 2F3SA 2HUNA 1A5TA 1QB7A 4OJKA 2DFPA 2GXUA 2YN4A 3UW1A 1JP7A 4ZGWA 2A14A 2Q0OC 4EY5A 2BMEA 1ZQ1A 4MUJA 3I04M 1ZO8A 4OFXA 5LDGA 5IZ4A 4AUEA 2C97A 1QHGA 2DP4E 1MV5A 4OX9O 2ZB8A 1KQFA 5E3HA 3RE1A 3GVMA 3VUFA 1HDIA 1M2GA 1RSZA 3CYFA 1XI2A 4DJTA 2AC7A 1W1UA 3TGUH 1YNSA 4NKRA 1SUEA 1IB6A 1VPVA 5C4GB 2PZJA 5IKEA 1PR2A 1R9GA 2R5FA 3JYHA 5H9VA 4JJGA 3FMVA 4DVJA 5C8YB 2QAGA 2QWOB 5FYDA 1ABFA 1YA6A 5IY5B 1E3LA 3S2IA 5C7LO 2R85A 5I7AA 4FXOA 4E2WA 2BC9A 2EILB 3K5IA 4JZGA 5KSYA 4LVOA 2QX9A 5CPFA 1KI6B 1DO0A 2VT2A 2C03A 3VQYA 3LLCA 2QJ1A 3TLZA 2Z08A 2F93B 4DIUA 1FQOA 1YZBA 3FSGA 3CS5A 2OAEA 4FQ5A 1V1MA 1Q6ZA 5AG2A 2Q6IA 1B8PA 2EIMB 2IU3A 5KJEA 4C7MA 2AN3A 1WKVA 3QUAA 4FFVA 2Y76A 5JAHA 1E60A 5FWAA 2E85A 2PX8A 2D1YA 3RJTA 1EHIA 5C31A 4WY5A 3AL3A 3WLHA 3DNMA 4PZZA 1YUNA 4YQYA 4HFNA 4HH3C 2C8JA 2DPGA 5GTIZ 1V47A 1I9CA 3K1AA 1FD9A 4BU1A 5BN5A 3IJPA 3G2MA 3RS2A 2IXFA 2PI4A 3NPMA 1KORA 3C6BA 2YC4C 1RPRA 1Q7EA 1VRVA 4JIMA 3E1SA 4OQNA 1X1QA 3FYDA 1F2DA 4TLCA 4AF7A 2P4KA 2PGJA 3F47A 5CJ2A 3CCLV 1J5PA 5LA6B 1FB5A 5TS2A 3B6KA 2F17A 3PFHA 1T1EA 3HJCA 1PNTA 2Z5UA 1I1QB 1SG6A 1WPBA 3AF3A 4V0RA 1M8PA 4FDAA 2Z1FA 4EJMA 2FY8A 4BR6A 2CBGA 1VA4A 4HPWA 2V8BA 1ZN7A 3TMAA 2M6LA 4CMKA 4X7PA 3BIJA 3P52A 5FTMA 4OV6B 5A6SA 4ISCA 3O8OB 4F4LA 1OMOA 4YJHB 2ZBEA 1G4YB 5TSDA 3FIJA 3IBGA 2JFBA 3CRVA 2X4DA 3LQKA 1SAYA 4MWTA 4LV5B 4EUHA 1ZCFA 3FCCA 4AJHA 2NO6A 2CGOA 4N82A 4QGFA 1WMSA 3CH7A 2H4YA 4Z9AA 1EUDB 4RS3A 4C89A 1QWSA 4AJKA 4AT1A 1QGUA 3SOZA 1VKHA 2KTUA 4G4JA 1HEYA 4ILEA 2G5TA 4JLKA 1BJRE 1RXEA 2HHHB 2PFKA 1K06A 1JV2B 3K96A 2TMKA 3E2MA 2WTXA 4MQEB 4X6YA 5ALJA 1DAIA 3MZ0A 3WGHA 4U6QA 3KHTA 1JJOA 4IIJA 1UQUA 5LQMA 4INZA 2WZCA 4G5YA 3CPQA 2LO1A 2PYIA 3NVKE 5TVKA 1YDEA 2ZI7A 2FGYA 1BNCA 1IM2A 2OHVA 1OI3A 1MXFA 1G7TA 4QE9A 2CNNA 2LUOA 4C0QC 2F3QA 1BEUB 5JJCA 3BG5A 2XXAA 3NMUF 4MYTA 4F12A 2EJCA 5T3YA 4EB6B 3DM9B 2ZR0A 2VSNA 2FB5A 1H8HD 3HBNA 3K2BA 3OX3A 4O2BA 4R9RA 2JDID 2OTLF 1YR3A 3GRAA 3T41A 3HWSA 1SK9A 3RVDA 5DT9A 3LG2A 1E4EB 1GRVA 1N34O 2Q0XA 1JY8A 1PW5A 1Z38A 3PWKA 3E7WA 4S1PA 3H6HA 3D8TA 4GPEA 2I4RA 1NBWB 2WJYA 3G2IA 4J0IA 3IEVA 1OC2A 3TSWA 3ZZMA 1V7PC 3CCQF 2DYSC 3SJBC 2P5YA 2PUTA 1ZWIC 3HACA 4ZK2A 3DSRA 1MQAA 3ZXYA 5KJFA 1UKZA 2I2AA 4JU9A 1YRYE 4KODA 4PNEA 4IZ6A 3J80N 1Z6QA 3SYNA 5DECA 2Z8YM 2XE4A 2IJHA 5AI4A 5AI5A 3ABIA 1WDTA 3Q3HA 