3JATB

Cryo-em structure of gmpcpp-microtubule (14 protofilaments) decorated with kinesin
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
total genus 153
structure length 426
sequence length 426
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jatB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jatB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jatB01
3RYHB 5EZYA 1RQ2A 3JAKB 2RHOA 2GVIA 5CB4B 3JAWB 4O4HA 4B45A 5LXTA 2RHLA 4O4IB 4KWEA 3HKEA 4O4LB 3VOAA 5MN5A 4FFBB 5JCOA 5FNVB 5LA6A 4TUYA 4O2AB 1TUBA 3R4VA 3JALB 5IJ9B 4X20A 2Q1YA 3WGLA 4WBNA 1TVKB 4X1KA 5J2TB 4U3JA 4EI8A 2BTQB 5CA0A 4X1YA 3V3TA 4O4JA 3ZBPA 3JARA 4HNAB 3HKDB 3N2KB 5KMGA 2XKBA 5J2UB 4IIJB 2BTOA 3RYCA 1FFXA 1W5EA 5JQGB 4XCQA 3RYFB 5CA1A 5IJ0B 5BMVA 5LYJB 2VAMA 5LP6A 1JFFA 4I50A 4I4TA 5KX5B 2VAWA 4DRXB 5C8YA 1Z5WA 3N2GB 1Z5VA 4O2BA 5JVDB 4I55A 5ITZB 1SA0A 3JASA 4ZI7A 4EI7A 3HKBB 4X1YB 3JAKA 4X1IA 3UT5A 5LOVA 5EZYB 4ZHQB 2R6R1 4M8IA 5EIBD 5LXTB 4IHJA 4F6RA 4YJ3A 4O2AA 3WGMA 3VOBA 3RYIA 3JATA 5LA6B 4TUYB 3E22A 1TUBB 3JALA 5JH7A 2RHHA 3C8LA 2VAPA 1W5FA 4X20B 4YJ2A 4WBNB 1W581 5IYZA 4X1KB 2RHJA 4U3JB 4ZOLA 4EB6A 1FSZA 5CA0B 3HKCA 2R751 2VXYA 4O4JB 4TV8A 3JARB 3N2KA 5EYPA 1OFUA 4IIJA 5GONA 4DXDA 3ZBQA 4LNUA 5KMGB 1RLUA 1FFXB 4TV9A 3VO8A 3RYHA 5CA1B 5BMVB 5CB4A 5JCOC 3JAWA 5M7EA 1RQ7A 1JFFB 4O4IA 4I50B 4O4HB 4O4LA 4FFBA 5FNVA 3HKEB 5C8YB 2Q1XA 5ITZA 4O2BB 5IJ9A 4I55B 1SA0B 3JASB 4ZI7B 4ZHQA 3ZIDA 1TVKA 5J2TA 3M8KA 4X1IB 3UT5B 5LOVB 3CB2A 2BTQA 5MN4A 3RB8A 4HNAA 4U39A 4IHJB 4F6RB 3HKDA 4YJ3B 5MN6A 3RYIB 3JATB 4B46A 3E22B 5J2UA 5JH7B 5JQGA 1W59A 3VO9A 5LP6C 3RYFA 4EI9A 5LYJA 5IJ0A 3RYCB 4YJ2B 5IYZB 3WGKA 4ZOLB 5EIBC 4EB6B 2XKAA 3WGJA 3HKCB 5LP6B 4TV8B 5KX5A 4DRXA 4I4TB 1W5BA 5EYPB 3N2GA 5GONB 5JVDA 3WGNA 4LNUB 3M89A 1W5AA 3HKBA 3VPAA 4E6EA 4TV9B
chains in the Genus database with same CATH superfamily
3SC3A 2HQBA 3OQOA 3RQSA 2V7GA 5L7TA 3DMFA 3UUEA 1XI2A 3NK7A 1JRLA 1H5NA 4CI9A 4NCJA 3MQFA 2HY7A 3GVIA 3ND9A 5HQJA 3I5DA 4UD6A 3FFMA 4CEHB 4M3NA 3EIXA 2WP8J 1BX1A 2X0DA 1L9KA 1JSZA 2V9ZA 2AOVA 3DUFA 4K9KA 4BASA 4BQIA 4M0UA 1P6UA 1W57A 4ZHYB 1F6DA 3BZUA 1ISHA 1NBMD 2ET6A 4J43A 3R74A 2JLYA 3WBBA 3V33A 2PWBA 4LDZA 3NKFA 3G23A 3EQ8A 5DMXA 1BJKA 3I1JA 1ZD2P 5C0OE 1SVKA 4YCLA 3OMNB 1WXXA 1O6CA 1JKJB 4DPMA 1T4BA 3L8DA 5FB3A 1WPRA 1CFZA 2BVNA 3J7AC 4ZD6A 4FYWA 1XQYA 3CG4A 5DIFA 2B7LA 3NBUA 2BZ1A 4H6PA 3CH7A 4BBJA 2PKXA 4HTFA 4XVUA 2RGRA 4RTJA 2R8EA 2UYQA 3VH1A 3P30A 2R48A 4MVCA 1EFVA 3TSCA 1QRAA 2X41A 1ZSNA 2ZWIA 2PTMA 1YB1A 4MW1A 1LI4A 2FAXA 3CPEA 4GPBA 3FWKA 3NB0A 2IH5A 3KLMX 4XTRA 1WUJS 3NT2A 5I9IA 3H1BA 1X7ZB 1PFUA 1BWPA 2IODA 4W8OA 4HQ0A 1QAMA 1Z62A 2G5PA 4PZPA 1UBMS 2C5AA 3IUPA 2Q8VA 3KJGA 1DC6A 3VC7A 4OGLA 5FR2A 1QP7A 2GSDA 4ZZ0A 5THXA 4HH4A 4KXQA 4MCIA 4IG4A 1JDBB 4EKWA 2J5BA 4UMEA 2QGNA 2X4DA 4P0TA 3TI9A 3WXBA 3VPAA 2CVFA 3QBJA 1AGNA 1KI6A 1BDMA 1QVGU 3D3WA 4XWKA 1ZK0A 3OKFA 3VZDA 1RRGA 3PITA 4DAOA 2IEAA 4G8JA 4XFKA 3W3AH 3B8NA 1CY2A 3MQ2A 1HZZA 3QIVA 2ZR8A 4AJ1A 3OT7A 1YI8A 3MWLA 7MHTA 1QIJA 4KE6A 2B61A 1UZLA 3BBPA 5BWOA 4BFLA 1IC6A 2V7VA 3CN9A 1A27A 5IX8A 1OFTA 4QO8A 3TM4A 4OMDA 5TGTA 1RPRA 5AJHA 3E7DA 1R0LA 2JNWA 3CCEF 1EJ0A 5GINE 2IV2X 3ILXA 1Y4MA 2NYUA 5F2KA 3A1WA 3FPLA 1JHDA 4F86A 3SYAA 4E22A 2L69A 3B51X 4TZ0A 2WKQA 4Y1RB 2NU6A 2J5XA 3CNHA 2YFKA 4BGVA 3FUCA 1AI7A 2RAUA 3UZUA 2HSDA 2FP3A 4JGIA 1R5BA 3RN4A 1MZFA 4IGAA 3NRCA 5IXYA 2FB9A 3UJ7A 3N39C 3VSBA 3F71A 1YO6A 1JA8A 3I9V1 4EFEA 4ESEA 4JMLA 1EN4A 2NZJA 4EBBA 2NV6A 1RYFA 3MBKA 3SM9A 4Y6OA 3DAGA 2OM6A 1Z18A 4PNHA 1RPJA 3PC8C 5LJIA 2C00A 2ACEA 3HO8A 3D8NA 2B7BA 3IOYA 3ZWPA 5JLAA 2X77A 4Z4GA 4AC9A 1W36D 3N3AC 4TTAA 1VM6A 2FKXA 2QJRA 3HPRA 3PDIA 4Z4CA 2TMDA 1SQQH 4Y2YA 5E95A 2GDJA 4DR7O 2ZCVA 5KOJB 2RN9A 4LTMA 2MSLA 3ZXIA 4LXUA 1DSSG 1OCOC 4GXNA 3OJOA 2PEZA 1IDSA 5JO0A 4NHOA 4BVBA 2I6DA 2W2TA 1TO1E 4NRDA 3F4BA 3KT0A 2ZE5A 4G5HA 5IU6A 3UUGA 4ZAYA 4GQBA 2QSUA 2CEAA 4RIEA 1FBTA 1NZDA 4XJVA 1QSGA 4JR0A 1BU8A 2JAHA 1EK2A 4R0NA 2FFRA 1TMGE 1XLTA 1Y98A 1NYQA 4ZV7A 1LU9A 1XDCA 3H8SA 4FSDA 4AY6A 5T5QA 3LK7A 1XHEA 2PIDA 1SU6A 1WUIS 2HU2A 4NBTA 1U04A 3AETB 3BSYA 4JUDX 3UJDA 4INJA 2PJUA 1ULTA 2FSSA 2I4RA 1FYXA 3I12A 1QHHA 3NHAA 3QU4A 1WTAA 2CN1A 4R98A 3EDQA 1AGYA 4IX9A 1NJ5A 3G6BA 4G0QA 4MARA 3KKKA 2JI8A 5HFMA 1GPLA 4H77A 3CEJA 1ZVMA 4O4IF 2ZVPX 3CNQS 2OCLA 1HNZO 1UP4A 4LX8A 4MWOA 1QFYA 1R8YA 1X0VA 2WPDD 2J5RA 2ZUVA 1ILWA 3CR3C 4QM6A 1UXHA 4LJ4A 5AYVA 4UV8A 1OT5A 3ZJVA 3DT8A 1X1QA 1OAAA 4XLLA 2WY2D 3FOZA 4CM7A 2XAGA 1IDN1 2PNFA 4XSVA 2VWQA 5K8UA 4EHFA 5CA0A 2GLZA 4ZXFA 3SDZA 1Q7RA 2CGOA 1XZIA 4G84A 3FDFA 3AG7A 2QG6A 1IVYA 4P81A 2E5FA 1OCZB 4W9MC 5B58C 4G5YA 2FSGA 1T6YA 3PJFA 1IWOA 3OIYA 1RXSA 4JHLA 1XUQA 2X3FA 2WINI 1WD5A 4MI9A 4ALMA 2XCIA 4UNQA 3RLIA 2R6AA 3V4LA 9LDTA 1CUFA 4PNPA 4QJ5A 4GZMA 4I50B 3S5UA 2BHTA 3HR4A 3QXSA 5AJVB 1DI0A 3FZYA 5D6NA 3QUAA 3CUKA 4E6PA 1UMDB 2C92A 2C07A 4JI3B 4ZEWA 4JL5A 1RPZA 2BV3A 1ODKA 3H0CA 4CIBA 5EZSA 3REGA 4A2WA 4J7KA 3ZG6A 4X3MA 5FWNA 2R5FA 3HDQA 3VX4A 4EW2A 