1QAHA

Crystal structure of perchloric acid soluble protein-a translational inhibitor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
SSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEAKQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAIAVQGPFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERCHLORIC ACID SOLUBLE PROTEIN
publication title Crystal Structure of Perchloric Acid Soluble Protein-a Translational Inhibitor
rcsb
molecule tags Alpha-beta structure
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 1999-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1qahA00
2EWCA 2CSLA 3ZP4A 2CHSA 3L7QA 1UI9A 3KJKA 1X25A 2CW4A 3QUWA 3V4DA 3KJJA 2IG8A 1ODEA 2UYJA 3K12A 3LMEA 1J7HA 1FNJA 2UYNA 1UFYA 3ZO8A 1NQ3A 3LYBA 2B33A 1QAHA 3GTZA 1QD9A 3D01A 1JD1A 2UYNB 3MQWA 1QU9A 3R0PA 3ZOPA 5HP7A 3VCZA 2CHTA 2DYYA 5HP8A 1XHOA 1DBFA 2UYPA 3M1XA 2OTMA 4NWOB 1FNKA 1ONIA 1PF5A 2CVLA 3K0TA 3ZP7A 3M4SA 2UYKA 3I3FA 1COMA 1XRGA 2CWJA 4ZK7A 3I7TA
chains in the Genus database with same CATH superfamily
2HS3A 3ELCA 3F0EA 2PMPA 2OHWA 2RHOA 5HXUA 5BMVA 1YHQF 2CW4A 2Z1TA 3QUWA 5EWRA 3IEWA 3JARB 4I4TA 5LXTA 4X1IB 3OBYA 1VQVA 4YJ2B 1VQ9F 3WJRA 3LWQC 2LBXA 1U3LA 1DBFA 4O4JB 1U40A 3VOBA 1YJWF 2OTMA 3ERNA 5EZYB 3C9TA 4BVSA 1COMA 5EYPB 3K2XA 3L7QA 5MN4A 1S72F 3RYCB 1X25A 3J7AR 1VQKF 1GX1A 1FSZA 4F6RB 3J80M 2KTVA 3JALB 5IJ9B 1YQNA 2I6DA 3S06A 1K8AH 1W5FA 1OAPA 2AIFA 4M8IA 1GO0A 4O4JA 1SA0B 2AIZP 2NMUA 5EZYA 3MQWA 1GZ0A 3N2KB 2HP0B 2CHTA 2DYYA 3CC2F 5EYPA 3LWPC 3CYQA 1PF5A 3SIVA 2CVLA 5LA6B 1VQPF 3ON1A 4EB6A 3JAKA 3LFOA 4F6RA 3JAWB 3TD3A 3N2GA 3I7TA 4XCQA 5CA1B 5DCVA 3CG6A 5GANK 2Z01A 3VTIC 5EIBC 3CMAF 2OTLF 3J81M 5KX5A 1UFYA 1XBIA 3RYIA 2QA4F 3RA5A 4EI9A 3GTZA 4ZHQB 3AGKA 2Z1FA 4TV8B 4BT6A 1Q7YH 3M1XA 4G4YA 5LP6B 3M4SA 3HAXD 3CCQF 3WGKA 3G6EF 1H48A 3FD5A 3K14A 3WGMA 1VQ7F 4ZK7A 4X1KA 4X20B 2JNBA 3KIZA 4DXDA 4BVQA 3V4DA 2K1SA 3JASB 1VQOF 4C4WC 3VOAA 4KWEA 4E6EA 4O4HA 1FFXA 3HWUA 5GONB 2VXYA 3LYBA 5JH7B 5HY1A 3LWVC 1T0AA 3RYFB 1DT9A 3CCEF 1YI2F 3VIUA 4NWOB 3JCMM 4IIJA 1FNKA 4X20A 2HVYD 4C8GA 3P0ZA 1Z5WA 2LBTA 5JCOA 5GIOC 2CSLA 4X1YB 3F0FA 4BT2A 1UI9A 3DC2A 