1QAHA

Crystal structure of perchloric acid soluble protein-a translational inhibitor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
SSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEAKQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAIAVQGPFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Alpha-beta structure
molecule keywords PERCHLORIC ACID SOLUBLE PROTEIN
publication title Crystal Structure of Perchloric Acid Soluble Protein-a Translational Inhibitor
rcsb
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 1999-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1qahA00
1QU9A 3L7QA 3I3FA 3D01A 1ODEA 3LYBA 5HP8A 1PF5A 1UI9A 4ZK7A 5HP7A 1UFYA 3QUWA 1FNKA 2CSLA 3MQWA 2EWCA 1NQ3A 4NWOB 3I7TA 3K0TA 1XHOA 1J7HA 1XRGA 3K12A 1QD9A 2DYYA 2UYKA 2UYJA 1ONIA 2CW4A 3GTZA 2CHTA 3R0PA 3VCZA 1X25A 1DBFA 1COMA 2CVLA 3KJKA 3ZP7A 2B33A 2UYNB 1QAHA 1JD1A 3LMEA 1FNJA 3M4SA 3KJJA 3ZOPA 3ZO8A 2IG8A 2UYNA 2UYPA 2CWJA 3M1XA 2OTMA 2CHSA 3ZP4A 3V4DA
chains in the Genus database with same CATH superfamily
3S02A 1W3EX 3CYQA 4TUYB 3D54A 2GZLA 4BT7A 1VQLF 4O4IA 1VQ6F 1FNKA 1X7PA 3RYCB 3HKEB 3U0OA 3JALB 1R1MA 2UYKA 5EB0A 5MN6A 3VI6A 5LP6B 3JATB 3KJKA 2UYNB 4O4HA 2HRUA 3MCAB 2L26A 3ZO8A 5J2TA 2VGMA 2RHJA 2UYPA 2Z1TA 2BO1A 2WALA 4X1IA 4ERHA 3ELCA 3F6MA 4NQ3A 1RQ2A 2F9ZC 2RHOA 4TV9B 1K9MH 2N48A 3S06A 2UZHA 3FBAA 3HKDB 2KGWA 4BVQA 3MQWA 4O2BA 2HRYA 3EORA 3V3TA 2VAWA 1X25A 3LFOA 3RA5A 4BT5A 1U3LA 1VH8A 1K8AH 4ZI7B 4F6RB 3WPXA 2H8CA 5CA0A 5MN4A 1KC8H 3RYIB 2R751 1W5FA 3K14A 3V4DA 3D01A 3HKCB 3E22B 5EWRA 4C4WC 2GVIA 1YGYA 2OHWA 4ZK7A 1GO0A 4TUYA 2K1SA 3ESJA 2HX0A 3I55F 4B5CA 2VXYA 4G4XA 1NQ3A 4B46A 1XHOA 5CB4B 4BT2A 3HKEA 3RYCA 3CMEF 1W57A 2FC3A 2QI2A 3JALA 3R0PA 4O4LB 2QA4F 5LP6A 1QAHA 5EO3A 3JATA 2HVYD 1FNJA 5JCOC 3N2KB 2UYNA 5EZYB 4DRXB 5GAPK 3CCVF 1YJWF 5HP8A 1ODEA 3CYPB 4TV9A 1Q86H 2DT4A 1UI9A 1IV2A 3HKDA 3VO8A 3I56F 5EAZA 1VQVA 1QVGF 2EWCA 5BMVB 1Z5WA 2YYEA 4I55B 1QD9A 2DYYA 5KMGB 1FFXB 4X1YB 1Q81H 3Q8HA 4EI8A 2B33A 5JH7B 3WGMA 2PHNA 2HP0B 4X3LA 4ZI7A 4F6RA 5JQGB 1Q7YH 3F0GA 