3V7QA 3ZV6A 5FWYA 5K3SA 1K6XA 4UVIA 4EVSA 2VXBA 4WOCA 4QGAA 3HY4A 2BSKB 4EOGA 1OUMA 1P4HA 3E3MA 3I2FA 2FPKA 1A9YA 2PUAA 1WP9A 1RLTA 2YUAA 1XQ9A 3K53A 1ZL8A 3FOEC 1GA6A 3WJRA 1A2QA 3ER9A 2BM0A 1QONA 1HFJA 2OTCA 1XSEA 5GVSA 3ER6A 4M9QA 3NP9A 2XYGA 2R79A 1XD8A 3DBIA 2JJQA 4WFHA 3AV3A 3BXGA 1XEXA 3IXQA 4L74A 3UIEA 3OQNA 4QG3A 1Z5ZA 4GVPA 5JSKA 4ER6A 4EFLA 4BT3A 2BCGY 1X1TA 4MVWA 1VHTA 4TV8B 4F0JA 1NTRA 2VUTA 1IBKO 1F2VA 1NXXA 4QBGB 2ID9A 4F7DA 2PL3A 4K6FA 4FYYA 4XYEA 2VHYA 3CYPB 1Y66A 1QK4A 4UUNA 1C0PA 4M1EA 2E55A 5AJZA 1TCVA 2I8AA 2XYQA 4NKRA 3OOSA 4O2AA 1NMZA 4FLXA 2AZ2A 4H27A 2YI9A 5DOVA 1XTPA 3BT7A 2HNKA 4QRIA 4KTTE 3GGCA 1W87A 4HAVA 2REOA 2JLWA 2X19A 1VF5B 1GGKA 4K05A 5AI8A 5EKDA 1K8ZB 4K1XA 1RLJA 3TLAA 1UH5A 4MAAA 3O82A 2ENUA 2WJZB 4IZ6A 1YE5A 2PL5A 4LTDA 4EJSA 2DULA 2FPMA 3VTKA 2CCKA 4GIBA 4TTQA 1GLNA 2J87A 3PUIA 5IC6A 4R16A 3FYUA 4J8PA 4ZAVA 1GZ6A 3PYXA 4NULA 1E58A 3I73A 4RSMA 1A9PA 3ESZA 2JZCA 2XTZA 1QG2A 3CZQA 1EGVB 5UKDA 4GP7A 3OUZA 3Q0TA 4JT8A 2QG4A 4B84A 1QTRA 2YXEA 4MT8A 2IYYA 5LIRA 2FK8A 2JIZA 5ALJA 3UCXA 4ZVRA 2FMXA 2YEVB 1ISJA 3O8LA 1KVRA 3CWCA 3RVZA 2OORC 3DEKA 2JNBA 3RRFA 4NVPA 3ZHBA 2MSNA 1BG6A 4LH6A 1WLSA 1ZINA 2P2SA 3CMAF 2NMUA 3N76A 5TGZA 3L7CA 1UFQA 2YV4A 4C2BA 4XARA 1ABFA 1ZCZA 4GZRB 3EUAA 2F8LA 1QVFU 3C85A 1E2NA 3V46A 2AQKA 2CVHA 2QD4A 5KKAA 1I4LD 3WL8A 2C4TA 4N7BA 1E5LA 3U62A 4UW9A 2Z9BA 2W22A 2QTWB 3EMVA 4GVXA 2ZAOA 4RWZA 1YQXA 4UEWA 1DG9A 2PUGA 1PL7A 1WVMA 1PW7A 2C58A 4WY5A 3ON5A 4F4HA 3AF6A 5DLQC 4CTJA 5LWHA 3PX2A 5AVWA 4PR3A 4WBNA 3B70A 1HY3A 3PI7A 1QJCA 4JC0A 1TM1E 1CJTC 2GERA 2VJKA 3WG7B 1Y1SA 3KTAA 4HAXA 1A9TA 2GEUA 3BEDA 3JYNA 3CD6F 1DEHA 1X15A 2L42A 4S0ZA 1Q5PA 1MO4A 4RX1A 5A5FA 3HCDA 4RV4A 4CKBB 2C0CA 2CWJA 5IVDA 1FFTB 1R1DA 1TU3A 1R3JC 4IGGA 2R3SA 4NOMA 2LPMA 1A9OA 3L70H 4R54A 3K1ZA 2UKDA 4H7DA 1NKTA 3BS4A 1R6DA 2I1LA 2RB4A 4CL3A 3BD7A 1JDVA 5KYVA 4O8ZA 1Y8RB 2ZUWA 3PNPA 3L4SO 4X88A 2EHJA 3OEEA 1TMKA 1CC1S 2VBFA 1AKUA 3H01A 2OQIA 3IOBA 1A69A 2X8JA 2QP9X 5T6BA 4BWVA 2OV6A 3LD9A 3OJXA 1U0EA 2CW5A 4DY4A 1I3CA 1WPQA 3QH4A 4M0KA 4F71A 3G2OA 3AKDA 1YS6A 3DZFA 2B1IA 3MB8A 2QT9A 2O3TA 3KYCA 2BO1A 4CBCA 3L7LA 4IUCS 4NTZA 4GG1A 4JLDA 2CTPA 3DKPA 3Q5DA 3LYLA 4DA9A 2GLUA 4HN2A 3RTBA 3NTXA 2WMDA 4DMKA 4LC0A 1HDJA 3TRFA 4XWWA 1TQDA 4OSPA 1T13A 4TYMA 2JASA 2HLPA 1KKLA 4KJXA 3IEQA 2ZULA 4WKCA 3QKRB 4ZI7B 3NCHA 5AXDA 8GPBA 4DMRA 4HPJB 4X45A 3FBAA 1V6SA 1PHPA 3TLBA 3SOPA 3IP5A 4B62A 2IBZH 4E4YA 1A2OA 3CJHA 1DO0A 4RK0A 1C9DB 1XD9A 5K1XA 5LXTA 2HMUA 3ESDA 3Q8HA 1K4KA 3PGKA 4BNNA 3OQ1A 3T06B 2M6RA 1V8DA 1Y1KE 4H2DA 3SZRA 3DD1A 1K3UB 4PA7A 2PX2A 2OLJA 5B57C 2ZU6A 3QX3A 1F0PA 2J9YB 4CETA 1YDFA 2I6XA 5J4YA 4J94A 2OC9A 3LYBA 1SOMA 3T1TA 4MRPA 4DMHA 1B23P 5DSZA 4MKIA 3F90A 1LD3A 1SR8A 1K8AH 4R2JA 4OATA 2O3RA 3O1HB 4PIPA 2QEXF 3RRJA 3PE3A 5H3CA 2ZIEA 1L8QA 1K7YA 1V37A 2XYRA 4NWOB 4KUHA 4U9IS 1UP7A 2GD1O 3GT3A 4CMGA 2XOKD 4L6CA 3IQFA 4EG0A 5MN6A 3WA7A 3EFOB 3CVVA 3CCLF 1SC6A 3ZP7A 1HEUA 3CURA 2C5BA 5ALEA 4ZJZA 1BMFG 4UNIA 3SF8A 4QU5A 4JJGA 1I4EB 4AI6A 1FRNA 1UBTS 2BFEB 4MR9A 2V6FA 2AC4A 4FJCC 5DEDA 3AJDA 4ZYTA 4G4VA 3FB6C 4UCFA 2ZVQX 4IOKA 4H7HA 3BJEA 4YAWA 3IBFA 3BSWA 2A0KA 1L6RA 3T35A 4QDOA 4YRGA 3TKYA 4EQ6A 2RFLA 3T3PB 4JJFA 2QUIA 3VVCA 4DLYA 3UUFA 1Q7EA 2EARA 4RK1A 1PUIA 4FW9A 2QUAA 1P2UA 4UNNA 2Y2UA 3HEMA 2O8BB 3SVTA 3DE7X 2JJYA 4FZRA 1CR4A 4DQUA 2OXFA 2O23A 5TS3A 4R81A 1T2FA 3FUUA 4NNOA 4R0VA 1KAMA 5EHIA 1S89A 4MVUA 1PG2A 2EEPA 2FPSA 4HQOA 2YJ4A 4D8TA 4Q4AB 1EJ6A 2X1VA 4F3RA 3W7WA 3WYDA 3EF1A 3HS3A 2K9PA 2IPOA 2PYZA 1SCUB 3AR2A 2XMZA 4TRRA 2OSVA 3AHHA 3SQMA 1IM8A 4Y2SA 1SF9A 2XCSB 4RA6B 3CQ9A 1GWNA 1YZGA 3Q2OA 2JGUA 3TL3A 2EZ9A 1WCWA 1GM9A 2K6GA 1CJCA 3EG9A 2WLIB 3OQIB 3N86A 2HX1A 3PUWA 3OZFA 2AKYA 4TTJA 4PG5A 1OPRA 2OBNA 1XRLA 4WQMA 4R2MA 1JLKA 4ZOLA 1OVGA 3LY7A 4DCVA 3GT7A 2UVPA 1A8QA 2GYWA 1R4MB 3ZDZB 4OYHA 3TZHA 2UV8A 1QHIA 5F5LA 3EFHA 3OLVA 2XT9A 1KARA 5D01A 4Z0NA 4OQYA 1D07A 2QUZA 1U3UA 2VSQA 3AEXA 2PSDA 1UAAA 5ERXA 1LPNA 1Q81W 4XVCA 3QKSA 4FEAA 2W11A 5EVCA 2H08A 3Q2IA 3AI3A 4INZA 4QO7A 1RW4A 4UBNA 1XCJA 1NI8A 4NOKA 5FUVA 1IE3A 3PUJA 2FHSA 2WTUA 4GFDA 2NN4A 4HYYA 2AFIB 2CLSA 3CCUV 2BKAA 2ENWA 3RRXA 5E6SA 3DZGA 5DXFA 2YWXA 2CBXA 3LWQC 1SU4A 1TB4A 3DAOA 4PAQA 2WICA 1K63A 1P29A 4RHTA 1U81A 3WRWA 2RI6A 4MB0A 4O2LA 5C8YF 3H5IA 1P7YA 1M5TA 1V54C 1MB3A 3RRMA 3RWBA 1EA5A 5KDLA 5FULA 4A5OA 4M53A 4XD2A 2EAUA 3JRWA 1V9LA 4MUGA 3WYCA 3ORRA 2ES4A 5FI3A 3QLVC 1O89A 2AOXA 2PI5A 4Y1GA 1OZ0A 4OOFA 2IBSA 4H0LB 4ARIA 2NT3A 3FNEA 4RJ2A 2ANCA 1M54A 4XM0A 1SXJB 5T4HA 4BMYA 4CFSA 2F9MA 1O3YA 1M2GA 5BXZA 1SXHA 4NLLA 1S4MA 1XU9A 2VF8A 1NN5A 2W4IA 2HK6A 1YB7A 2DXIA 3TNJA 3HYLA 4EL5A 4IRXA 1DOZA 4K03A 3KOOA 2ZINA 1JGTA 3HXTA 4AMYA 5C1PA 4C81A 3GG9A 1JKFA 4JKIA 4U7HA 3D00A 3THWA 2QMEA 3RTDA 1GTL1 2BHLA 1KQ3A 4LDQA 1FF9A 1ZP6A 1M33A 5LUAA 3ZH9B 5JPCA 4G24A 1Z0JA 4KN5A 1CSEE 1FFXB 4Z1MA 2F64A 3UOWA 4P6VF 2A2ZA 5JCZA 5EKTA 3M5PA 2REQA 3LY8A 5JXWA 1RXYA 1TAGA 4KMRA 3RGGA 2PMKA 3I5XA 3A7EA 4P8RA 3SPGA 1ZWLA 4YT5A 