3WGOA 2EKLA 3TIVA 5E7JA 2B2CA 4YJDA 1TEXA 1WPRA 2WFZA 3PDWA 1X7YA 2ZKOA 3WXBA 1ACJA 1GG9A 3LLVA 4QYIB 4ZVMA 3UB3A 2FOXA 3LO5A 2GWRA 3C3KA 1KJQA 1HDCA 3KVVA 4TKUB 3W4IA 2E3CA 4BNLA 5A9SA 3ZZUA 4MI9A 2HBYA 1Y9AA 2QX6A 3D0QA 1NVBA 4UAVA 3AI1A 3NHBA 4J75A 4EW3A 3JAKB 3AWDA 3SXUB 3A6ZA 4B85A 3AKZA 3S2SA 4D9IA 3VBCA 3PXEA 1ZXLA 2QXUA 4BY9D 4LWQA 1CLIA 2EKBA 4UV9A 2F3UA 1IURA 2QTFA 4YR7A 3K0EA 4RULA 3D00A 3HR8A 1WDMA 3UO2A 1JN1A 5JVDF 4JX8A 3G2QA 4KFUA 2RHOA 1KDRA 4GKJB 1V54C 4YV7A 2P2NA 3ONVA 3MSCA 2X0NA 1R6KA 4G5SA 3ZV3A 1N2CA 2F23A 1R7RA 4E15A 3WSWA 1IY0A 1P0PA 2QAJA 4I4LA 3WG7B 1NIJA 3MCWA 2W43A 1TVMA 2A0YA 5JMWA 3UA3A 3FCOA 1ADBA 2EBOA 4G24A 4ZYXA 1BXGB 3VPGA 2PA3A 3RSOA 3RTAA 4LYAA 4CT4B 4AKGA 4PC7A 3PFFA 1I33A 1BSMA 4FC6A 4DMKA 3PWTA 1K8RA 1F1JA 4RQAA 2GV9A 2JFQA 4LZNA 1XSEA 1TK2A 2ZR2A 4IGGA 2C29D 4AHCA 1ZI6A 5CDYA 4A3SA 1IUNA 1RYDA 3H9JA 3NBYC 3DLHA 3K70D 3F4BA 5A4JA 2V9PA 1H1TA 3KRTA 3STYA 2O8FA 3LPAA 2CHEA 3HVKA 2A9OA 3C45A 3OOSA 5EHGA 4PG6A 5LL6P 1YZFA 3OTOB 5C34B 3QX9A 1QFXA 3W9SA 1IY8A 1USVA 2ONCA 2IC5A 4FDMA 4ZYTA 2PF4E 2J48A 1COMA 3R75A 1OXVA 2P0EA 4Y7CA 4CLHA 1QQ5A 3CIOA 3M1IA 2AFIE 1N6OA 2SHKA 3Q1KA 3X2FA 1XILA 5JJJB 3IQDB 1PHRA 4HDQB 3KZKA 2JPDA 4JOSA 5HRAA 3OE7A 2XH8A 2C3UA 4X8OA 2XWQA 4BZPA 1H0HA 4EYSA 3O65A 1KC1A 4C21A 3LYLA 3ZDDA 2IGBA 4R1LA 2BY4A 4IV5A 1FY2A 4LC9A 4MLPA 3P2EA 1PIWA 1GYRA 1C3JA 2D3OW 2CK3D 4TYMA 2EBFX 3WZMA 1I7FA 2IIVA 4M54A 3H3FA 3TZHA 4YHHB 2AJ8A 3P2IA 3CCVF 2I7VA 4U9HS 5CT8A 4DYVA 2JCXA 2UYGA 1ZTEA 4AJ2A 3CLRD 4QPJA 4CEIA 1KPIA 2HF8A 1W73A 2P9TA 4HWSA 3B2QA 3PA6A 5JJKA 1YS1X 3TKYA 4ENSA 1J49A 1JPVA 1FW6A 4Q7QA 1KI9A 1WB9A 2FL4A 2IYNA 5JSUA 1GN8A 3P71T 5JC8A 3OWOA 3WJ7A 4L2IB 1AKNA 3DM5A 3QJYA 1M8JA 1QZXA 2CJYA 4F2PA 2OXIA 1ODKA 1GADO 2AE1A 3ASOB 5HQ3A 1NZ6A 4GIBA 1X4TA 5J58A 2NVUB 4R2KA 1VQOF 4OFWA 3Q3GE 1F14A 4DDWA 5K3EA 4QODA 1JFRA 3EWNA 4WZBE 3QPCA 4OGKA 2DWOA 3PG5A 2A58A 3SPXA 1B6TA 4LHEA 3CUWA 2QF7A 3VR5D 3L5OA 3VZQA 3Q7IA 1DTWA 1MG0A 4AECA 4HCJA 2HF2A 1ZCZA 3AJAA 4MVZA 2IV7A 1TL7C 3PUYA 2DQ3A 4JLJA 3KVOA 1KQOA 3PQFA 1ZJWA 3ELUA 1SQGA 5JW6A 3P9PA 4NB5A 4EG0A 3I0ZA 4C3OB 3IVXA 3OCCA 4MGKR 2Z2KA 3A9TA 1NLYA 4ZVQA 4B3TB 1XEAA 3L7IA 4M0CA 3FYUA 3LSUA 4IGKA 3RDPA 2AFVA 4W5QA 1NS1A 1F4NA 4YCJA 1M4UA 3HM9A 1GRRA 1MPTA 1Y1TA 5L3FA 4BCDA 1KNJA 2GPNA 4RMGA 1AH2A 