2VAMA 1VQ8F 1QVFF 3RYIA 2ALEA 3WXMB 2Z1UA 3HKCA 3E22A 3SIVA 3CCLF 3FD6A 1IPAA 2BTQB 3I7TA 5IYZB 1XRGA 1SA0B 2ZAUA 5MN5A 5GONB 5FLXM 4FFBB 5EYPB 1JJ2F 3J7AR 5CB4A 2JNBA 1DBFA 2AIFA 2R6R1 4O4LA 4C8IA 3JAWB 3IEWA 3RYHB 3N2KA 3C8LA 5EZYA 3J81M 5C8YB 1YJNF 3HTNA 4DRXA 3DDNA 3ON1A 2KTUA 4NUTA 5IT9M 4G4ZA 4BVSA 5GIOC 2W8BC 1YHQF 1UFYA 1W40A 1VQ7F 2KTVA 2LCAA 5EB1B 2OTJF 4NWOB 4KWEA 3B6NA 1Z5VA 4WBNB 3G71F 3G4SF 5BMVA 3WJPA 2QEXF 5LYJB 4I55A 5KMGA 1FFXA 2HS3A 2VAPA 3CCUF 4X1YA 5GANK 4ZHYB 3MBMA 2VGNA 1VK3A 5IJ9B 2HS4A 5EIBD 5JH7A 3S0YA 2HP0A 5JQGA 2KG4A 5FNVB 2ZVYA 1TVKB 3HAXD 3CC4F 2YXZA 5ITZB 3OW2F 3CPQA 5G4VC 3RYFB 3WPWA 4LNUB 5HWEA 5LXTB 2P6YA 2UYJA 4HNAB 1SA0A 5IYZA 2AIZP 5GONA 1N8RH 4FFBA 2RHLA 5CA1B 3S03A 5EYPA 5HY0A 3N2GB 1S72F 1YQNA 1YIJF 4I50B 4C82A 4C8EA 3VIUA 2CHSA 3JAWA 2H8EA 3RYHA 4DXDA 1VQ9F 5J2UB 5C8YA 4B45A 3CCEF 5DCVA 2ZVZA 2NMUA 1K73H 3AGKA 4EB6B 1GX1A 3QUWA 3WGLA 4YJ2B 1W55A 3E1YA 2H6LA 3CPWF 3RA6A 2CW4A 4WBNA 1W41A 3KHNA 4TZZA 5LYJA 1COMA 3LWPC 1VQOF 3CD6F 5HY4A 3C9UA 3LMEA 5HXZA 3FD5A 5IJ9A 2LBTA 4IIJB 2ZF8A 3ZP4A 4I4TB 2I6DA 3FFMA 3JASB 5HY2A 5AVMA 2Z1FA 5FNVA 5JVDB 5LA6B 3WGNA 1DT9A 1TVKA 4X1KB 3CG6A 3CCRF 3TD3A 4C8GA 3FPIA 1YITF 5ITZA 5KX5B 4O2AB 4BT3A 1J7HA 3C9SA 3RYFA 1VQPF 4LNUA 5LXTA 3P0ZA 4HNAA 1CN7A 3HWUA 3VOAA 5CA1A 3WJQA 3N2GA 4B62A 3PAFA 4G4VA 4I50A 3WGKA 3JAMM 4ZOLB 4E6EA 3NVKE 3CCQF 3N4YA 2RB9A 5J2UA 3VMFB 5GINC 1TUBB 2BTOA 3CB2A 2IQQA 3PLAC 3LDTA 4G4YA 3LWOC 4EB6A 1W5BA 4YJ2A 1RLGA 4BVTA 2V9YA 1ONIA 3WGJA 3GTZA 5EIBC 1H48A 3VTIC 1KD1H 4TV8B 3V7QA 3C9RA 1YJ9F 2IAFA 1CK2A 3OONA 3CXCF 2CWJA 3M1XA 1GO1A 3LWVC 3N4ZA 3OBWA 3MDOA 4EI7A 3LYBA 3C9TA 1JN1A 1FSZA 4IIJA 4BY9D 4I4TA 3JASA 1JFFB 3LWRC 1PXWA 4G88A 4YJ3B 3MCQA 5LP6C 3OBYA 5JVDA 1W5EA 5LA6A 4X1KA 3J80M 4LCKA 3JAKB 3CC7F 3HKBB 5KX5A 4O2AA 2HP3A 4G4WA 1X7OA 3GHZA 1JD1A 3T80A 3KJJA 4BT4A 1W42A 2IG8A 4BT6A 1NJIH 3KIZA 4R40B 1H47A 1QU9A 1IV3A 4ZHQB 1U40A 1NMUB 4ZOLA 3GYQA 3NVIB 4PWTA 5JCOA 1TUBA 4O4JB 5LOVB 1W5AA 2HS0A 3UT5B 2GLZA 3BYQA 1OFUA 1M1KH 1Q8RA 1U3PA 4ZHVA 2LBWA 1CLIA 5B8FA 3M84A 3JVHA 4TV8A 