4UU1A 2PZJA 1RHUA 5LCXA 2HVKC 1XZBA 3MMPA 4TMTA 3E8SA 4NYJR 2GB4A 1Y7IA 1FDWA 2Z8YA 4KI7A 1M2VA 3I4CA 3PUYA 2ZJAA 3DE1X 4PHTA 2C7PA 3IV6A 3Q4HA 1BYUA 1TRKA 1JDUA 1QGZA 4ZQFA 1CK4A 4WNIA 3R9XA 2H1WA 4EG4A 5AW9A 2NLOA 2PWZA 2ZJYA 2D5IA 3ZGYA 4M2LA 2BM9A 4YJDA 2AUTA 3LP8A 3CYQA 1KJ8A 1FTGA 4FUQA 2FP4B 3JQ7B 1A4RA 1RYMA 2YINC 3PXGA 4YJ3F 3VKVA 3GK3A 5IM4A 2J45A 1YOVB 1QX4A 5FBVB 4UXJA 1H8EG 2CNLA 2IIQA 3EXHA 4KO1S 3HB5X 1TZ2A 1XNHA 3KYBA 1Z0AA 4FFBA 4K3UA 3SQLA 2OCCB 5JATA 1Z12A 2BY4A 3WYAA 4EJ2A 2GN6A 2ZBVA 4EHDA 2GF2A 4P53A 2XBLA 1WN7A 2KX7A 3A1FA 2HMYB 2D1TA 1K3FA 3I3OA 1COWA 3ZJYA 4CMEA 1NFQA 2UYNB 3CC2V 1S0UA 3K2IA 1SBNE 2K1SA 1ENVA 1DAEA 2FWPA 3GFFA 4JP1A 1ZR2A 4JLNA 4KDFA 1XRSB 1JFFA 1CIVA 5DFAA 4KH0A 3LDCA 3L7OA 1YULA 4WXHA 4FKZA 1Z0SA 4H6VA 2V4MA 5DV9A 4X65O 1S1CA 1WXQA 4H3KB 3FSGD 7GPBA 3HK2A 3PQFA 4ZQEA 5H3HA 5H3LA 1R7RA 3IT0A 1VQ7V 3ESJA 2JAPA 3H4IA 2EF1A 2MINA 4ZVLA 2LCIA 5LQNA 4BUCA 1DRVA 4AWBA 1E3LA 6REQA 4QDKA 3IEVA 5CHEA 4ZDWA 4JQSA 3LW8A 4F6RB 3N6VA 2C29D 2D2VA 3C6KA 2O7SA 3GAFA 4QJIA 4BT4A 1O58A 3RGWS 4B3FX 4NCAA 4X92A 4R3UC 1CKEA 5TIIA 2V0GA 3WYNA 4FVTA 4I5IA 1TPYA 3EAQA 5AKIA 1JJBA 2HRZA 2PG3A 4A16A 4OEHA 4X6XA 4NFSA 2CL0X 1E1MA 4U3JA 2OK7A 1RLOA 1P45A 4L8LA 2DBRA 1IUKA 3X1YA 1AUQA 5JJNB 2YYSA 4NEHB 2IS2A 1VQPF 4V0KA 4OQZA 3ZLJA 4BFVA 4C7VA 3O9MA 4ZI3A 4DUZO 3I55V 1IQUA 2IEDA 2AOUA 2D6FA 3U7FB 1EZVH 3PNSA 1C1DB 2J7PD 3MTGA 1N57A 3OT1A 2NU7A 3OPNA 2J0SA 1QR8A 5BV7A 3AP1A 4S2UA 4BATA 5A5DA 5HS6A 3UOGA 4C9BA 3UWDA 3UO8B 1JA1A 1D0SA 1D1SA 4WJZA 4IKPA 4P54A 2D1SA 3TNDA 2PWAA 1KGDA 4H0NA 4IH1A 4MQEA 4LHXA 2P5OA 3WC4A 2JFXA 4HLCA 4DSOA 3RT1A 5DNUA 5DTIA 3KB1A 1XAIA 1DXYA 2RQ6A 3CCJV 3ASZA 4M99A 4CV1A 2HQ1A 3UCEA 2DYRB 4P30A 3DW3X 3T99A 1Z2OX 4NR0A 4MVZA 2G8LA 4A91A 4RY2A 3E86A 4FE7A 4E13A 3ZP4A 3PSHA 1CB7A 4J42A 2A1IA 2JAWA 1NAHA 2QRLA 4QFBA 4II2A 3P4UA 3IB6A 1E2PA 2BFFB 4DUGA 1UBCA 4L5YA 1TCBA 2P6PA 4JUIA 1KEZA 2CXSA 5SZIA 5EB1B 3GCXA 2WJWA 4JP2A 2DBZA 1T2AA 4MMYB 2EZ4A 3JQFA 5BP7A 3UMMA 1MB2A 2HWWA 3OZAA 5AQ1A 3PQ6A 2BMFA 3W7TA 2R6JA 4ERXA 1M34A 1WB6A 4MRMB 3STTA 2HCRA 4GR5A 2Q5ZA 2VDNB 1H6AA 1G17A 4C0QC 1G64A 2IF0A 3H2IA 3VQYA 1XEWX 1F3LA 1NLFA 1IN8A 2RNBA 2UXBB 3F3MA 3ADDA 3TKAA 3EXG1 2HSJA 3R66A 4JNCA 1GCAA 5GWXA 2CKDA 2QN1A 4CKXA 2BHRA 5PNTA 1DWOA 4BOYA 3OZWA 5IT0A 4XVQA 3DMHA 1RBQA 2ODWA 1A04A 2NQ8A 3L77A 1COZA 1OIVA 3F6PA 4PYLA 2P2DA 1PNRA 3ZWQA 4YA6A 3K03A 4PNEA 1RZVA 4U2CA 4BMSA 1GZUA 5JANA 1YVDA 1A4UA 2XSZA 1J2JA 5IMBA 4I1VA 3DEFA 1ZIOA 1JYEA 2XB8A 3BSFA 2ZE6A 4RF5A 4BQOA 2IXTA 4FM2A 5CBFA 4E6EA 4O6VA 5FBRB 2JBAA 2ADFA 1ZWIC 1YZLA 4K1LA 2DPMA 5ALDA 3ZS8A 5BNTA 2G09A 4IZHA 1KORA 5DHUA 3KE1A 3K04A 3ZRXA 4DLXA 2JL1A 3TS1A 2VBIA 5KI6A 5AHXA 4RVUA 2FZKA 1B15A 1FNSA 2VZ8A 3W79A 1DEXA 2QV0A 3FZNA 4KR0A 3TVTA 3LUFA 4MCJA 1C1HA 3BPZA 3L3BA 2ASEA 1W0KD 2QWNB 2HD4A 4DV7B 3VDNB 2YY7A 1VLQA 2PA3A 3KUKA 3ZU3A 3ZRSA 1TGVA 2B0JA 2FK7A 3H8JA 4ZKDA 4YAEA 3UA3A 3SHWA 5IH3A 1I4DD 3JAMM 5B6JA 4P98A 2HT6A 2GTIA 2YDEA 1J5EB 3C6YA 4X54A 5EXEA 3UMGA 2HLDA 3F6BX 4S2EA 2R9AA 1HEYA 3OWXA 1Q8RA 2E87A 4BMVA 4KG7A 5FV4A 3DMDA 2ACKA 4EGFA 2RHOA 3N8KA 1C5KA 2O4CA 1BMTA 1K86A 2FRVA 1GCOA 1XT6A 4I9HA 5JHHB 1E1QA 5KU1A 1XD2B 4J7CA 4OHUA 2HDWA 3CWQA 1TU4A 1ZXLA 2IA5A 3A1UA 4W5RA 2QNRA 3GWKC 4R2XA 2QD1A 3VBCA 2GASA 4UTPA 3UT5A 5EC1C 2A7XA 4W5TA 1ZVVA 4REOA 1EXWA 4WOBA 5F3RA 5FUMA 3DDCA 1J9EA 3ZIAA 1Y7PA 1HA3A 4QBHA 5LMUO 4CLOB 4HSEA 3ONVA 1OCZC 2HRYA 1DAMA 2V6BA 3SE0A 3SQDA 1J5PA 1Q1GA 2H31A 2FVXA 4BNJA 3DB2A 3SZ3A 2X8BA 1JJ2U 1JHAA 4H6XA 4OYLA 3EPRA 3ZHQA 1FDTA 3DQQA 2NZWA 2XNDA 1LZLA 5BN5B 5G1NA 3IFXA 3SIRA 4EYOA 4JEHA 3RT3C 3PC6A 1FYWA 2HBRA 4G4JA 2JC3A 2VWPA 1H2GA 3EVAA 3SMVA 3WNZA 2FN9A 1B8PA 4PIVA 5YASA 4P7GA 3DC7A 5EAIA 2QN2A 3CC7V 3DP7A 2CXHA 5BNIA 4ZC1A 2X6BA 2BKXA 1TF5A 4DW8A 1OLXA 4JI3O 3NHZA 5DOZA 3RDPA 4RFVA 2IYPA 1ZOPA 2H5LA 1R88A 4PHHA 1FMJA 1NTZH 1VHWA 2WMOB 5J9PC 2WSMA 3LC0A 4UUBA 1H1DA 5IVHA 5L3DA 4RTRA 1L2TA 2FRDC 4ZO9A 3WS7A 1C9JA 2NVBA 1JX6A 1EM8A 4Z2WA 3EPHA 2QUBA 1I7SB 3S44A 1QFSA 2G0NA 2FCRA 2RC5A 3G0HA 2JG3A 1X38A 2XDAA 3OZEA 2HWKA 4MA5A 1Q50A 4FOSA 2BM8A 4WKPA 3RU3A 2MYTA 3EY4A 3HWUA 2PN1A 2CVOA 1HT3A 4TL7A 4TN1A 4O33A 3WL4A 2HK7A 2RGAA 3QYPA 3EWAA 4M6WA 2AJ8A 3HWRA 3TQIA 2OD9A 3KHNA 4AIIA 4YHHB 2VHCA 4L4SA 2J9ZB 3K92A 3A3YA 1N5IA 2OVFA 3VR4H 2ZXEA 4D9MA 3BHMA 1MU0A 4MVYA 1KNXA 2IEIA 2BE9A 4NENB 5U1PA 3OX1A 2WZDA 1CJKC 4Z1VA 2Z1FA 3WR5A 2OBYA 2ZUTA 1ZGCA 5CN0A 4X60A 2CE4A 1KI3A 4FP9A 1G60A 4MP8A 4GEGA 1MNQA 5JCJD 1OWMA 2WD7B 3PNOA 4TL8A 3TW8A 3IULA 2IY7A 1P8AA 4HBGA 3H1FA 3RFCA 2O8CA 2E4ZA 2Q3BA 3VVLA 3R3XA 2D3WA 3G1UA 3HGQA 2ZP1A 3GJYA 2R11A 2XB9A 1NNLA 3GLFA 3P96A 2XODA 4AP9A 5CB6A 1OAPA 2JJ2D 3LU1A 5JMOA 1FTSA 4O4IB 1JTFA 1ZSYA 5KJ6A 3WDLA 3TQCA 1UC8A 2WYHA 3RVLA 1EUDB 4RQEA 4JB0A 5BOSA 4KHPB 5CDTA 2ITCC 3FDZB 2QQ0A 2ZT5A 4C7JA 2Q1WA 4FM1A 4RZ3A 1N3BA 1NBOA 4F1KA 3N2GB 3T3HA 5LQCA 4BXOB 3GDOA 4X66B 3UY4A 2IH1C 4CIYA 2XVMA 3IQXA 3AWIA 3EC1A 1Z0DA 3BWEA 3KZXA 1GPH1 3UWPA 2HQOA 3OLWA 2PU7A 3QOYA 