1JFFA 3CCMF 3GHZA 4NUTA 2YXZA 2UYJA 4O2BA 3CD6F 2UZHA 2QTPA 4I55B 2PHNA 5LP6C 5CB4B 1VQLF 3B6NA 3JATB 4G4ZA 4O4LB 2ZOVA 3T80A 3CXCF 3MBMA 1XV2A 2BTQB 5JCOC 2VAMA 4IHJA 1RQ2A 2RHHA 1E7KA 3JVHA 1ZWZA 1W42A 1W57A 3CCVF 3CPWF 3TD4A 3ZP4A 5KMGA 1JJ2F 2VAPA 3ESJA 3KJKA 4FFBB 1W5EA 2GVIA 5CB4A 4X3MA 2Q1YA 4B46A 3LMEA 3HKEB 1Q8RA 1FNJA 2R751 3IEQA 4LNUB 4EI8A 3CCSF 3CMEF 2IAFA 5EIBD 1NMUB 3D01A 3CCLF 4EI7A 3NK6A 3S0HA 3F0DA 3PLAC 1VH8A 1QVGF 5J2TB 4BT5A 3K0TA 3E22B 3V7QA 3CB2A 3JARA 3HKEA 5HXZA 3N4YA 3JAMM 3Q8HA 4X1IA 3C9RA 4YJ2A 3SIUA 4BY9D 3N4ZA 1VQNF 1NQ3A 1TUBB 3S02A 2MQEA 5EB1B 5HP7A 5HY4A 3E22A 3VCZA 1W5BA 2Q1XA 1W581 1M90H 3WGLA 3V7EA 5JQGB 3F0GA 3RYCA 1W41A 5EB0A 2OTJF 3JALA 2OZBA 5IJ9A 1SZQA 2BTOA 5AVMA 4C81A 3OONA 5IYZB 2I6RA 2IG8A 1SA0A 4RQOA 4TUYB 2QEXF 5FJ4C 3PAFA 4ZHYB 3M84A 3N2KA 2HP0A 5ITZB 1RQ7A 1CLIA 2B33A 4B5CA 2UYNB 5CA0B 5LA6A 5GAPK 5HP8A 3QHDA 3HJWC 3IKFA 4C8IA 2RB9A 3NVIB 3JAWA 3V3TA 2HP3A 2UYKA 1U43A 3I3FA 2QI2A 2FC3A 5CA1A 1U3PA 1SDSA 5B8FA 2EWCA 2FGYA 4TUYA 2P6YA 1H47A 4G88A 4DRXB 1K73H 5ITZA 2R6R1 4U3JB 3KHNA 4ZHQA 1PXWA 1W55A 4TV8A 3E1YA 3VO8A 1X7OA 1T0KB 2ZVZA 4WBNB 3NK7A 5LP6A 4R40B 4B62A 2HRUA 1ONIA 1W40A 5HY2A 4BT7A 4DRXA 4ERHA 1YIJF 3FPIA 4U3JA 1IPAA 5JVDB 1JY8A 3JASA 1IV3A 3KE1A 5GONA 3K12A 3IKEA 5JH7A 4G4XA 3D00A 2GLZA 2VAWA 3HKCB 3RYFA 4U39A 4O2AB 1M1KH 5EO3A 3FBAA 3MCQA 2KTUA 1N8RH 2H6LA 1H7MA 3ZP7A 4X1YA 5GINC 2ZAUA 4YJ3B 4HNAB 3G4SF 2DT4A 5J2UB 1VK3A 2H8EA 5FNVB 4I55A 3WGJA 3OBWA 1KNJA 1CK2A 4LCKA 1KNKA 3JATA 1YJNF 5HWEA 5BMVB 2HRYA 2HQSC 3ZO8A 3WJQA 4O4LA 3RA6A 2N48A 4C82A 4I4TB 1QAHA 5LXTB 5MN5A 1QD9A 3FFMA 3HKDB 1W59A 5LOVB 3CCJF 2RHLA 5A2QM 4TV9B 4RHAA 2GZLA 2UYPA 2ALEA 3WGNA 1KC8H 1IV1A 3E20B 4FFBA 3F6MA 3WPWA 1YJ9F 3CCRF 1VQ6F 2LBWA 2HS4A 2CHSA 3RYHB 4LNUA 1OFUA 3MDOA 3HKDA 5LOVA 2G9IA 4TV9A 4C8EA 3S03A 2YYEA 1CN7A 1Q82H 1QU9A 5J2TA 1XHOA 3GYQA 1RLUA 1YITF 1QVFF 3RYHA 3FD6A 3QTYA 2CWJA 1KQSF 2AMTA 1W5AA 3MCAB 4EB6B 3JAKB 3N2GB 4TZZA 1TUBA 4ZHWA 3G71F 1JN1A 1W2BF 2V9YA 3C9SA 3CCUF 3R0PA 3ZOPA 5KX5B 3I55F 2ZF8A 3RYIB 5MN6A 1Z5VA 4G4VA 5LYJB 3C8LA 4BW0B 3WPXA 5JQGA 4ZI7B 2KG4A 1VHAA 2VGMA 5FLXM 1GO1A 2W8BC 3WXMB 