3IKMB 3FOWA 4TTSA 3WQRA 1RM3A 2O7RA 4NJOA 4KQJA 2PJZA 3PNYA 1CSEE 1BW9B 5DRTA 5LR6A 5BPFA 2V6BA 2DFLA 1I80A 4A0RA 3B7WA 1A2QA 4EF6A 2YIBD 1KYOF 3H2SA 4CNBA 4GI2A 2C0QA 4A6EA 4UDNA 3KEFA 3TD3A 1I7NA 2VXCA 3K3WA 2R4TA 2X9QA 3ZJYA 2PKQO 3EEOA 3EUWA 1QHYA 3D0OA 3L3BA 3Q5GA 2BMFA 1M2WA 2XYRA 3TSCA 2VSYA 3RD5A 2E76B 4E51A 1T43A 3S44A 4M37A 1PK9A 3BPSA 1PAUA 4TMZA 5KHAA 4GYCB 2N1MA 3RAFC 1F0NA 5EZ5A 3BDVA 4HQ6A 1KA9H 4JU8A 4UTOA 1JQAA 3B48A 3ETNA 5HZKA 1R18A 2DWUA 1E3MA 1LNSA 4MJLA 1KU6A 2P1RA 1YBHA 3EDRA 3FTPA 2OP0A 4IDEA 4Z0NA 4V0KA 1IBLO 3CZMA 2QAGB 1DZ3A 2H48A 4MT8A 4PHHA 1YZLA 1M3SA 1VTKA 1UP7A 2OFOA 3MUOA 3VYRB 2VQSA 4FCVA 1LTKA 1Y4DE 3UMJA 2P3QA 1H38A 2EQBA 3LWOC 2X6RA 3QLVC 2ZUDA 4HAYA 3ABTA 3SZOA 3CEMA 2ZBGA 4JC0A 3GJ5A 4WIAA 1TRKA 4TPKA 1V1MB 1QBGA 2Q5CA 3NDBB 1IUKA 1UCFA 1GG2A 1ZSNA 3H5TA 3TZKA 2HK8A 3OAAD 2GK6A 1R4ZA 1VKJA 5CBGA 1P0CA 2CVQA 3NGXA 2BUCA 1ZOLA 4YDSA 4OA8A 1C9MA 2JI7A 1OAKA 3DOEA 3LUCA 2GEVA 2OQRA 3PGMA 1H2BA 3JAMN 1M83A 1YF2A 2OGUA 1EFLA 3FLEA 3AF4A 5DYYA 1Q1NA 2BP7A 4F38A 4LYEA 1OKKD 5IP5A 3K1AB 2IKSA 4K6GA 4ZGGA 8ABPA 5CFRA 2BCEA 5C5EA 2MYUA 1SVIA 4CC6A 2O19A 1R8SA 1TGVA 2M6RA 3A1TA 1XMQB 1BA3A 5IULC 1U9YA 3L0BA 5ECWA 5F12A 1CD5A 2HI0A 3V4SA 4AILC 3KZMA 1EUZA 2O0HA 3ZZ0A 1X39A 3NBZC 5K8LA 3JQFC 3HVIA 3N28A 4BNKA 4IX1A 2IHUA 1SUBA 1QVGU 4U7DA 4FUQA 2PTHA 5EMNA 2JA2A 1V3TA 3PF9A 2AEMA 1E9RA 3ZHOA 4WA7A 3MS4A 1T0AA 1D0SA 3ROMA 1DC4A 4MZDA 1DIRA 4TVSA 1YS2X 3RC9A 2XUKA 4S24A 1EIZA 3Q88A 5FBWB 1F8XA 4KR6A 1P18A 2ZIVB 1EK1A 4M1QA 3GXBA 3KNZA 1U3PA 3CNLA 4D43A 3L1IA 3V55A 1V5FA 3G8BA 2DQZA 4URVR 4GEKA 2EULA 1VP9A 1XA3A 2PAAA 3RVQA 4LJ4A 1CQWA 2MR6A 2Y77A 4V0MA 3RE3A 3DMDA 1YONA 3VAAA 4DR1B 3Q9UA 3TE6A 4A6XA 8LDHA 4TRJA 4AZ0A 1IVNA 4D7TA 1QTIA 3KUCA 2Z1UA 3C5EA 1T1IA 3IR6A 4HWGA 3TLGA 4PYQA 5A9GA 5K03A 2N75A 2IQQA 4RY0A 5B3AA 1XO1A 4WW0A 3TD6A 2WQ6A 1CR1A 2X76A 2XUGA 5K3OA 2P9JA 4G81A 3EQ9A 2P0YA 3OCVA 5CFPA 2VCYA 5DCWA 2WPDA 1NKVA 4R8RA 4E0BA 1LF5A 2VC2B 2Q1UA 2CLOB 1GL9B 3CLSD 5JSFA 1IZ0A 2ZRFA 5BWOA 621PA 1H2RS 2IUTA 3ZCPA 3QU5A 2QD5A 2AIFA 2I54A 2FZEA 4FYYA 3KYDA 3QEJA 3RW9A 3ENWA 4LH6A 1RM4A 3T95A 3UFXB 3L1JA 1LX6A 1PW7A 3AX6A 1I3CA 2DXIA 1IZ8A 3G79A 3E89A 5AK0A 1LQ2A 3H4MA 2ZJ0A 3CPHA 1U96A 2WWFA 4JJZA 3EJ6A 4B4KA 4LQLA 4HQ0A 1JSRA 1Z35A 4FHZA 4GH5A 1HLFA 3LXMA 3MGAA 2WPNA 