1NA5A 2PY5A 1OAKA 3AVPA 4RJJA 3H84A 1LUVA 4Q9NA 3FRHA 1BS3A 1CF2O 2R8ZA 1GG2A 2CUTA 3ELBA 1XDDA 1PG5A 2CC2A 3FIJA 2IU3A 4OJMX 3PNBA 2QQFA 1RI1A 4ZCPA 2FPOA 1KMNA 1YJ5A 3CHYA 3A6EA 5ALPA 1DXHA 3N53A 3KZIZ 3DTVD 4TLDA 3ZDYB 4UE2A 1VCHA 4BGEA 1T8SA 3SKVA 1AOXA 1UBRS 4GYJA 4Z8YA 5AVQA 2QA4V 3MDOA 1E6KA 1DHRA 2C9BA 2ZPAA 4PI2A 3PX7A 2XUZA 4B4KA 3EGVA 4M0DA 1ZCAA 1QWOA 2ZUEA 1HFEL 3EZ2A 3H16A 1UJ5A 3UWSA 2MWMA 3WTCA 4MB6A 4BC0A 3ETGA 2XWSA 4MRSA 1JDNA 3JALA 3V5NA 3ZU6A 3KZOA 3KVRA 4FDLA 5I01A 3P0EA 4HFNA 4U0KA 5B4UA 4KP4A 3L8ZA 3C5VA 3Q5EA 3SYOA 3EIUA 4IGIA 5JWHA 4MDEA 4YQYA 2BHNA 4N0DA 4B6FA 2CGEA 4J1TC 1RCFA 2CXOA 4EJ0A 5KTRA 3MS2A 2C9DA 1GKUB 3NVMB 2H9IA 1KE1A 5LVAA 2JD2A 4QDTA 1TVMA 3B89A 2XAHA 3L06A 2FSVA 5T3YA 1CZRA 2PQMA 3TLYA 4TV9F 2WEKA 4UC0A 3U3DA 1I7DA 5LA6A 4FX2A 4LX0A 4V3BA 2YMLA 3KOMA 3O93A 4MS4B 4P35A 1VI6A 4R8KA 3WSVA 4XCQA 1ST3A 1V3TA 1X19A 3V1YA 3A26A 5TVKA 1Z8HA 1ORHA 4A8TA 3HN2A 2Z3WA 2YJNA 2JAQA 2KG7A 3E9DA 1YQTA 1Z4PX 1CUVA 1NE2A 4WN9A 1XCPA 2QWPB 3FHOA 2F1OA 5BWLA 4RE5A 4HATA 1JR3A 2UYOA 1T3TA 4PG8A 3BTUA 1O96A 4RTOA 4COKA 3FFQA 2PMPA 1T9GS 3RVRA 1KJQA 3AL0C 2ARKA 4QVKA 4TMXA 4MVJG 3OOYA 4EMBA 4G97A 4FM9A 3B5IA 5JJ5A 2DETA 4NJMB 2SBTA 2GHRA 3L74H 1K33A 1GEEA 1F0YA 3P9IA 5ILOA 4NYIR 5COAA 2ZSDA 1UF9A 2R0QC 2L6LA 2GR9A 4G5FA 3O03A 4JBXA 4ZHSA 4C6SA 4B17A 2Y0IA 3AK2A 4RXMA 3LUKA 1VSBA 4Q4LA 3RU9A 5BSUA 1TUBA 2OLEA 3P7MA 4TXMA 2JLCA 4X8HA 1C7JA 4YWHA 4TWBA 2JGIA 4RHFA 3UEOA 2QXUA 1HTTA 3ROTA 4IDCA 1I7FA 4J7ZA 2WJ6A 3KOUA 1E4YA 4XD7D 2HSWA 1A4XA 3VR3A 2OZVA 5CFOA 1TQ4A 3UO3A 1E6CA 2O8FA 4Z9FA 3OCCA 4NV1A 3E7XA 3WRYA 1K2WA 3MILA 1TW2A 4ACAA 3M1XA 4FKBA 4GMHA 3AP2A 2Q1UA 2ZNIA 1KI8A 1RQGA 2ZKLA 2AEEA 1Y1QA 2J0UB 3URMA 3BDVA 4BNYA 2VA9A 4E21A 3ONNA 4TYWA 4BFUA 5A62A 2Y3IA 4J80A 4N3AA 2G0TA 2GBCA 5EJ4A 1V48A 4YCDA 4XR9A 3INTA 1U2GA 3QV1A 2XB4A 4EPWA 1L3CA 1WMDA 2BPOA 2G70A 1U28A 2HYDA 2ZB2A 3DLAA 2EKPA 3TR6A 2AC2A 4MX8A 2ADMA 3DV0A 3BB1A 3U81A 5JDIC 3P20A 2Q7DA 1MAHA 4UAGA 3O8NA 2JAXA 1JY8A 2RH9B 2CD9A 4G0PA 2X3UA 4B1FA 4N40A 1G8MA 1YCFA 2Y6VA 2O1EA 4D46A 2ERYA 1I5YA 4IEFB 1R10A 1H6DA 3HCBA 2VUIB 2KTUA 2I3AA 3T4UA 3TGUH 3RCBA 3I6BA 5LP1A 3QXGA 1TYAE 3JD2A 3GZJA 2EFYA 1XWWA 4OJQA 3UXYA 5HF5A 4ERHA 4KQFA 4WOPA 3GTZA 2B2NA 2XNKA 5KYGA 4R1OA 1OAOA 3G6KA 1H85A 1XCLA 3EQ7A 4P7JA 2G9VA 1PFKA 1C8KA 4F12A 3OR6C 1Y3CE 1JBEA 4HCJA 4WFAV 3HKEA 1OE0A 1YNOA 5EZYF 2OWOA 1SBYA 4TQAA 2WIFA 4JXJA 1ZM3A 1QGOA 2DPXA 3H5NA 3WMEA 1R5OA 1WUTA 5B1IA 3R3ZA 3DLPX 1JEJA 1V9CA 2C95A 4MJ7A 2GVNA 1FDRA 2UYPA 1E64A 5KUTA 3GJ0A 4PX2A 1YU9A 2PUJA 4MWDA 4OHKA 4ND6A 2VP0A 1BZYA 1U2RA 4JAAA 1TA9A 4YMGA 4GYYA 5ITSA 5FEMA 2D74A 4DIKA 1ECBA 5IYCO 1LQUA 2M6LA 3ZD8A 3O3MB 4UE6A 3EEOA 2ZJ8A 3PHGA 3IT1A 4GSYA 3IIIA 4KNVA 1RJ9A 3THSA 2Y4NA 3M1YA 1JN0A 2HJSA 5EE5B 3BK1A 3CNLA 2CY0A 1V5FA 4GX5A 1AK2A 2IAFA 4AY4A 1DCMA 4UXIA 4PFKA 5EWRA 4JUAA 3VZCA 1E1NA 2C2XA 4TS1A 3VTFA 4Q9HA 1QFJA 4K9RA 1YR1A 1DFIA 2E7ZA 1JG1A 2ISSD 1PRYA 4DBLC 3MYYA 1XZMA 4FNMA 2P3LA 3UT6A 5KHGA 4HMPA 3VPHA 4K6HA 1E79G 4MVRA 2VRZA 2QRUA 3TD4A 4E4TA 1CEQA 2CWWA 5M34A 2XQIA 3E9CA 1IL0A 1DBWA 3QGMA 3QXHA 5F12A 1BWSA 2RBKA 3QTBA 1I51A 2LW7A 4BVLA 4PU0A 2UXDB 2IEGA 4AQDA 1MV5A 2WSBA 1K3EA 3T7DA 1M1UA 3IC5A 3S3TA 2V6JA 2CJWB 1U97A 4B0PA 2DJVA 2ZSJA 5IT5A 3GBPA 1NUUA 4WFFA 2SKCA 4QGGA 4GLFA 4C7UA 5D2CA 3U11A 3PTLA 4PINA 3OTOO 3CW9A 4K9QA 4MTLA 2A5LA 1N2CB 5EMLA 3HBLA 2J41A 5JPIA 4E08A 1Q0TA 1C2YA 1SXJC 3LKDA 2IYTA 1Y7LA 3SZMA 4NNPA 3ZWYA 4C0LA 3F5SA 3RA6A 4FHGA 4RD0A 5HBGA 4OLJA 4CR6A 1T2CA 1NJIH 3QUTA 3BMXA 4O4HF 5TGDA 1E9AA 1RU3A 5ALYA 3D5QA 1YZQA 1V43A 2Z1MA 4B8YA 1H65A 4W6QA 3UTCA 2O5VA 3CLVA 3ZZ1A 3MB5A 3IDFA 2CL7X 3KCXA 5BQPA 1H2YA 1NQXA 3R3WA 5L3VA 1DPGA 5BSKA 3FAVB 2JHGA 3BICA 1ESNA 5I7VA 1G16A 2CLOB 2F8TA 3ENWA 5IXJA 2W2QA 5GJCA 2BKUA 2PT9A 1U63A 4PX5A 2A06H 4DM4A 3MINA 3G2KA 4PLYA 1J24A 3IBTA 1ISGA 1JVBA 4DIFA 1O0SA 2D0IA 2R5NA 3PVZA 1PX2A 2O3JA 1O87A 2WSSG 1H0RA 4B0OA 3VXKA 3W2EA 3PHHA 2ZZMA 2VYCA 2O2HA 3AEZA 4RMIA 2X7HA 3EZFA 5CX1B 1PQUA 1PDVA 4WMLA 4KE8A 4AIRA 4KYIB 3U3OA 4EY3A 2ZCUA 3AGKA 1VQ8F 3WGYA 3OHPA 4G36A 4CLXA 4XDYA 3LBHA 4PWYA 1EYZA 2RGUA 1ISRA 8ADHA 3P19A 4R2LA 3N2KA 2P4HX 5LU8A 5F5XA 4LKRA 1KJNA 3LUHA 1QO0A 2VT6A 2Z30A 2Z1NA 2CLLB 3BL8A 1IBRA 1SELA 1FZTA 1ZN7A 1KAHA 1DXQA 2ZQZA 1YBAA 3VFDA 3A6DA 1RPAA 5EJ9A 4R84A 2I9KA 1OLSA 1C4XA 4ZQCB 2V65A 2C7RA 3J7AR 4P3KA 3HLTA 2OCCC 2Y93A 1UWKA 1ZUNA 3VC2A 2MMGA 2AQIA 4BJHB 3EDRA 4DFDA 3A10A 2XQGA 4JLBA 4DW1A 1XEFA 2IE0A 2ADOA 4PTLA 1IG3A 3HXKA 3BF7A 5CLIA 4D82A 2IX3A 5COQA 2CW4A 4RY9A 3SEFA 1OD6A 4I5FA 5I4CA 4S1VA 2FW1A 3E6AA 4NE2A 2FUG6 4UFPA 3HKBB 4ZI2A 3FPEA 2DN9A 1DAGA 5E9JA 3R3YA 3ZMVA 5GJWC 2CV0A 3W3ZB 2E9SA 4J1QA 1LLDA 3WNQA 4TLCA 5ALIA 1M1KW 3E4CA 4PE5B 4D4HA 2E6UX 1BFKA 2HB6A 4KITB 1WV0A 2ZT6A 2AI3A 1EVZA 5C8YB 2ZPTX 2DT4A 4UMVA 3HYSA 1A8IA 3QQ5A 7REQB 3I45A 3OIFA 3IV7A 3F3KA 1GQSA 1YBMA 3ECAA 1Z6ZA 2F3PA 2Q4BA 3IT3A 3N0WA 4IYRA 1L7QA 4D42A 3NIFB 4JC4A 2RBGA 3PYMA 3DXXA 4F92B 2W6JD 4F4LA 1LC3A 4E1VA 