4U39A 2ZOVA 3QHDA 3CCSF 1VQKF 1SDSA 2G9IA 2FGYA 1ZWZA 4M8IA 3NK7A 2BTUA 4U3JB 5A2QM 2I6RA 1IV4A 1JFFA 5HY1A 3QTYA 4XCQA 4YJ3A 3RE3A 3IMPA 4RQOA 2LBXA 3K12A 3F0DA 3JAKA 3E20B 3HKBA 4X20B 3JARB 3P10A 1KNJA 3JCMM 1RQ7A 1JY8A 3ZOPA 3DC2A 5FJ4C 1VQNF 2PMPA 3CCMF 1M90H 3CC2F 4RHAA 3L7QA 3I3FA 3S0WA 4ZHQA 1H7MA 1W581 3S0HA 2AMTA 5IJ0B 4C81A 1T0AA 4IHJB 1E7KA 2CSLA 4O4JA 5LOVA 1KNKA 1U43A 3UT5A 3SIUA 1W2BF 1YI2F 1RA4A 1XV2A 2CVLA 2Q1XA 3F0EA 3IKEA 3ZP7A 3IKFA 3VOBA 1IV1A 3ERNA 1OAPA 3VYUC 3KE1A 3F0FA 5G4UC 2OZBA 4O4IB 4U3JA 3IR9A 2MQEA 2Z1EA 3K2XA 3NMUC 3K0TA 3CMAF 3NK6A 2OTLF 1X52A 2CHTA 3IEQA 1VQMF 1KQSF 4X20A 4O4HB 3LWQC 5HXUA 4ZHWA 3JARA 5J2TB 4X1IB 3TD4A 3M4SA 2HQSC 3TD5A 3CCJF 3V7EA 1SZQA 1PF5A 1VHAA 1XBIA 3O85A 5HP7A 3D00A 1RLUA 2CZWA 2Q1YA 4O2BB 5IJ0A 1VQ4F 3G6EF 4IHJA 1GZ0A 4X3MA 1Q82H 1W59A 3VCZA 3WJRA 2Z01A 4EI9A 1VQ5F 3VYSC 5GIPC 1T0KB 5CA0B 4BW0B 3VYTC 2ZODA 3P4EA 2QTPA 4BVRA 2OTMA 3HJWC 2RHHA
chains in the Genus database with same CATH topology
1QU9A 3L7QA 3I3FA 3D01A 1ODEA 3LYBA 5HP8A 1PF5A 1UI9A 4ZK7A 5HP7A 1UFYA 3QUWA 1FNKA 2CSLA 3MQWA 2EWCA 1NQ3A 4NWOB 3I7TA 3K0TA 1XHOA 1J7HA 1XRGA 3K12A 1QD9A 2DYYA 2UYKA 2UYJA 1ONIA 2CW4A 3GTZA 2CHTA 3R0PA 3VCZA 1X25A 1DBFA 1COMA 2CVLA 3KJKA 3ZP7A 2B33A 2UYNB 1QAHA 1JD1A 3LMEA 1FNJA 3M4SA 3KJJA 3ZOPA 3ZO8A 2IG8A 2UYNA 2UYPA 2CWJA 3M1XA 2OTMA 2CHSA 3ZP4A 3V4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU9 A;  3L7Q A;  3I3F A;  3D01 A;  1ODE A;  3LYB A;  5HP8 A;  1PF5 A;  1UI9 A;  4ZK7 A;  5HP7 A;  1UFY A;  3QUW A;  1FNK A;  2CSL A;  3MQW A;  2EWC A;  1NQ3 A;  4NWO B;  3I7T A;  3K0T A;  1XHO A;  1J7H A;  1XRG A;  3K12 A;  1QD9 A;  2DYY A;  2UYK A;  2UYJ A;  1ONI A;  2CW4 A;  3GTZ A;  2CHT A;  3R0P A;  3VCZ A;  1X25 A;  1DBF A;  1COM A;  2CVL A;  3KJK A;  3ZP7 A;  2B33 A;  2UYN B;  1QAH A;  1JD1 A;  3LME A;  1FNJ A;  3M4S A;  3KJJ A;  3ZOP A;  3ZO8 A;  2IG8 A;  2UYN A;  2UYP A;  2CWJ A;  3M1X A;  2OTM A;  2CHS A;  3ZP4 A;  3V4D A; 
#chains in the Genus database with same CATH topology