1P7CA 4HGQA 2IZ5A 2P78A 1UL1X 4B6SA 4D3DA 2C54A 1N1DA 3E9NA 2IQIA 3VU9A 5HUJA 5LNK1 1ZIDA 3RGGA 1IN5A 4RVSA 3PYXA 4JJEA 1JWBB 4ZXFA 1SZDA 1X7YB 1GZ6A 3H9UA 1YS7A 4QNMA 3GT3A 3A0UA 5E4TA 4GBGA 1N5RA 4PHFA 3SHQA 3TB4A 3ACDA 1JHDA 3EBOA 1FPMA 1J23A 2F3RA 3BRWD 1B0ZA 3DV2A 1DQZA 4B3RB 5A9SB 1JA0A 4YY3B 4HFMA 2RE8A 2ZTMA 4FFPA 4BVEA 2VYVD 4EATA 2E48A 3V7YA 1HE1C 2VDPB 5CVEA 3OQHA 4RY9A 3OESA 4RVOA 3GP3A 1Z4OA 3FHOA 3PXGA 3ZJZA 2BEWA 2O0LA 5DCYA 4WFBV 1UWLA 1R6AA 4ZI7A 3EVGA 5KYWA 2UZ0A 3IT3A 4XB6B 4XARA 4YMVA 4BMSA 3OLXA 2JFXA 1R4AA 4P3NA 3IX7A 4US0R 1N2CB 2HB6A 3O75A 3EF1A 1XHZA 2BKVA 3HKDB 4GRIA 1GM9A 1TEHA 5IT0A 5LGUA 3GYGA 3PS9A 3T5BA 3G5AA 2CV0A 5JJIA 5AW9A 1ZVVA 3W6PA 1T25A 4Q39A 3D31A 1NBAA 3F6RA 3BBPA 3COWA 2SCUA 1SWWA 4JBGA 4DSZA 3B5EA 4ZXPA 4GE0A 3D6TB 4EA6A 2CWDA 4RORA 3RS9A 4REMA 4C7XA 2RHBA 4EL0A 4UUOA 4ZV9A 2PGAA 2OBLA 2ECKA 1PK8A 3CX3A 2HWXA 3V1LA 4ZJUA 1BDJA 3N6RA 1YQNA 3GN2A 4MA0A 4MAAA 5TMPA 1U0SY 3RVLA 3WGNA 3HFRA 3R0IA 5GM1A 4AG5A 3K03A 2O2HA 2ZXEA 1BDIA 1AQLA 2P06A 1M76A 3KT3A 4RVDA 1ILEA 5BOSA 2ZSHA 2XWBF 1L5HA 2GUWA 4Z1MA 2XE8A 2I6RA 3A1NA 3ZD8A 5BW6B 3DHEA 4PNPA 5EVCA 4DJJA 4IYJA 2C9CA 3C6YA 3WNVA 2AJTA 1I7LA 4O08A 1YAHA 1TVKA 1DQYA 2EF0A 2HFJA 3A05A 5B4TA 3FPJA 1Z17A 1RYZA 4Y3UA 4IDHA 2P9BA 1C30B 4I1PA 3LQYA 2OCPA 1DQRA 2MT9A 4ATNA 5AKHA 1Y63A 2Q7HA 2RKWA 1PF5A 2Y6UA 2JS5A 2ZWOA 4CCYA 1YTLA 3TVTA 2LPMA 1UC9A 1NUPA 2I2XB 2ZT7A 2A67A 4MWEA 4KN5A 5LOVB 4CEIB 3SPCA 4XYBA 5JXJA 1XMPA 1W75A 1PJ3A 4C7VA 3KLMX 4UULA 4X5OA 4IDAA 4PHGA 3VUEA 2QR5A 1G20A 2B4YA 2Q2WA 3M3HA 2OQIA 3I3OA 1C80A 2JJ1A 1X77A 4QQFA 1C2YA 3IAHA 2OYCA 3QNMA 3DUFA 3FAVA 1EUQA 4QASA 4H3HB 1S8FA 5DX8A 2PVCA 2PDAA 4YUYA 1L8QA 5JWRA 3TZCA 5LIPA 5CCDA 3NHMA 3DFMA 3BK2A 4Q48A 3NWOA 4B3GA 2VUTA 4F4IA 2W2NA 2CFSA 1MJGA 4M9SA 1EG2A 2QQFA 4LR3A 4ZI2A 2YQ4A 3OHMA 2EYQA 4MVOA 2ODMA 1DTWB 4JXKA 5I45A 4G2KA 5IH3A 4FNAA 4NZPA 3GJSA 4RCVA 3FB7C 3BT7A 2PCLA 1SKUA 1P77A 1AI4A 1R16A 4WN3A 2O8DA 1CUIA 1L7XA 1CW2B 3D1LA 3T5AA 4BFLA 3A32A 4EG6A 3OFSA 2O52A 1TB4A 4EGJA 4GC9A 2YXYA 3WWDA 3X3HA 4XD7D 3FYUB 3DZCA 1P5RA 4JHXA 3GZ4A 4H7HA 3O9ZA 5CURA 1KQSU 1IBKO 4AQYB 1U4OA 3INRA 2EZ8A 2WU0A 4II2A 2Z30A 3O21A 3RJ9A 4DCCA 4DCMA 1GRCA 4G26A 2HT1A 4JI6O 2OOSA 5FAXA 1M2EA 1YIJV 1KVTA 4ARVA 2J31A 1XVVA 4Q4JA 4YWJA 2VK8A 4FD2A 5IH7A 2EIJC 2Q4RA 