4KXNA 4WH0A 5HOEA 1QAOA 3GB9A 5AHWA 4MGKR 4LE1A 3HU3A 1UFRA 1D2CA 2MSEB 4FLEA 3P9XA 4WW0A 5CXXA 1WETA 4CMCA 3LUCA 3I9V6 4MWZA 1VPLA 2ATEA 2QN8A 2JLSA 1XTKA 2HQRA 4KTVE 1VHJA 4XWTA 6GPBA 1VKNA 1IQ0A 4G9GA 3J80N 3ZWAA 1QNLA 3WK8A 1CUSA 3K2QA 4ZEMA 3FTDA 4AXBA 4JI8B 1FQJA 5B1SA 5KNCH 1CXZB 1T1SA 3MOIA 1ZHFA 5KSZA 3U56A 1OZFA 4HNQA 1VH8A 2ZKOA 2EBOA 4FCCA 3A6LA 3ZDCA 4HAYA 3IA2A 1VKRA 3M1AA 1IY0A 4C01A 4P7BA 5I45A 3D6AA 2DQSA 4I36A 2GK4A 4BAYA 4GPD1 3FPJA 1XXLA 4BVGA 1BCSB 4J4BA 3HKDB 1T3HA 1S3JA 2VR1A 3QZUA 3OQPA 4IMRA 2QE7D 1P9OA 4YJFB 1QRUA 4DUPA 2DYRC 1U5BB 3DWFA 5GOZA 3AK3A 4M8IA 3EVZA 3F7OA 1P0PA 4JWKA 1CQZA 2FMTA 4X5OA 1C3OA 2FEXA 5DM2A 3D7LA 3HKCA 2EBUA 2BRUC 1R4ZA 3TMKA 4MULA 4QZVA 1EVYA 1QF6A 1SRQA 1SQVH 5DNCA 5CEEA 4UFOA 1WEHA 4ITRC 3ET4A 1BL8A 1G3MA 2RK6A 4YJ3B 2HZBA 5JWOA 3JATB 4RK6A 4IEIA 1G21E 1AHPA 3V7NA 2EG5A 1PEKE 3DBHB 1RZUA 2WT8A 3GJQA 4QUHA 4LHYA 2A5DA 3NYRA 1KO5A 3AM5A 9GPBA 4NB5A 4M1YA 4M76B 1XRPA 3BZBA 3PFGA 5D5PA 1Z2CA 3GEGA 4RVNA 2OZLB 1CZHA 2GFIA 2PGDA 2W6PA 1NHGA 4CTMA 5FD8A 2Q2NA 2V4DA 4HZ3A 3TPCA 4O8CA 3G59A 2XMSA 2J3JA 4G0NA 4NX2A 3RBAA 3MJVA 3GW8A 4DVGA 3G5UA 3KUDA 4DREA 2UXBO 1UJNA 4JASA 3AY7A 2R9RB 2R6FA 4LF9B 2QRNA 4IGKA 5BVGB 5HJ2A 4PA9A 2YC4C 4PRYA 1ZOLA 4XEHA 1MA1A 1KFBB 4O59O 5TISZ 4PO1A 1YBFA 4L50A 2KW5A 2D3OW 3JQQA 1GN8A 4GW3A 1ODJA 4UDOA 2IUSA 4GMKA 1NW7A 4DDMA 3D0QA 5KX5F 1VP3A 2YXDA 4E11A 1EM1A 3NM4A 2ZIXA 3K1TA 4V02A 3C6XA 4AQYB 2DYKA 1H69A 3ZGZA 3QVNA 4RM3A 2QMQA 4N54A 1RAGA 1I5XA 4FFMA 2DJ5A 4G1EB 1S8OA 4DMGA 1OV6A 5A9RA 4RMJA 3HC7A 3LNTA 4QTYA 4KGVA 3QVMA 2PX3A 3I8OA 2NW6A 2NO9A 5GAJA 5F1OA 4PGHA 4DR5O 3RJ9A 4IGEA 1PLLA 2WFAA 2ZSBA 1JQ0A 3M5WA 5LBUA 4IUBS 2AFVA 1U1GA 3U48A 1PO7A 3LXRA 3G9UA 3AK1A 4BWGA 4HVLA 1SKYB 1UDCA 4IO1A 2EYUA 1XZDA 2Z95A 4DV7O 1HETA 1T0AA 1GAQA 3QU2A 5I8ZA 1G6OA 1KYWA 2X40A 4K6OA 3CCCA 2QKSA 2IEBA 2CWDA 1VIBA 5G1OA 2G9IA 1RWOA 1P44A 4HKTA 1BU5A 1NMYA 2OHIA 3B2NA 3RYCA 2YH2A 1RSOA 2OKCA 5ITVA 2Q21A 2GBIA 3KQHA 4HLUC 4B4VA 1AD2A 4KB5A 1C3JA 3GCGA 3RW0A 3UMCA 4HDSB 4DCOA 3IUQA 4B6EA 2IYSA 1XZGA 1ZRNA 3CSSA 1H2RS 4PZAA 5DBEX 1YQNA 4ZZ2A 3C7DB 1R0XA 4KVFA 2P3OA 5TQJA 3QEKA 2PTHA 3ZWCA 3Q6MA 1JLHA 4FI3C 2IH3C 3ZYCA 1WKVA 4ZVNA 1OH7A 1N32B 1DX6A 5FOSA 2I22A 1Q20A 3VKGA 4Q1BA 3VHXA 2F6RA 1SVOA 2C2BA 2FX3A 3UBMA 3WGIA 2H2IA 3EIWA 1PLJA 4AI8A 2YSUB 5DEOA 3ZHRA 2E4UA 4NPAA 2G9UA 3U1BA 3ZJZA 4BUJA 3GUVA 1HX7A 5BSMA 1VF6C 3ON1A 5KINB 3G4SF 5DTQA 3OJFA 1B14A 4UFZA 3TXQA 3BKWA 2QL7A 4WIAA 5G0UA 5FTLA 3BGWA 2V7EA 2HPZA 3OBWA 1ZGJA 3IVAA 2UUCB 1JE0A 4UZEA 4RULA 3GLGB 4UJ3A 4MW6A 5DXAA 1Z5UA 1SQBH 5DISB 2FFAA 5J59A 3TOSA 3VO9A 4PWZA 3KK0A 4BQPA 1K27A 1IBLB 5AUNB 3HCNA 1PT6A 3CLTD 1RHJA 3THYA 4RIFA 4L51A 4LEIA 1GTOA 1X7YA 2AEFA 4BYGA 3L4BC 3VH4A 4BT5A 3UK7A 1UOQA 1QBGA 3D8TA 1SO8A 1T2NA 4RD4A 3I2IA 2B94A 3LM8A 4RPGA 1V11B 4FYKA 2F1HA 1HQKA 1QAQA 3ASVA 1U3LA 1PTKA 4R8RA 2X3YA 3E3LA 3RFFA 5KSOA 3QSGA 2GKGA 1QP0A 3SQWA 2JGDA 4LGVA 2YV2A 4L6AA 4M36A 5FRDA 3T7JA 1XXHE 3QK7A 1YQ9A 2W2KA 4N6GA 1Q8IA 4MICA 2VA8A 4YHHO 2H51A 1Z75A 4KGXA 4NK4A 4BW5A 4L0QA 1O6FA 4LKOA 4MW5A 3OAAG 3RVNA 3EZLA 1PT9A 1BSVA 4LF7O 4R40A 4ZTZB 1C7FA 2C03A 4V0ME 3I9FA 4E5NA 1Y8ZA 4QOSA 2UU9B 1ZH0A 5IHXA 5TPWB 1J0EA 3C74A 3EGEA 3TNYA 3C43A 1MSWD 2XX3A 1CDOA 4G63A 3K59A 1GQFA 1E1RD 4UASA 3TAUA 3IP7A 2WA3A 4QXOA 4MQFA 4Y6PA 2XUJA 4UAVA 1E66A 5AKLA 1OFIA 4NCHA 1CHNA 3H2ZA 1GADO 2C8JA 2PO5A 5FTKA 1BHAA 2NSYA 4J7AA 3X1MA 1M2FA 5HQ3A 4J10A 3C48A 5KUKA 1GZVA 4K9SA 1QZTA 4FQ5A 1FC0A 3W5HA 1X80A 2JFVA 3T1HO 3K0TA 2GN0A 4R5HA 4KHPO 4RO2A 1JU9A 5BRAA 2IY9A 4BMOB 5BWCA 3DHVA 3NIWA 4MA0A 5AW0A 2I1WA 1YZ3A 4N65A 1YONA 2QT1A 4ZO7A 1XMVA 2JLXA 2LD4A 3VZPA 5EMJA 3E89A 4X66O 4CKYA 2NUAA 2WF8A 3F74A 4PEVA 4JJZA 2QVGA 3RYHB 3TKLA 2OHVA 4KN9S 1H38A 5A4FS 1N3YA 3RHSA 4L08A 3VTIC 3NS7A 3M6FA 2RG1A 4DLUA 2X86A 3BL6A 1HE4A 2IC5A 2IIVA 5KMGA 3H8WA 2VZEA 4F6EA 4XOUA 4BNXA 4DW0A 2OE2A 3VDXA 4MS3B 3G02A 3T1NA 4ROTA 1T36A 4FLYA 2G4CA 1S5LZ 2Y27A 4FFWA 3GT0A 5MFPA 5DCYA 3WGQA 1VARA 1PEYA 4LY0A 3W77A 3HYRA 2V55B 5BNFA 1OIWA 3BXPA 2Y1FA 2AR9A 2GD2A 3K8YA 3DZCA 5K03A 5CH8A 4WLVA 1Q74A 1WOMA 1R1BA 2AJDA 3PRYA 2LE0A 3RKRA 1DRKA 4ZZIA 1U0BB 1KH3A 3CEPB 3V32A 4NY1A 4HDRA 4G6ZA 3A4YA 2H3OA 4J9VA 5BORA 2Y71A 4ZOCA 1I30A 1U94A 4PYOA 2MSKA 5JNLA 5F21A 2ECFA 4JU9A 1IXYA 3V4RA 4MKZA 4UCXA 3LKVA 4NJEA 2R8BA 4CHGA 4FWTA 3UJAA 3JQ6A 1U02A 2QD5A 4BQSA 1GHTA 4PX3A 3B7PA 2HSEA 3NU1A 4MV4A 1ECCA 2Q7GA 3F9CA 5HS4A 3I01M 4TQDA 2HCTA 5EHNA 4G2NA 2B8JA 3Q7PA 2D7JA 4ZIRA 3R8XA 3GLIE 3VBEA 1ZIPA 1YQUA 3B7WA 5IEJA 3IHWA 2E18A 4W7SA 2JKZA 5C5EA 3QQPA 4ID9A 1GR0A 1LJ8A 3UK6A 3EGWA 4OAQA 4CCYA 4XDZA 5IASA 1EBBA 1FRFS 4NAUA 2IS1A 5JASA 4PC6A 2XV1A 5CLGA 4WZBE 3EC2A 5GW7A 2PX5A 3ZCVA 3L0SA 2X9LA 2Y9MB 1Z0ZA 4Q7KA 2MDTA 4YJHA 5L3SA 4JP5A 2WB4A 1DT3A 4NEGA 3TD9A 2WA4A 2WQ6A 1WDLA 1BE6A 1VA5A 3B36A 2R8YA 4DR6B 1QVZA 3V8NA 3ZJUA 3TXYA 4MQ4A 2O6HA 4DG5A 4FT4A 1Z34A 3RSGA 2PGLA 4LBVA 3IAAA 4JI5B 1SBCA 4B7KA 4D92A 4B81A 4HNGA 4RKYA 1DGQA 5CDUA 1Y76A 4KL8S 