 3S02 A;  1W3E X;  3CYQ A;  4TUY B;  3D54 A;  2GZL A;  4BT7 A;  1VQL F;  4O4I A;  1VQ6 F;  1FNK A;  1X7P A;  3RYC B;  3HKE B;  3U0O A;  3JAL B;  1R1M A;  2UYK A;  5EB0 A;  5MN6 A;  3VI6 A;  5LP6 B;  3JAT B;  3KJK A;  2UYN B;  4O4H A;  2HRU A;  3MCA B;  2L26 A;  3ZO8 A;  5J2T A;  2VGM A;  2RHJ A;  2UYP A;  2Z1T A;  2BO1 A;  2WAL A;  4X1I A;  4ERH A;  3ELC A;  3F6M A;  4NQ3 A;  1RQ2 A;  2F9Z C;  2RHO A;  4TV9 B;  1K9M H;  2N48 A;  3S06 A;  2UZH A;  3FBA A;  3HKD B;  2KGW A;  4BVQ A;  3MQW A;  4O2B A;  2HRY A;  3EOR A;  3V3T A;  2VAW A;  1X25 A;  3LFO A;  3RA5 A;  4BT5 A;  1U3L A;  1VH8 A;  1K8A H;  4ZI7 B;  4F6R B;  3WPX A;  2H8C A;  5CA0 A;  5MN4 A;  1KC8 H;  3RYI B;  2R75 1;  1W5F A;  3K14 A;  3V4D A;  3D01 A;  3HKC B;  3E22 B;  5EWR A;  4C4W C;  2GVI A;  1YGY A;  2OHW A;  4ZK7 A;  1GO0 A;  4TUY A;  2K1S A;  3ESJ A;  2HX0 A;  3I55 F;  4B5C A;  2VXY A;  4G4X A;  1NQ3 A;  4B46 A;  1XHO A;  5CB4 B;  4BT2 A;  3HKE A;  3RYC A;  3CME F;  1W57 A;  2FC3 A;  2QI2 A;  3JAL A;  3R0P A;  4O4L B;  2QA4 F;  5LP6 A;  1QAH A;  5EO3 A;  3JAT A;  2HVY D;  1FNJ A;  5JCO C;  3N2K B;  2UYN A;  5EZY B;  4DRX B;  5GAP K;  3CCV F;  1YJW F;  5HP8 A;  1ODE A;  3CYP B;  4TV9 A;  1Q86 H;  2DT4 A;  1UI9 A;  1IV2 A;  3HKD A;  3VO8 A;  3I56 F;  5EAZ A;  1VQV A;  1QVG F;  2EWC A;  5BMV B;  1Z5W A;  2YYE A;  4I55 B;  1QD9 A;  2DYY A;  5KMG B;  1FFX B;  4X1Y B;  1Q81 H;  3Q8H A;  4EI8 A;  2B33 A;  5JH7 B;  3WGM A;  2PHN A;  2HP0 B;  4X3L A;  4ZI7 A;  4F6R A;  5JQG B;  1Q7Y H;  3F0G A;  2VAM A;  1VQ8 F;  1QVF F;  3RYI A;  2ALE A;  3WXM B;  2Z1U A;  3HKC A;  3E22 A;  3SIV A;  3CCL F;  3FD6 A;  1IPA A;  2BTQ B;  3I7T A;  5IYZ B;  1XRG A;  1SA0 B;  2ZAU A;  5MN5 A;  5GON B;  5FLX M;  4FFB B;  5EYP B;  1JJ2 F;  3J7A R;  5CB4 A;  2JNB A;  1DBF A;  2AIF A;  2R6R 1;  4O4L A;  4C8I A;  3JAW B;  3IEW A;  3RYH B;  3N2K A;  3C8L A;  5EZY A;  3J81 M;  5C8Y B;  1YJN F;  3HTN A;  4DRX A;  3DDN A;  3ON1 A;  2KTU A;  4NUT A;  5IT9 M;  4G4Z A;  4BVS A;  5GIO C;  2W8B C;  1YHQ F;  1UFY A;  1W40 A;  1VQ7 F;  2KTV A;  2LCA A;  5EB1 B;  2OTJ F;  4NWO B;  4KWE A;  3B6N