4ZOLB 5IYZA 2Z1UA 4BT4A 3VYSC 4X1KB 2HX0A 3RE3A 3NVKE 1TVKB 2UYNA 5CA0A 3CC7F 5LYJA 3WJPA 4ZI7A 1JD1A 4O4HB 1FFXB 2BTUA 1Q81H 1VQ4F 1RLGA 3NMUC 4BVTA 4O4IB 3LDTA 4ZOLA 3I56F 3C9UA 4ZHVA 5C8YB 3O85A 5HY0A 4IIJB 1VQMF 2F9ZC 2L26A 3VMFB 1TVKA 1Q86H 4BVRA 4NQ3A 2LCAA 1ODEA 3IMPA 1W3EX 2WALA 1JFFB 2RHJA 4G4WA 4WBNA 1KD1H 3HTNA 4O2BB 3LWOC 4O4IA 3S0WA 3VI6A 2Z1EA 3HKBB 5GIPC 3EORA 5C8YA 5IT9M 3CPQA 4BT3A 3OW2F 2CZWA 3CYPB 3D54A 2H8CA 5JVDA 3P4EA 4PWTA 1VQ5F 2ZODA 5IJ0B 2ZVYA 3CC4F 3UT5B 1X7PA 4IHJB 3S0YA 5EAZA 2IQQA 4I50B 1X52A 3HKCA 3KJJA 4O2AA 3HKBA 5KMGB 1IV2A 1J7HA 1VQ8F 3U0OA 2KGWA 2VGNA 3TD5A 5G4UC 5G4VC 1IV4A 5IJ0A 1NJIH 3VYTC 1K9MH 4YJ3A 3UT5A 3BYQA 4HNAA 1YGYA 3IR9A 5J2UA 3DDNA 4B45A 2HS0A 1XRGA 3P10A 5FNVA 3LWRC 1R1MA 1RA4A 4I50A 2BO1A 4X3LA 3VYUC
chains in the Genus database with same CATH topology
2EWCA 2CSLA 3ZP4A 2CHSA 3L7QA 1UI9A 3KJKA 1X25A 2CW4A 3QUWA 3V4DA 3KJJA 2IG8A 1ODEA 2UYJA 3K12A 3LMEA 1J7HA 1FNJA 2UYNA 1UFYA 3ZO8A 1NQ3A 3LYBA 2B33A 1QAHA 3GTZA 1QD9A 3D01A 1JD1A 2UYNB 3MQWA 1QU9A 3R0PA 3ZOPA 5HP7A 3VCZA 2CHTA 2DYYA 5HP8A 1XHOA 1DBFA 2UYPA 3M1XA 2OTMA 4NWOB 1FNKA 1ONIA 1PF5A 2CVLA 3K0TA 3ZP7A 3M4SA 2UYKA 3I3FA 1COMA 1XRGA 2CWJA 4ZK7A 3I7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWC A;  2CSL A;  3ZP4 A;  2CHS A;  3L7Q A;  1UI9 A;  3KJK A;  1X25 A;  2CW4 A;  3QUW A;  3V4D A;  3KJJ A;  2IG8 A;  1ODE A;  2UYJ A;  3K12 A;  3LME A;  1J7H A;  1FNJ A;  2UYN A;  1UFY A;  3ZO8 A;  1NQ3 A;  3LYB A;  2B33 A;  1QAH A;  3GTZ A;  1QD9 A;  3D01 A;  1JD1 A;  2UYN B;  3MQW A;  1QU9 A;  3R0P A;  3ZOP A;  5HP7 A;  3VCZ A;  2CHT A;  2DYY A;  5HP8 A;  1XHO A;  1DBF A;  2UYP A;  3M1X A;  2OTM A;  4NWO B;  1FNK A;  1ONI A;  1PF5 A;  2CVL A;  3K0T A;  3ZP7 A;  3M4S A;  2UYK A;  3I3F A;  1COM A;  1XRG A;  2CWJ A;  4ZK7 A;  3I7T A; 
#chains in the Genus database with same CATH topology