3AFOA 2LR0A 5DEIA 5BNWA 1W1WA 4IQ0A 2UUAB 1XOIA 4Y0NA 1GTVA 1OLOA 3K70D 5IYZA 1DG1G 5BUZA 1AC5A 1GGNA 1H2KA 4DV1B 1PFWA 3QU9A 1VE9A 2Y8EA 4ZYVA 2WALA 4UEOA 3PRKE 3WKCA 1YF3A 3EW7A 2OBBA 4BHTA 4WWHA 1GQQA 2BE7A 1L4MA 4HEQA 4GR9A 4IIEA 1E8MA 4DQVA 1OI2A 1JDBC 3NDRA 1G63A 2DQZA 4L4RA 1RTKA 4P2GA 4QREA 4IV5A 3LCVB 3LCCA 2E1PA 3U7IA 1EN5A 2ZQMA 1CNFA 5E6RA 1ZH4A 3LVFO 3DVAB 5SY6A 4BT7A 3D8RA 1E8DA 3OBBA 1NVFA 1LBTA 3KHTA 3P9RA 1R3DA 1XNRB 4I1OA 1V2GA 3A6FA 1NFFA 1J8FA 2HPVA 5A3JA 3BFPA 2D59A 5TMPA 2XNCA 4W5NA 4JOSA 3ZHXA 3G88A 3JYPA 4FIPC 3S1SA 1WHTA 2AEMA 2NWQA 1Y6FA 5FPPA 1MABB 3T38A 4CLRB 1M2NA 1THTA 2WRZA 5BN3A 5DCLA 4UE3S 2QI9F 1ZGZA 3RSQA 3T5MA 1E9FA 2WYOA 4GP9A 4TWJA 3SLKA 3I0NA 3MG9A 1YQEA 2LGJA 3WPXA 2A84A 1I14A 3F7MA 1Q77A 2O4UX 4BX8A 1SAYA 4QSHA 1LY1A 3VCZA 1V1MA 4BDSA 1U3WA 2JZOA 4REQA 3X44A 1GQOA 3ENQA 3FNQA 3CX7A 3B1YA 5DT9A 2AFRA 3OX2A 5FOUA 1YOBA 3ID6C 2R5WA 4J7XA 3DCYA 3GJSA 5DNWA 1QK5A 4WACA 2JIZD 3I6MA 4IGFA 1SRRA 1JHUA 2FLWA 3ED1A 1HKHA 4QNNA 2ABWA 4JKYA 2W42A 3IVCA 4TROA 4XUEA 1LSUA 1Z07A 5HILA 2XAUA 1IFXA 4HUJA 4Y2VA 3DZIA 4GQIA 3WZ2A 4FX5A 4J41A 4YRQA 3UJNA 2YTZA 3QHAA 4BY9E 5DSTA 1GT91 1JJVA 3LFHA 4OBBA 1K0FA 2QVZX 1UPGA 3RRZA 5TARA 4E94A 4G4XA 3OF3A 1TNDA 2C4VA 2ZS7A 1FXWA 1O9GA 1TEHA 1GGHA 4GLOA 4PQGA 5FNVF 4HGOA 4HR7A 3R7DA 4EARA 1PL4A 4LZOA 1FNNA 1X87A 4E7OA 3OIVA 2B20A 3ORHA 3P0RA 4R1PA 4DC1A 2H3HA 4L3VA 3D7MA 4S1WA 2B3TA 1XRJA 4GPIB 4DA8A 2H6LA 3DDHA 3DXRA 2C77A 4TMWA 1A4IA 1Q11A 2PXCA 3LOPA 2MR5A 2HYIC 1Q83A 4N4AA 3SSNA 4UEJA 5KYKA 3SX2A 4IY1A 3M6UA 3NZEA 1U0OC 1IOLA 1I7NA 2IU6A 2W6ZA 5L3FA 3E70C 3LDUA 4QKQA 4QNHB 3FZGA 1F5SA 4MV5A 1LLQA 2ERXA 4M60A 1T3SA 4V1CB 1FRQA 2QRGA 3PWSA 4RNCA 1VLVA 2YJGA 5JAUA 2YICA 3KSZO 4HXEB 2IGTA 4QXQA 3H7AA 3EDMA 4DIEA 1OYWA 1OLUA 4KFTA 1D6SA 1TXGA 3CIOA 1EIZA 1A5TA 1OASA 3R6TA 4OXNA 3A2FA 3EB9A 3GROA 2HS3A 4NNJA 4HDKA 2AG5A 1M74A 3Q40A 3APQA 3OEED 1NRWA 1C4WA 2YWHA 1V71A 1T8RA 5C7LO 3TUIC 1KEPA 4CG3A 4C5BA 4PZCA 2QTVA 4MDHA 2R4TA 1D4FA 4WZAE 2YS8A 4ZJYA 3GVMA 3TZLA 4OXIA 5FNZA 1RWQA 1XEQA 1RYEA 3IBSA 2OV2A 3HBFA 1Q92A 4YXWA 2H52A 4OV6B 1DWPA 4HDNB 2HF8A 4LJ7A 1F51A 5HXAA 2PTGA 1RPTA 1SH7A 3BMQB 1U2PA 4BNLA 5DK6A 3WMRA 5LIPA 2DFPA 4AJHA 3B1KA 1GTZA 1XLUA 2AS0A 1KK0A 4I1UA 5C80A 3EOZA 3LL4A 3V4FA 1DG3A 1YBHA 3CUVA 2JIBA 1TZJA 1Q81H 1C7QA 3I1YA 3T4EA 1JFLA 1Z73A 1NMSA 1T5LA 1QIIA 5LLTA 5HYVA 1QIHA 1QZUA 5IAJA 2HJHA 4WFBV 5I9BA 1Z68A 1P2FA 4WJLA 5KO2A 2P0EA 5T8KA 3GQBA 4UTOA 3D2AA 3PG5A 4C4TA 4ODIA 3ZD7A 3P52A 4NG5A 2OZKA 2J3QA 5BWBA 1LLFA 4QPPA 5EZYB 4C88A 4RACA 1BXGB 1L5HB 1EUQA 4PPGA 1MRSA 4BE9A 4M9UA 3BRCA 1JQAA 4LWOA 3M9XA 1UJBA 3BYZA 1NVVQ 1F9AA 2Z1EA 2GKOA 4QXAA 3OZBA 5IAKA 1DT5A 1JP7A 3I30X 2D0DA 3HV2A 3WK7A 4FD2A 1GOTA 1DJMA 1CX9B 3OJ0A 2BUBA 3V7WA 2G06A 1DO2A 2YJ5A 1EPUA 4ON9A 2BBTA 1BMFA 1R6NA 1M7BA 4DXWA 4TYPA 1U1EA 3AVYA 3VNSA 3SIPA 4FKMA 4EB8A 2B8EA 4FLZA 4Z7QB 3ESBA 3FR7A 1PR4A 5REQB 1REQA 1J49A 5ARCA 3T7RA 2EINB 3UMBA 4DPKA 4G1BA 3T4PA 4LK2A 2I6QA 1F2TA 1OXSC 3RYIA 1B6QA 4B7CA 5EKUA 2XHEA 1ZH6A 1SBHA 2HU7A 4LBZA 2XWQA 3MTIA 2WFLA 2KB0A 4LBWA 3S5JA 1JWAB 4L9SA 1PP4A 4E5VA 5CT6A 1YZTA 1DRWA 3JPWA 1GTRA 4XWAA 4X7RA 4X85A 3SJCC 4HUQA 4ZVTA 1TVEA 4BIUA 1EE2A 3SJBA 3AJ9A 5IJAA 3RAEC 2QX7A 1QV7A 5A0FA 5LB4A 4CTNA 4J90A 4ALIA 4MWBA 3PPWA 3W6PA 1F2DA 1RYNA 5JZOA 3I04A 3MRVA 5AI0A 1SULA 3RUAA 3ZWMA 2X76A 3CWBH 1UBLS 3U44B 4BV8A 3FTPA 1YB5A 4IV0A 4MV7A 1JNXX 4E30A 1KSJA 3MD9A 2D2IA 1OXXK 2I2XB 2R1TA 3FF1A 5AVUA 4LXYA 2FVYA 3AR4A 3ND5A 1Z4NA 4IICA 3CR8A 1LV7A 1WIWA 5ALOA 3GWGA 4PNZA 4CNQA 1BC5A 4UHJA 1EA7A 2OXIA 4O4HB 2XQKA 4C21A 1Y3FE 4PVDA 4WKOA 2V1XA 1JQEA 1GPYA 2IH4A 3GRPA 1VQNV 2L18A 3ELWA 1EBOA 2FSFA 3JYQA 5F7OA 3E22B 5CVEA 4XE5A 5HFJA 1RCTE 3ZRVA 3TJZA 3FD9A 1YGPA 3UMYA 1QB8A 1DWQA 4CC6A 3RSLA 1O5IA 1PVVA 2OAP1 3ZQJA 4Z7OB 4RHCA 2DBVO 1ZXXA 4LQDA 5C5IA 3WG7C 2H0AA 4JI8O 3IJPA 2ZWOA 4OHOA 4KO8A 3ZVRA 1Z7GA 3I09A 4PZ9A 3L40A 3DOHA 3QE3A 2OV3A 4C6HA 4BLSA 5C51B 3VOBA 1ZMBA 3Q15C 1LRLA 3LO8A 1ESZA 3PHCA 4NG4A 4O63O 4Q3CA 1G8PA 3MUNA 3WHIA 4V2IA 4X6YA 1Q5OA 5D3ZA 5HX7A 2VS1A 3M6XA 1WB9A 3HUEA 5KAMA 2Q99A 3N2ZB 1U4OA 3PLAE 3USES 4E32A 2PGNA 5C18A 3CGGA 2W83A 5EESA 1DDOA 3CCFA 3WNCA 4TQFA 1W73A 1RT9A 3OECA 3EZXA 5FTJA 5K8CA 3RU2A 2Y1EA 4J4HA 3U40A 3EGXA 4DMLA 1U9IA 5J2TF 2YVUA 5DCVA 3AVXA 3AEQB 2F17A 2BEWB 2VDLB 2Z08A 4JYMA 3LVQE 3OG9A 1KWKA 2AFHA 3DNPA 2JS5A 1UPCA 1A7KA 1Y6QA 4L3WA 4BCBA 1J90A 4GGOA 3NR2A 3M81A 2P5YA 4AKIA 1BH2A 4ZVPA 1NKVA 4GM1A 4ZVSA 3WLRA 2JIQA 1UC9A 4BEWA 5B2FA 4OQQA 4X8LA 4JGGA 2ZRCA 3X2QB 4OQLA 1P75A 5JRJA 1KJIA 3HG7A 1KKMA 5C7YA 3EZ9A 1LLUA 3L1IA 1L7RA 1G42A 2NACA 1SGWA 1P4RA 4Z1MD 3NV9A 3VR1A 2CUGA 3IAS1 3PD0A 3ZMZA 4D80A 1WMBA 1PT8A 2QL5A 2FXVA 2GK3A 3ANYB 5C4IA 3I5UA 5T64A 3OKCA 2VQFB 1Y81A 3KV1A 3IE2A 5E38A 3M2TA 2Q45A 5AW5A 4UBMA 4JSTA 4JEMA 3T7KA 5E7QA 2TMKA 4AZ0B 3H4VA 1SXPA 1F20A 2F3TA 5KNBA 1GV1A 3P94A 4CF3A 5EMMA 3U31A 3JQAD 3GGPA 4ASUG 1IK6A 2W4MA 3AHJA 3BJZA 5BNZA 2ZT7A 3FPFA 3UB4A 3I2JA 3L0CA 2PJRA 1TI7A 1NC1A 