1PG5A 1YFZA 1DJOA 2EHJA 1G8AA 4D0NA 5KNBD 1SZXA 2BSQA 5C8YA 4EGQA 4ANFA 2GD0A 3A3YA 4N9QA 1P73A 3ZJ4A 2P40A 3PTLA 2OV4A 3JSLA 1CJUC 3FPLA 3VSEA 1YTFD 4Q6GA 2H9AA 2V9YA 1PZEA 5HK8A 3T9DA 3VKGA 3K09A 3JQPA 1CPYA 4XB1A 4DBLE 1OD6A 3NTLA 4CT0A 1BJKA 2QWNB 1CYDA 1NV9A 1J1UA 4DKXA 4D0SA 1C3XA 1MB4A 4TXJA 2N3ZA 4TQFA 4LSMA 3F71A 1ZM3A 4ETMA 1J8QA 3T1YO 4F3NA 3IOCA 3CX6A 2VUHB 2QE7A 5FA8A 1RXUA 2BI7A 4H6XA 1U3VA 4DADA 4QATA 5FBLB 3WGUA 4DBLC 2FQWA 5I7EA 5L7WA 2X0IA 1H2GA 1IIRA 2IHZA 3KZXA 4MYUA 1P2VA 2AI1A 4DR3O 4B08A 1GZ3A 1YI2V 4MV4A 2FJUA 4PA9A 3PFBA 4AJEA 4RA9A 4RPIA 5BYBA 3CH6A 2V0NA 3B1WA 4ZK7A 2WYIA 4AN1A 2B7CA 1V4BA 5F78A 1HQYE 5GOZA 5REQA 2V6FA 4Z7JA 4IL5A 1KAQA 4KXFB 4MR7B 2PUSA 3O85A 3Q8XB 4YAWA 2JS7A 1KTIA 3KUKA 5CX1A 4G65A 5FIUA 1WLEA 2QD2A 3O8OA 2ZVPX 3WMRA 2I7TA 4MW8A 3VI6A 4YJHA 5FP0A 4A0HA 2BP7B 1YHQV 2P9ZA 1VCOA 3G2PA 3WOVA 3O4GA 4HB4A 3N8NA 3GJ7A 5AKIA 1EQUA 3TIXB 3NV7A 3GLGE 1HI9A 5LQSA 3G8AA 1JPXA 3HZOA 1EUDA 3P9RA 2O59A 1Q82H 3LOQA 2I2BA 1H5UA 1Q84A 1E0DA 2XVYA 4RGVA 2OKCA 3ZU4A 2BSKA 5C3MA 5FWDA 2RGYA 5H1YA 1U2SA 2W6IA 4DM7A 4CEHA 4IR7A 3IXQA 4CL2A 3SS8A 2GCPA 1DC7A 2PX6A 1AXEA 1T2CA 3ASZA 3PQEA 3NJ4A 1RAFA 1XIVA 3QMMA 3Q8MA 1G2OA 1G21E 3TX2A 2HQ1A 1WCWA 1ILWA 3S28A 4B2LA 1JHOA 1TM1E 4BP1A 1PV4A 3KHSA 2ZYHA 4YRQA 2IXBA 3VPHA 2L26A 1GKLA 3ELYA 4XWTA 2FWBA 1ULZA 5HNKA 5C51B 2EWCA 4WNIA 3AEXA 3GRUA 1QCYA 4JL6A 4RUEA 5B30A 4FFOA 3D8BA 4FEEA 3EZ9A 1QYRA 1EJ2A 3HU3A 4FGUA 5EJ9A 4HGNA 2XB8A 3VYUB 3DULA 2JJQA 1M2NA 4EB6A 4HEQA 1PZHA 3PI7A 3TRIA 5JQWA 1GFWA 3KCNA 1TEVA 4NPHA 3AR2A 4C04A 1LU9A 2AXEA 8GPBA 4DV5B 3FPKA 1E4EA 2JD0A 5F3DA 3U62A 4C29A 3OLYA 3OBBA 3RHFA 4ARBA 5EJ7A 2DHDA 3SZUA 1QO7A 4P4GA 5GADl 1GAWA 2BGNA 1ZVQA 3I4CA 5I4IA 5CA0F 1VE3A 2WSYB 3R5FA 2R96A 2F4VB 1SK8A 4B3CA 2WABA 1GGEA 3A6DA 1VGQA 3GCZA 3OVMA 1R73A 1N2ZA 3OEHG 1SZTA 2CLDX 4WNYA 3BHIA 1NH2B 1HG1A 5JH7F 2WT8A 3N5CA 1Z2CA 1HMYA 1M1KW 3IOMA 4KSYA 2WSBA 3UJAA 2DJIA 4J41A 1QBKC 2GM3A 1YA8A 1PFKA 3P9QA 4ZHVA 3PXAA 3OBYA 1I14A 2H57A 3W6NA 1T3ZA 5CT6A 3PUVA 3AG4C 3N7UA 2I4MA 2V45A 4OUKX 1F3LA 2DQ4A 3URKA 3KYDB 1F7YA 1WP8A 4U7GA 4QYIA 2J9ZB 4Y2XA 4XM0A 1Y4UA 5JDCC 3RRBA 4TKUA 1EWQA 4C4RA 3RT3C 3ZIAG 2F90A 4CW7A 1GDHA 5MN6A 2FPRA 4AP9A 4UXHA 4PQFA 5CN0A 2B4AA 3MWFA 2Z56A 3QYFA 1N8KA 3ZK7A 3T7IA 2GN2A 3SXUA 3DV9A 3L4JA 2FETA 