 2HS3 A;  3ELC A;  3F0E A;  2PMP A;  2OHW A;  2RHO A;  5HXU A;  5BMV A;  1YHQ F;  2CW4 A;  2Z1T A;  3QUW A;  5EWR A;  3IEW A;  3JAR B;  4I4T A;  5LXT A;  4X1I B;  3OBY A;  1VQV A;  4YJ2 B;  1VQ9 F;  3WJR A;  3LWQ C;  2LBX A;  1U3L A;  1DBF A;  4O4J B;  1U40 A;  3VOB A;  1YJW F;  2OTM A;  3ERN A;  5EZY B;  3C9T A;  4BVS A;  1COM A;  5EYP B;  3K2X A;  3L7Q A;  5MN4 A;  1S72 F;  3RYC B;  1X25 A;  3J7A R;  1VQK F;  1GX1 A;  1FSZ A;  4F6R B;  3J80 M;  2KTV A;  3JAL B;  5IJ9 B;  1YQN A;  2I6D A;  3S06 A;  1K8A H;  1W5F A;  1OAP A;  2AIF A;  4M8I A;  1GO0 A;  4O4J A;  1SA0 B;  2AIZ P;  2NMU A;  5EZY A;  3MQW A;  1GZ0 A;  3N2K B;  2HP0 B;  2CHT A;  2DYY A;  3CC2 F;  5EYP A;  3LWP C;  3CYQ A;  1PF5 A;  3SIV A;  2CVL A;  5LA6 B;  1VQP F;  3ON1 A;  4EB6 A;  3JAK A;  3LFO A;  4F6R A;  3JAW B;  3TD3 A;  3N2G A;  3I7T A;  4XCQ A;  5CA1 B;  5DCV A;  3CG6 A;  5GAN K;  2Z01 A;  3VTI C;  5EIB C;  3CMA F;  2OTL F;  3J81 M;  5KX5 A;  1UFY A;  1XBI A;  3RYI A;  2QA4 F;  3RA5 A;  4EI9 A;  3GTZ A;  4ZHQ B;  3AGK A;  2Z1F A;  4TV8 B;  4BT6 A;  1Q7Y H;  3M1X A;  4G4Y A;  5LP6 B;  3M4S A;  3HAX D;  3CCQ F;  3WGK A;  3G6E F;  1H48 A;  3FD5 A;  3K14 A;  3WGM A;  1VQ7 F;  4ZK7 A;  4X1K A;  4X20 B;  2JNB A;  3KIZ A;  4DXD A;  4BVQ A;  3V4D A;  2K1S A;  3JAS B;  1VQO F;  4C4W C;  3VOA A;  4KWE A;  4E6E A;  4O4H A;  1FFX A;  3HWU A;  5GON B;  2VXY A;  3LYB A;  5JH7 B;  5HY1 A;  3LWV C;  1T0A A;  3RYF B;  1DT9 A;  3CCE F;  1YI2 F;  3VIU A;  4NWO B;  3JCM M;  4IIJ A;  1FNK A;  4X20 A;  2HVY D;  4C8G A;  3P0Z A;  1Z5W A;  2LBT A;  5JCO A;  5GIO C;  2CSL A;  4X1Y B;  3F0F A;  4BT2 A;  1UI9 A;  3DC2 A;  1JFF A;  3CCM F;  3GHZ A;  4NUT A;  2YXZ A;  2UYJ A;  4O2B A;  3CD6 F;  2UZH A;  2QTP A;  4I55 B;  2PHN A;  5LP6 C;  5CB4 B;  1VQL F;  3B6N A;  3JAT B;  4G4Z A;  4O4L B;  2ZOV A;  3T80 A;  3CXC F;  3MBM A;  1XV2 A;  2BTQ B;  5JCO C;  2VAM A;  4IHJ A;  1RQ2 A;  2RHH A;  1E7K A;  3JVH A;  1ZWZ A;  1W42 A;  1W57 A;  3CCV F;  3CPW F;  3TD4 A;  3ZP4 A;  5KMG A;  1JJ2 F;  2VAP A;  3ESJ A;  3KJK A;  4FFB B;  1W5E A;  2GVI A;  5CB4 A;  4X3M A;  2Q1Y A;  4B46 A;  3LME A;  3HKE B;  1Q8R A;  1FNJ A;  2R75 1;  3IEQ A;  4LNU B;  4EI8 A;  3CCS F;  3CME F;  2IAF A;  5EIB D;  1NMU B;  3D01 A;  3CCL F;  4EI7 A;  3NK6 A;  3S0H A;  3F0D A;  3PLA C;  1VH8 A;  1QVG F;  5J2T B;  4BT5 A;  3K0T A;  3E22 B;  3V7Q A;  3CB2 A;  3JAR A;  3HKE A;  5HXZ A;  3N4Y A;  3JAM