3RUEA 3JQ8B 3U1VA 1WZNA 3HJBA 4GICA 3EZ6A 5K8TA 3KQVA 5TE9A 1A32A 1H8EA 4J9UE 1K75A 3E1SA 1GAEO 5A6SB 3ZBTA 4WESB 3D54A 4FWBA 1ZGAA 4AQYO 4EFNA 4ISBA 2ZD9A 3ZHVA 4S1TA 5IWCA 1A98A 5JIBA 4HNAA 2WUWE 5LQSA 1JTVA 4BZWA 2IELA 3R5JA 4OQDA 4UUOA 3M2PA 1N8KA 3I7TA 1WO8A 1O2DA 1LSJA 5AVVA 2HMSA 1T9BA 1E32A 2XOXA 5D3QA 4D9GA 3AFMA 3UUWA 5AHOA 4N3NA 4KDEA 2NTNA 3CO0S 3AYXB 5IDJA 3DTYA 5K0CA 5I3ZA 3QVGB 1WPBA 5H6QA 1GN3A 4RFSA 4B80A 3UG6A 4WY2A 2ZE7A 3IAYA 4B3GA 4W4KA 3W5IA 1ROPA 2I62A 3FYIB 4GVLA 4ENUA 2FW9A 4L6IA 1O6GA 2G7ZA 1EFAA 4XVHA 1NATA 4E2FA 5B3JC 2WHQA 1ZI9A 1YI2V 1FYJA 4I08A 1CJBA 3W5UA 4PRKA 5B53A 1C8LA 1PVDA 2YWFA 1Z06A 2A6PA 2TSYB 4YP5A 2I03A 1NTOA 1NUHA 2YW9A 2RGEA 3HCWA 5KIAA 2GN4A 1PUJA 1O95A 1XQ8A 2H29A 3FETA 3LVBA 3W1EA 4YPVA 1F6WA 2BKEA 2HSZA 1YB4A 4EY4A 3F5MA 3ILHA 3CKYA 3NVAA 4F8JA 5JJJB 4OGFA 1MNAA 5DM1A 2JI7A 2GVDC 2ATVA 1IH8A 4WA8A 1NZ6A 4BAUA 2GZRA 4PZ0A 4OI1A 1ESMA 1DLBA 5K6AC 1KZ9A 2I99A 2MSDB 2NSHA 2HJFC 1CZNA 1KO7A 4R7TA 3DYIA 5DHSA 2XRYA 2Z5GA 2BFBB 3PPIA 4M0CA 2POCA 1U1IA 5LWQA 2R7KA 2XUIA 2FPLA 1XVUA 1AI4A 2HJVA 1YV9A 3OICA 5LQAA 4RTKA 1D5WA 5A4KA 5FPRA 3HSKA 1A9SA 3I32A 5IRCD 3CC2F 1RHRA 5CB4A 1PR1A 1YKFA 2C7QA 2EGUA 1SQ0A 2V59A 3I8XA 5K3FB 1I4OA 4B4OA 1E2KA 1A2BA 3PXEA 3V6LA 2C3UA 1I5OA 2ZUCA 4LECA 4GHWA 4A6EA 3QU5A 1CLUA 1I3NA 4AF7A 3OI7A 2VJNA 3AHFA 2OZEA 2YNMC 2VATA 2W43A 1NMXA 1E94E 4U5XA 3E5HA 5DM60 1VQ7F 3K0EA 3VYSB 2EFDB 3Q98A 1GRRA 2UUCO 2CFOA 3IIKA 4QBFA 1Q6UA 5KVAA 4P3NA 1R50A 2G82A 3MGKA 4QGFA 1MC5A 3RG2A 5BYJA 3PNMA 4LJLA 2ZSIA 5DGDA 3ML0A 1SCIA 2C42A 4OXQA 1F7UA 3VNVA 4E2LA 4IIUA 5KX5B 3O75A 5A06A 3NMUF 3GR6A 1UJWB 3FZQA 2VHZA 4UOQA 3P3NA 1IBLO 1AK1A 3ROPA 3G5MA 4E1BA 4RHYA 2B8NA 2H54A 1CRQA 2RD2A 4BVSA 4MR7B 3GJTA 3QPUA 3SICE 5H7XA 4HN4B 1ZLZA 3LHSA 4P4GA 2IPXA 5ISMA 2QUHA 3W2IA 4R8CA 4PPNA 1PBNA 3LPCA 2X8LA 1A50B 2QLLA 5KWSA 1DEAA 4C43A 2AA3A 5K2MA 4I1RA 4C05A 1YL6A 3I72A 1XF1A 3I55F 2FE4A 4FU0A 2GPNA 4LRQA 3CJRA 4M9ZA 5C8ZA 1IN5A 1WY7A 2PK3A 3ST7A 5ICMA 4CQLA 3V3KA 3RT9A 5D51S 1FMFA 3PB3A 1LTHR 3HSSA 3FTEA 1MENA 2GAJA 3DMPA 3PVCA 2KBEA 4TLAA 4CTKA 4E2YA 4CYMA 4C8EA 1EWKA 1W85A 2XUAA 13PKA 3LY5A 3LTEA 1GU7A 2ZYAA 3RYFB 3HABA 3UPUA 4BNTA 3D7NA 3BIOA 1RHKA 2RGWA 3PYLA 4A5SA 3ZCUA 2PFGA 1CERA 2NO6A 2CLHB 3INRA 4BECA 2ZWPA 2UU9O 1RJGA 5K1ZA 5A2GA 3CCJF 1JSLA 2JEOA 4XYMA 2NZ2A 5IBPA 4IMPA 2ONKA 3WSWA 1LJLA 3VO1A 4PCVA 2OCYC 3K7EA 4RSHA 2C88A 1PNVA 4EDFA 1F0KA 1QP8A 3LRPA 4RHAA 3NALA 4IF6A 3AIMA 2C82A 4PN7A 1XUOA 3CBQA 3E18A 3CVYA 2IY8A 2GHQA 3I2GA 1BGXT 2JJ1G 4MHTA 3O85A 2XSZD 1X9IA 1S8NA 3E3NA 3S8MA 3HVIA 3PTAA 5J58A 3WGNA 1K7XB 2FPRA 4MUFA 4C07A 1X77A 4QQNA 2C2YA 3BMOA 4JJ7A 2WVJA 3JX9A 2BD0A 4I4LA 3L1VA 1SURA 4LDNA 3DDOA 5LM3A 3E9EA 2NV0A 4TM7A 4I5GA 3RUCA 2HWXA 3K05A 3QTCA 3OO0A 4F6LA 3A9WA 4WXMA 2YOGA 4XDHA 2WG1A 1W55A 2V7UA 2ZTMA 3PL5A 3KEQA 1XELA 1G9TA 1ZIXA 3HYNA 2HLNA 4XUCA 4ENWA 1S9DA 3UHFA 3ELDA 2OBMA 4HP8A 4WFGA 3WWYA 1B7GO 3MD0A 4LGYA 4AMZA 3V42A 1M5IA 4EF6A 3QE4A 3PCRB 5DGHA 5ALTA 4OH1A 4KQMA 3TN7A 5C8DA 4LJYA 3UK0A 1AO3A 5B7QA 2YR0A 1R8QA 1XJ0A 5JADA 5MDHA 1RLMA 4XFJA 3FHCB 3N59A 3ABRB 3UB2A 1S7GA 2XY4A 2G04A 4AN4A 4CKEB 3COWA 3UT0A 5HUHA 1YRAA 5EAZA 2HA0A 1VIVA 1XB2A 1Z8NA 4QPDA 2UZHA 3SIXA 4HMQA 2IZ1A 4PV7A 1WHSB 1X1EA 1Z63A 3JAKA 4F9FA 3U3MA 1PR6A 1GUBA 1KFKB 1M7GA 5ADWA 5D3MA 2GO1A 3WTBA 1PNLA 1SCKA 3C39A 5TX7A 3SI7A 3TH5A 3OFKA 3PFKA 4UQLA 3K2BA 5C93A 3JSXA 5FLXM 1HTBA 2SCUA 4FBMA 4H1TA 3ZIAD 1Y0BA 2R6HA 2ZYWX 1NZFA 4JT2A 4BX0A 5CIYA 1RM3A 4WA7A 4KLZA 3PNVA 1E2QA 2PR2A 2XUFA 3S0WA 3M4NA 1UFVA 1W4LA 4F5YA 1FPMA 1J39A 1SVUA 1EUCA 1GL7A 4D74A 1CQJA 3CZ4A 4GXTA 1K4CC 5CYGA 4JV5B 1YXMA 2XNDD 2Q9CA 5HJ5A 5HJ7A 4F4FA 3QEMB 3MQ4A 1GG5A 5AQEA 2WHYA 5C52B 1LDMA 4TKMA 2XVAA 4FILA 1ZAYA 3OMXA 3P27A 1MO3A 3H6KA 3M1IA 1YQDA 4TL6A 3UGQA 1ZG3A 4JCOA 2YWCA 2NUPA 5HPYB 3CONA 4G9BA 3ABSB 1TD9A 2FMLA 4H31A 4ZVOA 2HHHB 5K0NA 4R51A 5KHOC 4HC4A 2GK6A 5JD4A 4DR6O 3E03A 1QLEB 3IV9A 3KKQA 3LHDA 4KQGA 3R41A 2SHKA 2ZDIC 2O2XA 4WUTA 3ASYA 1Q7BA 1JWLA 1Z6AA 4JI5O 3S40A 3DP9A 3F67A 2BCCH 2R6CA 3UG7A 3D01A 4YMWA 3NRBA 3EOBI 2UUAO 5TS2A 2G0AA 4Q7QA 3EGOA 4AECA 3N6XA 3V4OA 3LCRA 1H1LA 4DV1O 4UCVA 1R8XA 1YCDA 2Q3FA 3KBBA 4PELA 1XL1A 1FXVA 1D2GA 2EERA 2O0LA 3USCS 4H13B 2BFCB 1OFVA 3BMNB 2J3KA 3UMFA 5EKSA 2HIGA 4FZ1A 1E7YA 4EABA 4RAIA 3B60A 1PM9A 4TOIA 3NV7A 4U2GA 5DWVA 3UJHA 3E0QA 1G6UA 2AWNA 2CHGA 3GXOA 3KSAC 3SBEA 1B04A 2QTFA 2V3VA 3GMSA 1XTVA 3GFOA 1JECA 4XB2A 4C4SA 3ZJTA 1ORVA 4A03A 4C6RA 3GDWA 4Q37A 2RB5A 3FLAA 4OYYA 2GZSA 1CE8A 1RQ7A 1E6UA 3ODPA 4RDHA 3QTLA 3PICA 2JGJA 1G8AA 1DTWA 4CS4A 1IUNA 1YZVA 1XNRO 1OC4A 2H4FA 5D7NA 3A25A 1V8PA 3DWIA 3ECSA 2XQJA 2ZB3A 3BPSA 1YR9A 3CE6A 1VJDA 1CUDA 1P5HA 1AR1B 4FK8A 1UM9A 2OFXA 5AUPB 4P36A 3BXEA 4IX1A 4TT3G 1T0HB 5JY1A 4GLXA 2HKOA 1V4NA 3PUHA 4I55A 2I66A 3HY3A 3T52A 5HKBA 2ZXFA 2HRRA 3Q4GA 5FBZA 3HI4A 3ES9A 5HZHA 3OO1A 4XUDA 4G4WA 1TKAA 4GNRA 1DBSA 1NL3A 3Q12A 1W49A 4DCUA 1Z38A 3LT0A 4YDHB 2A9VA 4MQ6A 4NSNA 1XDZA 1C30A 3NHLA 4RYDA 3CPWU 