1L7RA 1WXQA 3AGQA 1BE3H 2BEJA 2ZS9A 1A9QA 4HAVA 1QF7A 2XADA 3DUWA 1TTTA 5I7SA 3ZP4A 2HO4A 2H0QA 1N4DA 4TT3G 3N3BC 5E0OA 3VU9B 3APOA 5FV7A 1NXWA 4BX3A 1K0UA 2GM5A 3UO3A 4GZ3A 4L27A 2I6DA 4G4IA 3K2QA 5B6JA 821PA 3ZXUB 1FXKC 1GOTA 4C4WC 4K9RA 1EYZA 2L6LA 4FYPA 2KB0A 3A26A 5KX5F 3V80A 1YBVA 4L5JA 1ETUA 2Y1EA 3VCZA 3TLEA 3BAFA 4YPOA 2JIBA 2QPTA 1WSAA 4YAUA 4ZZIA 3A6FA 2VRBA 3BUSA 1H94A 2B8NA 2GN8A 4EBFA 1XXHB 1I13A 5E4JA 2JIZG 5FORA 4CI9A 4Q12A 4RA6A 4QZVA 2YI9A 1NBMD 3W7XA 3KPJA 1Z6TA 4JVLA 1GH6A 2YH2A 4MWCA 4ZI7B 1U6KA 1V2GA 2UVQA 3LGXA 5KYWB 5DTIA 3FUUA 4MVYA 4BRWA 4FIZA 3FI0A 4N5IX 3I5AA 1MGPA 3DHNA 1JFTA 2FN7A 3DCJA 4A03A 3SBDA 5DTMA 3Q40A 2XB4A 4BO8A 4J49A 1G3MA 3JYOA 4DJDC 3OU7A 4B3MB 1XL6A 1KFKB 1YZHA 1FFHA 2HLDA 2SCUB 4QXAA 2MYPA 3RC8A 3TQRA 5TDHA 2ZJ5A 1JGTA 4JL5A 4JYZA 1M6YA 3L0IB 1FVOA 4JELA 1KECA 3G6WA 3I0MA 4ARIA 2J6CA 3GH3A 1FU4A 2C5EA 4P2BA 3AP1A 2H6LA 4LY9A 4R2XA 2BMWA 2W0MA 2CMHA 5KA6A 3K6JA 5H0IA 1E94E 5GP1A 3I42A 3LDCA 3SZMA 4MVWA 3REQB 1SCBA 4RH1A 4X64O 5ALMA 2BTEA 4PLPA 4U9UA 4FD3A 5D1HA 1F5NA 4Q3NA 3EWAA 2X3UA 3TZQA 3E5MA 3KWLA 4B48A 3KKYA 1C50A 1E79G 1LDGA 5BOSB 2BF7A 4W8HA 1KBQA 1L5HB 2J7PA 2OLEA 1KSGA 5AK6A 1AQYA 4NEHB 2XUOA 4XEUA 4HVLA 1W0JG 3UAOA 2FZCA 1NYTA 1TT5A 3L18A 1UFYA 2ZZKA 1GR0A 2FPPA 4CMAA 3PR1A 1FDIA 3TDNA 4BVFA 5JR3A 4A8JC 4LBEC 2F6RA 2NVUA 3LNTA 4DMLA 4RZUA 2IDMA 2LKCA 1CUVA 3QW2A 4CCYB 2E49A 2OBNA 4M7WA 3QX3A 3GVHA 4N03A 3BSWA 5DBGA 1NPDA 3E61A 4ENUA 2VP2A 2ZUUA 1F2TB 3RVBA 2E4AA 3QMVA 4C6RA 1NVPD 3EY4A 3CYQA 2CNDA 2WVJA 3KIPA 1I7DA 1P5HA 3RF7A 3U19A 4ESVA 2A7QA 3GUUA 1Y74B 3H9VA 4IIGA 2OXFA 5EE3A 3H97A 4K9LA 4A8HA 2JEXA 1JFSA 1G20B 5KI6A 5FV4A 1Z3CA 1XE3A 4C08A 2IOQA 2B8JA 2B78A 2BGIA 2Z2ZA 3DUFB 3PWZA 5HFLA 3FAVB 1NDHA 1PNKA 1T2EA 5HFNA 3MDOA 1MC5A 4CH5A 4KK4A 3PE4A 1D8AA 2PU5A 1ODFA 2CD9A 4L8JA 2IXEA 3P9IA 3ZS8A 5CH5A 5K7SA 4OPMA 4AG3A 2YFKA 1F51E 5DRYA 2Q4OA 3JQDA 3CCCA 5HXZA 4JF3A 1EXVA 3E9YA 4V0ME 2W6ZA 2EJTA 4AICA 4B2YA 2O8DB 2I67A 4EUEA 4WJLA 1JDBB 4YASA 1KWGA 5IDJA 1RWPA 1D2RA 2ZBVA 2XRZA 1WCV1 1YZVA 5T6MA 1M2VB 4OB6A 3M49A 3MERA 3K35A 3FUWA 1REQB 1WNSA 2B25A 5KNDD 2C2GA 4GW3A 3FOCA 4YFVA 4HWTA 3R0XA 1Q6HA 3MRVA 1OXBB 4EKDA 4R8VA 4PIVA 4BN0A 3QG5A 3ENQA 2VUSA 1Q81W 4FFRA 3J81k 4N5DA 2EW2A 3DZIA 1ZX1A 4EKGA 4JI2O 1N77A 4BFXA 5ALXA 1Q2UA 5HIMA 2HXGA 