M;  3Q8H A;  4X1I A;  3C9R A;  4YJ2 A;  3SIU A;  4BY9 D;  3N4Z A;  1VQN F;  1NQ3 A;  1TUB B;  3S02 A;  2MQE A;  5EB1 B;  5HP7 A;  5HY4 A;  3E22 A;  3VCZ A;  1W5B A;  2Q1X A;  1W58 1;  1M90 H;  3WGL A;  3V7E A;  5JQG B;  3F0G A;  3RYC A;  1W41 A;  5EB0 A;  2OTJ F;  3JAL A;  2OZB A;  5IJ9 A;  1SZQ A;  2BTO A;  5AVM A;  4C81 A;  3OON A;  5IYZ B;  2I6R A;  2IG8 A;  1SA0 A;  4RQO A;  4TUY B;  2QEX F;  5FJ4 C;  3PAF A;  4ZHY B;  3M84 A;  3N2K A;  2HP0 A;  5ITZ B;  1RQ7 A;  1CLI A;  2B33 A;  4B5C A;  2UYN B;  5CA0 B;  5LA6 A;  5GAP K;  5HP8 A;  3QHD A;  3HJW C;  3IKF A;  4C8I A;  2RB9 A;  3NVI B;  3JAW A;  3V3T A;  2HP3 A;  2UYK A;  1U43 A;  3I3F A;  2QI2 A;  2FC3 A;  5CA1 A;  1U3P A;  1SDS A;  5B8F A;  2EWC A;  2FGY A;  4TUY A;  2P6Y A;  1H47 A;  4G88 A;  4DRX B;  1K73 H;  5ITZ A;  2R6R 1;  4U3J B;  3KHN A;  4ZHQ A;  1PXW A;  1W55 A;  4TV8 A;  3E1Y A;  3VO8 A;  1X7O A;  1T0K B;  2ZVZ A;  4WBN B;  3NK7 A;  5LP6 A;  4R40 B;  4B62 A;  2HRU A;  1ONI A;  1W40 A;  5HY2 A;  4BT7 A;  4DRX A;  4ERH A;  1YIJ F;  3FPI A;  4U3J A;  1IPA A;  5JVD B;  1JY8 A;  3JAS A;  1IV3 A;  3KE1 A;  5GON A;  3K12 A;  3IKE A;  5JH7 A;  4G4X A;  3D00 A;  2GLZ A;  2VAW A;  3HKC B;  3RYF A;  4U39 A;  4O2A B;  1M1K H;  5EO3 A;  3FBA A;  3MCQ A;  2KTU A;  1N8R H;  2H6L A;  1H7M A;  3ZP7 A;  4X1Y A;  5GIN C;  2ZAU A;  4YJ3 B;  4HNA B;  3G4S F;  2DT4 A;  5J2U B;  1VK3 A;  2H8E A;  5FNV B;  4I55 A;  3WGJ A;  3OBW A;  1KNJ A;  1CK2 A;  4LCK A;  1KNK A;  3JAT A;  1YJN F;  5HWE A;  5BMV B;  2HRY A;  2HQS C;  3ZO8 A;  3WJQ A;  4O4L A;  3RA6 A;  2N48 A;  4C82 A;  4I4T B;  1QAH A;  5LXT B;  5MN5 A;  1QD9 A;  3FFM A;  3HKD B;  1W59 A;  5LOV B;  3CCJ F;  2RHL A;  5A2Q M;  4TV9 B;  4RHA A;  2GZL A;  2UYP A;  2ALE A;  3WGN A;  1KC8 H;  1IV1 A;  3E20 B;  4FFB A;  3F6M A;  3WPW A;  1YJ9 F;  3CCR F;  1VQ6 F;  2LBW A;  2HS4 A;  2CHS A;  3RYH B;  4LNU A;  1OFU A;  3MDO A;  3HKD A;  5LOV A;  2G9I A;  4TV9 A;  4C8E A;  3S03 A;  2YYE A;  1CN7 A;  1Q82 H;  1QU9 A;  5J2T A;  1XHO A;  3GYQ A;  1RLU A;  1YIT F;  1QVF F;  3RYH A;  3FD6 A;  3QTY A;  2CWJ A;  1KQS F;  2AMT A;  1W5A A;  3MCA B;  4EB6 B;  3JAK