1U3PA 1ZC4A 3ZCXA 2IHKA 2F1IA 3FCYA 3GMDA 5EINA 3V2HA 5LYJA 3GFPA 2FPIA 3DGEC 2CH7B 1EESA 1R0ZA 3NNSA 4FB5A 4X8MA 2DLCX 5ARBA 4ZK7A 2XPCA 1W34A 2BDTA 3FNRA 2HA7A 3O8DA 2DUWA 4MDFA 4N0EA 1YK0A 4G1CA 2QNIA 4RENA 2JGRA 1D6JA 1TM7E 3OZUA 4R5MA 4ZAFA 1OX4B 3H5TA 3KKOA 4K6MA 2PGGA 1JLRA 5ENVA 1J95A 5KJFA 5B1BB 3R75A 3MWDB 3I3SR 4NFHA 3SYLA 2ZUSA 2IF2A 3FUXA 2R1UA 3COPA 4TWZA 1NW5A 3A2MA 2WM9B 1K5GA 1UEXC 1SQFA 3BRQA 5A4IS 1ZOOA 1Z6PA 5EB0A 1K06A 1E0AA 1EVEA 5AW1A 4FN4A 1F2UA 2PRKA 1NJ2A 4JFAA 3LUTB 2JEYA 1NNI1 4Z4FA 2VP3A 1DC8A 3CB2A 2ADPA 5DI3A 2Q3EA 3CUTA 3G9ZA 2G38A 3OD5A 1SUDA 4D9JA 4KI0A 5B3AA 1TKRA 4HOYA 4NBKA 3HACA 4R6WA 3L1KA 1J5EO 1A5AB 3R7WA 3F7VC 1IYZA 4NMLA 1CUGA 3GAZA 4EW6A 1FTYA 4F85A 4L0MA 4P2BA 2AMYA 4D97A 1FTWA 4H7JA 1E7SA 1UJCA 2NTVA 3PQ3A 5EIOA 1E7MA 5F2EA 4M1MA 2DKNA 1KIMA 2IHZA 2AYYA 2CD7A 4YAGA 1FDSA 2MCFA 2VJPA 2VO1A 4MVJA 2VYFA 2QA4F 4EG1A 1SQPH 5B37A 3WXMB 4MZXA 1JR3D 1SHKA 1OOEA 1KMIZ 1RP3B 1EFTA 2BI4A 2CJPA 4H44B 1KY3A 3ETLA 5LHGA 3HA2A 3B3QA 3V6MA 2W6QA 1QOPB 3MAJA 1O8CA 3NOXA 1F1JA 4EGSA 5IDQA 1KO4A 2EBWA 3C9SA 1J2TA 2Y1KA 4HFMA 1P31A 3KS9A 3CC8A 3EIOA 4URXR 2DQKA 4OLFA 1ORDA 4DR2B 3IQWA 3SNHA 1Z5GA 4ZDJA 1GZHB 3ZDDA 1I6MA 3LIPA 1VJCA 3PFCA 3VR5A 1NT2B 1ZISA 2JS7A 3W5SA 3GD7A 2XXAA 1RBZA 4YRPA 4ME6A 3RVBA 3F8TA 4CN8A 1XI1A 1VYHA 1Z3CA 2RMKB 2H17A 1XHZA 3B2QA 2YDXA 4QOFA 5LOVA 3OTWA 4Y0AA 5DXJA 3VR3D 3MAAC 5JC1A 1F8UA 3K0SA 1QHEA 5HIMA 1MSDA 3OBYA 5KHAA 1QS0A 4QJFB 5HR5A 4WEOA 1LUAA 3QTYA 3UHAA 5IT9M 4RS3A 3BTOA 3BQ9A 3MCUA 1FUKA 5BRJA 4YT2A 1OI4A 3WJQA 4UNRA 5F73A 3HP4A 2NR5A 2JI6A 4X62B 2VPPA 1P1CA 3I58A 2BP7B 4U0JA 1G59A 5BSFA 2QU8A 3CLSC 1OCEA 2ZJ3A 3SC6A 4IFEA 5KHJA 2DHEA 4HGPA 5HF6A 1N75A 3KHUA 4JCCA 5EBLC 4H60A 3WJ7A 1TT7A 3ZV4A 5AW6A 5HFNA 2XMQA 4I6EA 3JZMA 4Q19A 3LRTA 5JJBA 2BTOA 1PSDA 4TKUA 3TJRA 3VNQA 1N6IA 2GWRA 3PU6A 2HFJA 1CQIA 3QELB 3LHKA 4KXRA 3K1JA 1OXTA 2TRSB 5L3BA 3U60B 2WZQA 4QWWA 4BVJA 4FYMA 1LFDB 4IJVA 2RHCA 2OR3A 2AE2A 1U99A 5J1SB 3FGZA 1UMCA 3UNXA 3L43A 3R0XA 1W41A 3UA4A 3RAGA 3SGLA 2WLLA 1KQGA 2Q6IA 2F2TA 3A58B 2Q3CA 1WDMA 2B9EA 1UQUA 1MO5A 5HM8A 4QUGA 3KFVA 5BW5A 3TRKA 4LNUB 4QU0A 3I34X 3G2NA 2WAMA 3VDQA 3NYIA 3X2EA 2UUBB 3NAQA 4QOIA 1ZITA 4FDMA 5AESA 5B1EA 3ZWOA 3W9UA 4EW3A 3CLUC 1ZC3A 3N0TA 1QC5A 3AESB 4U63A 3WGOA 1JMVA 3ZCQA 4Z1OA 3KG2A 1NVKA 3W2GA 1ZNXA 5EJ8A 4GKKB 4JT4A 5EA2A 1JEDA 5BQXA 3OQBA 4IKEA 3OC0A 1MZEA 3DF9A 4R3NA 1OXVA 3R5SA 4X1IA 3PUVA 1S2GA 1QYCA 3C8LA 4OBXA 3EY9A 4ZCMA 5FUYA 1C7RA 3I5YA 1DS6A 5ELXA 8LDHA 1JMKC 2DPHA 4FFDA 1IOZA 1YJ8A 2RGYA 1VQOV 3AHGA 4MS1A 3M99B 3LLSA 2SECE 3FHJA 2LP4Y 2O8EB 1C50A 3T3DA 2LBWA 5FWAA 1PDOA 4RESA 1QG0A 2WD8A 4DGQA 2QOEA 3D6JA 4L2IB 4C89A 3COSA 1SG6A 2EZUA 3NW9A 5H5JA 1FOEB 4MEJA 4IL5A 3DE3X 4INPA 4OOEA 1P9LA 2GCNA 1U7OA 4YDQA 2FEOA 4E14A 1A7AA 3MERA 1GEGA 4ER7A 4WERA 4ND8B 2ZBFA 2QYTA 5I8PA 2H94A 3GJ5A 4HWRA 3CUSA 2O5CA 4HWKA 3BGOS 4CM5A 2LNDA 4C3VA 3FOWA 3J7TA 1NI3A 4G4GA 5K05A 2PKQP 1K97A 3SFVA 1KJJA 2WF7A 4LXXA 5FUQA 2IW3A 2D2FA 1OH5A 5CT9A 3LDAA 1Z6GA 2X2FA 4DMFA 1GCUA 2H00A 4G26A 2I5PO 4B3TB 5GINC 4S04A 1M1KH 4RPKA 3X1WA 3TAXA 3K0DA 2QR3A 5HXZA 3PC8A 3QEJA 1T5DX 4EAQA 5KYTA 4S0XA 3H9QA 1K1EA 4GOMD 1QV6A 3WFJA 4LFBB 4BLRA 3E8MA 3K20A 1KEKA 1K08A 4DIOA 4AULA 3LUBA 5BT8A 2ZRMA 1ISPA 5DM0A 4E4EA 2EVWX 4KWEA 5DGTA 2EX1A 2Z2KA 1U8YA 3ZRWA 4RVOA 5F2VO 1R73A 3QHQA 5GMOA 1X7WA 3W7UA 2AHOA 3HJTA 4OXSA 1WAZA 1XF9A 4UUJC 2FETA 3SHQA 3CCMV 1JR6A 3K9GA 1KYYA 5TQ2A 3FNHA 2A3NA 1XDWA 2WFMA 3ZN2A 3C8UA 5EOVA 5LGTA 1NDQA 4NC9A 1JW9B 4NP6A 4WINA 5BSEA 3TIVA 3BFVA 2NO7A 1GTMA 2PE5A 2B1RA 2PD4A 3IGFA 3OLYA 4OXYA 3K9QO 2JK1A 4TTPA 1TD1A 4EWLA 4TQUS 1TJ3A 3LYHA 5L3ZA 1CBUA 4CG1A 4IJ5A 4MR8B 2WLNA 4NYJQ 5DF1A 4PQRA 2JA1A 1DELA 2ITDC 3OPYA 4YLEA 1FXUA 3L73H 2WSSA 4GYCB 1XV5A 4BX2A 3IOEA 3GLHA 1C41A 3WMFA 2AF3C 4MYCA 4DSZA 3IQEA 1PVOA 1R9JA 1T8UA 3WLKX 3B3AA 3BIFA 1ZQ1A 1WW3A 1GYRA 1J0DA 3EW9A 3PIDA 5CW2A 3IPLA 2MK3A 1VQLV 4HDMA 1TVCA 3ZEIA 3PGLA 1EZJA 4YNBA 3N6RA 1D8AA 4KSBA 4A73A 3U4CA 2I7DA 3CU5A 1ZVQA 3O8CA 1DOAA 3BRWA 5FA6A 1J7JA 1UOEA 2D8MA 2BFDB 2VQFO 3VC3A 1YEWA 3AERA 1XYVA 3QXJA 3DHWC 1SZCA 4PCUA 1PJZA 3NHBA 4Y9TA 2VP4A 1YHYA 4ZCRA 5BSVA 1M2HA 3ZHCA 3IEMA 2QRVB 1UJ2A 3U37A 2JLUA 4JR2A 4KIFA 1GPBA 5B1AB 2I6UA 3SSMA 5FORA 4U2BA 2J09A 3KQUA 2IUTA 2QP3A 3YASA 4EY5A 5IJ9B 3CEMA 3AJEA 1W88B 3CKLA 1T9HA 3EDCA 4ECEA 5TMDA 2B99A 2QLFA 4FC6A 2OHXA 2NYVA 4Y2XA 1PGOA 1CIPA 5DM70 4ZT5A 5CEFA 2H9AA 2IPMA 1SA0A 4EX7A 3EIHA 3QPDA 4BO2A 1JYFA 2JLRA 4WY8A 4RCVA 3A0RB 2ZIAA 1FLAA 5JZSA 2ZDQA 3MQWA 1XKXA 3V80A 4P4SB 1OXUA 1IURA 3G0DA 1U8ZA 3TSYA 2E6KA 2WHXA 5SY4A 1Y8QB 3PLNA 1UMBA 3PF9A 5FADA 2FSUA 2AMJA 3DNMA 2HMVA 1DMSA 4G3XA 3VTZA 1N7GA 3KSBC 5E1DA 2QU7A 4DCJA 3H9EO 2CCJA 5AIBA 1OKKA 3K5PA 2Y1CA 3O4GA 5C81A 1RM4A 1SZDA 4I0XB 4TV9B 4K9DA 1N7HA 3MUOA 2JHAA 4GL4A 1N2HA 4FEEA 3U4DA 2I65A 4ZJPA 3RJ5A 2VXOA 4RTMA 3PFFA 4IS3A 5ER9A 1FXSA 5DDIP 3RBZA 5CBGA 2B7CA 5B1YA 2W6MA 5LQJA 4YJGA 5CT8A 1Y42X 4CIVA 3U4QA 3KO8A 3IDSA 1MPXA 4Q4HA 1FTQA 3AY3A