3RUHA 1NAIA 3DAFA 3NTQA 4Q4JB 2Q1SA 4QXPA 4RM3A 4G85A 1SCJA 2XLBA 1SCAA 3AHIA 3KJEA 1IH8A 1VBFA 3QNUA 3W5JA 3PDCA 4WJZA 4ZCIA 4KEAA 2V65A 2QM4A 4ZREA 3D5QA 5I4KA 3AESA 4BGUA 5BUQA 2XNSA 3QF4A 4DV7O 4J94A 1QD9A 4AJ9A 2ZCEA 1X7HA 4ER0A 4BUCA 4AY6A 1VIDA 1B8NA 4I9WA 1KK0A 1MT0A 1BQZA 4KX5A 3LCUA 3LWRC 2HQSA 2C31A 3TXAA 3RG2A 3NDIA 1U7ZA 3U1VA 1RCTE 4AJPA 2E4XA 4RK0A 4HMPA 3CKMA 3M6AA 1O6BA 4WN9B 3I9V6 2YVLA 3W5CA 1G6OA 5A7GA 3D6FA 3P2OA 1FFAA 5E38A 1OLSB 3HSSA 5MHTA 2IPMA 1WNFA 2JA1A 2FLVA 3DT8A 2BFEB 2WLLA 3I5DA 4L85A 5M7EA 5HKBA 1G1AA 4ZT3A 2X41A 2NNUA 1EEHA 4PXAA 3VJRA 1E9FA 4GKKB 4OQLA 2PT5A 4RA9B 2OFXA 1NNLA 1V35A 6LDHA 1TQHA 1UPFA 5T4FA 1IZ7A 2GVNA 4S2UA 4EHDA 1SM4A 4EMUA 2ZAIA 2J5BA 4RH0A 4WXYB 3QO5A 1U5AA 1DG1G 5REQB 3IDSA 3AIOA 4BNWA 4Z5XA 4NTYA 3RABA 3M6LA 1BEEA 2Q8PA 1OXMA 3LYBA 2G0AA 3BK7A 3ZX4A 3LHSA 1XP5A 1OBFO 5H7XA 3K71B 5CX1B 1S0UA 1GVHA 2OFWA 1D1PA 1XQXA 3QUQA 1H8HA 2XDAA 3V1UA 1RM1C 3FHJA 2DWEC 4LGYA 5FFNA 4MQBA 2CV2A 2ZP1A 2AX3A 2Y69C 5DN6D 3LQFA 3ZOPA 4NMLA 4MQ6A 3NCHA 2V4DA 3PPXA 3SMQA 5F33A 4UBIA 3WK6A 3C98A 3UH0A 4CTJA 1P60A 4KOEC 3VVBA 5HS6A 3ZWBA 3CRAA 4JUDX 1GQRA 3KZCA 2GZRA 3UCSC 3ENNA 3ZVNA 2ZSIA 1JHVA 3OF2A 2BSKB 2BUAA 2Z0MA 3EBPA 1P1KA 4CEHB 4JN6B 4ZRMA 1DQSA 3GUCA 2VNHA 3GEEA 5JJLA 1YB1A 1KHTA 1G6KA 3FCAA 4TQUS 1XFDA 5DHRA 3WMGA 3O38A 3RK0A 2QNRA 2I71A 3B2EE 4MQFA 1DXOA 3AVTA 2YYZA 5JXGA 1QANA 3T1NA 4N21A 2R4UA 4RIHA 4B6FA 4C6HA 1GU1A 2UXCB 5DLEA 2CLCX 5IYDO 5E8RA 6ADHA 2EJ7A 2ZR7A 3W8RA 5ICCA 2FWMX 1T9GS 4PG7A 2JBWA 2GQ0A 2EBUA 4Z0PA 1HNXB 2PBRA 2R7KA 1W2GA 2FXVA 1U8EA 3HCEA 5G0SA 2DJVA 5E95A 3IR5A 1MDBA 1YJWV 2ZAOA 3THYA 3DOFA 3ND5A 2F9ZC 1FDOA 3VHLB 4FFLA 3KOZA 2PWAA 3FMOB 5CBFA 4G0PA 1ZM9A 3A27A 3TL2A 3H1AA 4P38A 3UFXA 2IP2A 3M4ZA 3H1HH 3E7DA 4LG1A 5ICFA 3JAMM 4DJFC 3EPLA 4PQYA 2NTEA 5C52B 1ZRSA 4KDFA 2D00A 2ZB7A 3QFRA 1XCMA 2OBYA 4JI4B 1U3TA 5I5EA 5JEEA 2CEAA 4LXHA 5IYBO 2P4QA 1B4DA 4Z53A 4LJ8A 1QVAA 4NC9A 4OEHA 1JBKA 2FFHA 1X1AA 2PH1A 4L02A 4QAJA 3KQSA 1UZNA 2G38A 2PWBA 2YUAA 4D0RA 1AVTA 4EPWA 5FR2A 4LF5O 1T5LA 1ISFA 1UOOA 1XU4A 2AVNA 3HO1A 2ZGVA 4DUGD 3I4FA 4X66B 1GNLA 3WRYA 3OO1A 1OI4A 2YWFA 4RK7A 3VTKA 2B1GA 4I7ZB 1GNVA 2AH5A 1GQ2A 3D2AA 4PGFA 5C8DA 4PONA 3T15A 4UEJA 4GSLA 4GP7A 4RPLA 4PEVA 2BE9A 1HYGA 1WOYA 1V5GA 2W83A 4IDNA 4YRJA 1XTZA 4DKJA 3E9ZA 3M5DA 