B;  3N2G B;  4TZZ A;  1TUB A;  4ZHW A;  3G71 F;  1JN1 A;  1W2B F;  2V9Y A;  3C9S A;  3CCU F;  3R0P A;  3ZOP A;  5KX5 B;  3I55 F;  2ZF8 A;  3RYI B;  5MN6 A;  1Z5V A;  4G4V A;  5LYJ B;  3C8L A;  4BW0 B;  3WPX A;  5JQG A;  4ZI7 B;  2KG4 A;  1VHA A;  2VGM A;  5FLX M;  1GO1 A;  2W8B C;  3WXM B;  4ZOL B;  5IYZ A;  2Z1U A;  4BT4 A;  3VYS C;  4X1K B;  2HX0 A;  3RE3 A;  3NVK E;  1TVK B;  2UYN A;  5CA0 A;  3CC7 F;  5LYJ A;  3WJP A;  4ZI7 A;  1JD1 A;  4O4H B;  1FFX B;  2BTU A;  1Q81 H;  1VQ4 F;  1RLG A;  3NMU C;  4BVT A;  4O4I B;  3LDT A;  4ZOL A;  3I56 F;  3C9U A;  4ZHV A;  5C8Y B;  3O85 A;  5HY0 A;  4IIJ B;  1VQM F;  2F9Z C;  2L26 A;  3VMF B;  1TVK A;  1Q86 H;  4BVR A;  4NQ3 A;  2LCA A;  1ODE A;  3IMP A;  1W3E X;  2WAL A;  1JFF B;  2RHJ A;  4G4W A;  4WBN A;  1KD1 H;  3HTN A;  4O2B B;  3LWO C;  4O4I A;  3S0W A;  3VI6 A;  2Z1E A;  3HKB B;  5GIP C;  3EOR A;  5C8Y A;  5IT9 M;  3CPQ A;  4BT3 A;  3OW2 F;  2CZW A;  3CYP B;  3D54 A;  2H8C A;  5JVD A;  3P4E A;  4PWT A;  1VQ5 F;  2ZOD A;  5IJ0 B;  2ZVY A;  3CC4 F;  3UT5 B;  1X7P A;  4IHJ B;  3S0Y A;  5EAZ A;  2IQQ A;  4I50 B;  1X52 A;  3HKC A;  3KJJ A;  4O2A A;  3HKB A;  5KMG B;  1IV2 A;  1J7H A;  1VQ8 F;  3U0O A;  2KGW A;  2VGN A;  3TD5 A;  5G4U C;  5G4V C;  1IV4 A;  5IJ0 A;  1NJI H;  3VYT C;  1K9M H;  4YJ3 A;  3UT5 A;  3BYQ A;  4HNA A;  1YGY A;  3IR9 A;  5J2U A;  3DDN A;  4B45 A;  2HS0 A;  1XRG A;  3P10 A;  5FNV A;  3LWR C;  1R1M A;  1RA4 A;  4I50 A;  2BO1 A;  4X3L A;  3VYU C; 
#chains in the Genus database with same CATH homology
 2EWC A;  2CSL A;  3ZP4 A;  2CHS A;  3L7Q A;  1UI9 A;  3KJK A;  1X25 A;  2CW4 A;  3QUW A;  3V4D A;  3KJJ A;  2IG8 A;  1ODE A;  2UYJ A;  3K12 A;  3LME A;  1J7H A;  1FNJ A;  2UYN A;  1UFY A;  3ZO8 A;  1NQ3 A;  3LYB A;  2B33 A;  1QAH A;  3GTZ A;  1QD9 A;  3D01 A;  1JD1 A;  2UYN B;  3MQW A;  1QU9 A;  3R0P A;  3ZOP A;  5HP7 A;  3VCZ A;  2CHT A;  2DYY A;  5HP8 A;  1XHO A;  1DBF A;  2UYP A;  3M1X A;  2OTM A;  4NWO B;  1FNK A;  1ONI A;  1PF5 A;  2CVL A;  3K0T A;  3ZP7 A;  3M4S A;  2UYK A;  3I3F A;  1COM A;  1XRG A;  2CWJ A;  4ZK7 A;  3I7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...