3PENA 2I34A 1XRJA 1WAZA 2JVKA 4WLOA 4C87A 3NIGB 1Z2DA 3GPLA 1R12A 2D06A 1TC1A 1P2BA 3GT0A 2FDRA 1ZITA 2H31A 3S3XA 2QRQA 4I5EA 1JXOA 1WB4A 2PKRA 4UZSA 3HKDA 2WHQA 4FZRA 4LJRA 4M8IA 4ALKA 2ZE8A 5IKMA 3RSSA 3S03A 2UUBO 2JASA 4RMIA 2H4HA 3KYIB 4TYQA 3GNSA 4OH7A 4G4YA 2F66C 2IOYA 4F4JA 2QSYA 3SR0A 3GHZA 4CUZA 5GMOA 4K6KA 4HAUA 3GCXA 5CM2Z 4D4IA 4MVJE 4HQOA 4PYKA 3W4JA 4RA6B 2VT7A 4DT1A 1THMA 4TLEA 4CFYA 1K8YB 5EMJA 1DL5A 1ENPA 2M1ZA 1JCHA 3ABQB 1KDTA 3E53A 4LJ6A 5KQPA 3GPIA 4RD1A 3UWKA 5EB0A 4E11A 5C93A 4IJQA 4KO3S 3AVWA 1DMRA 2R87A 4OXYA 1PR0A 3FFMA 1RVDA 3ED5A 1K8ZB 1BO6A 1WUHS 2ZPUA 1DAOA 4HLUA 1R0XA 3P0EA 4D8XA 4DYDA 5J2TF 2EILC 4YPVA 5B8FA 1Y6JA 4NI5A 1NVPB 2W98A 1OXTA 4BCCA 1BCSB 1E7YA 4CBVA 4LX8A 1JJBA 2CXUA 4WQMA 5EBMC 2QG6A 1HBJA 3I45A 4OB7A 1UKYA 4OI1A 3PRJA 1C30A 1NY5A 2I8AA 3LKDA 2EIMC 1YRLA 1UM9B 4FLWA 1MQSA 5IN5A 1XNJA 4BE9A 3TTTA 4J9UE 2HMSA 5EWLA 5DHSA 1W4RA 1A50B 1QGYA 4JH0A 4UD6A 2XYQA 4J90A 3L46A 5FBRB 4JOBA 2FR8C 3PLAE 1CUDA 5LM3A 1WUJS 4ZEMA 5LOVA 3TXYA 1V48A 2YWCA 3PPYA 2IW5A 3ND9A 3C5CA 1VDZA 3GEHA 4GUAA 4EG5A 1Q6YA 2J3QA 4Z8YA 2R9RB 4B73A 4BGIA 2C95A 1IXYA 5EBLC 2PS0A 1RRKA 1BAPA 4XD2A 4S1NA 3WQBA 1TT5B 1MO5A 1PNMA 2YIBA 2JB9A 4YHHO 1YIDA 4KBYA 3PDUA 1PKXA 3P32A 1U0EA 3PLAC 3KQNA 1GLNA 2REQA 2FPPB 5IC6A 2XQKA 5CMLA 7GPBA 2HC9A 1R3LC 1T1RA 2ZVQX 4EK9A 1SQXH 1AOXA 2JLVA 1PLKA 4R83A 4PYLA 1LVGA 5HK9A 1WCYA 4O3FA 3UJ7A 2XMQA 2B9VA 4IKOA 4J3NA 1XXLA 1XBTA 4BOYA 3HU5A 1BVRA 3V1TC 3U7QB 4WHMA 2IP1A 2E4WA 1AS3A 2GBGA 2ZIGA 2E0IA 2WSSG 2I6UA 4MICA 1N8SA 1DIHA 3VFDA 1V95A 3G80A 4EVSA 5AUOB 5IEBA 5FL3A 4QYWA 5IJWA 3KVYA 3HR4A 5CDFE 3GDHA 4LY6A 1T8TA 5BN1A 1M57B 2WJ6A 1HZJA 4N8DA 3EQ7A 1QDUA 1Z7YA 3WFZA 5EZYF 5BP7A 5K0CA 1OBVA 3M4YA 2E5FA 4P3XA 3AOEA 3DDSA 5K4HA 3BS4A 4GLJA 3RFCA 1AKWA 2CXRA 1JQEA 4FMDF 1XI1A 1GCIA 4NJMA 1S2DA 2XCTB 2XRMA 5D7BA 3T3MB 2PZSA 3NP9A 5H2FZ 5KBYA 3DZBA 3W1WA 1YHZA 3LWVC 2E4UA 1U0BB 4CDRA 4FYMA 3EVNA 1JSCA 10MHA 3KTDA 4EPRA 4TKZA 1KEZA 2PN1A 4F6EA 1IBCA 3U2QA 1VL2A 2PLNA 4BFWA 5CXSA 1VJ0A 1NYQA 1OKKA 2Q41A 3IEWA 1WXGA 3FRJA 1KXJA 2PTMA 3LUFA 2AG8A 1NW4A 1UBOS 2AMLA 3K9QO 3EGXB 1Q86W 4HBGA 2RHTA 1QKJA 1L8XA 5C7OO 2RHLA 2VYQA 3VHXB 3LUTB 1J0BA 4IJ5A 4GKBA 3WU2Z 3BFKA 1KF0A 4IJ6A 2DBVO 2JKYA 2G9UA 1BXRB 4CGYA 5B1IA 1MNQA 4QO7A 3KSBC 3WIOA 4LW8A 4YJ2F 3GA0A 3CIFA <