A;  1Z5V A;  4WBN B;  3G71 F;  3G4S F;  5BMV A;  3WJP A;  2QEX F;  5LYJ B;  4I55 A;  5KMG A;  1FFX A;  2HS3 A;  2VAP A;  3CCU F;  4X1Y A;  5GAN K;  4ZHY B;  3MBM A;  2VGN A;  1VK3 A;  5IJ9 B;  2HS4 A;  5EIB D;  5JH7 A;  3S0Y A;  2HP0 A;  5JQG A;  2KG4 A;  5FNV B;  2ZVY A;  1TVK B;  3HAX D;  3CC4 F;  2YXZ A;  5ITZ B;  3OW2 F;  3CPQ A;  5G4V C;  3RYF B;  3WPW A;  4LNU B;  5HWE A;  5LXT B;  2P6Y A;  2UYJ A;  4HNA B;  1SA0 A;  5IYZ A;  2AIZ P;  5GON A;  1N8R H;  4FFB A;  2RHL A;  5CA1 B;  3S03 A;  5EYP A;  5HY0 A;  3N2G B;  1S72 F;  1YQN A;  1YIJ F;  4I50 B;  4C82 A;  4C8E A;  3VIU A;  2CHS A;  3JAW A;  2H8E A;  3RYH A;  4DXD A;  1VQ9 F;  5J2U B;  5C8Y A;  4B45 A;  3CCE F;  5DCV A;  2ZVZ A;  2NMU A;  1K73 H;  3AGK A;  4EB6 B;  1GX1 A;  3QUW A;  3WGL A;  4YJ2 B;  1W55 A;  3E1Y A;  2H6L A;  3CPW F;  3RA6 A;  2CW4 A;  4WBN A;  1W41 A;  3KHN A;  4TZZ A;  5LYJ A;  1COM A;  3LWP C;  1VQO F;  3CD6 F;  5HY4 A;  3C9U A;  3LME A;  5HXZ A;  3FD5 A;  5IJ9 A;  2LBT A;  4IIJ B;  2ZF8 A;  3ZP4 A;  4I4T B;  2I6D A;  3FFM A;  3JAS B;  5HY2 A;  5AVM A;  2Z1F A;  5FNV A;  5JVD B;  5LA6 B;  3WGN A;  1DT9 A;  1TVK A;  4X1K B;  3CG6 A;  3CCR F;  3TD3 A;  4C8G A;  3FPI A;  1YIT F;  5ITZ A;  5KX5 B;  4O2A B;  4BT3 A;  1J7H A;  3C9S A;  3RYF A;  1VQP F;  4LNU A;  5LXT A;  3P0Z A;  4HNA A;  1CN7 A;  3HWU A;  3VOA A;  5CA1 A;  3WJQ A;  3N2G A;  4B62 A;  3PAF A;  4G4V A;  4I50 A;  3WGK A;  3JAM M;  4ZOL B;  4E6E A;  3NVK E;  3CCQ F;  3N4Y A;  2RB9 A;  5J2U A;  3VMF B;  5GIN C;  1TUB B;  2BTO A;  3CB2 A;  2IQQ A;  3PLA C;  3LDT A;  4G4Y A;  3LWO C;  4EB6 A;  1W5B A;  4YJ2 A;  1RLG A;  4BVT A;  2V9Y A;  1ONI A;  3WGJ A;  3GTZ A;  5EIB C;  1H48 A;  3VTI C;  1KD1 H;  4TV8 B;  3V7Q A;  3C9R A;  1YJ9 F;  2IAF A;  1CK2 A;  3OON A;  3CXC F;  2CWJ A;  3M1X A;  1GO1 A;  3LWV C;  3N4Z A;  3OBW A;  3MDO A;  4EI7 A;  3LYB A;  3C9T A;  1JN1 A;  1FSZ A;  4IIJ A;  4BY9 D;  4I4T A;  3JAS A;  1JFF B;  3LWR C;  1PXW A;  4G88 A;  4YJ3 B;  3MCQ A;  5LP6 C;  3OBY A;  5JVD A;  1W5E A;  5LA6 A;  4X1K A;  3J80 M;  4LCK A;  3JAK B;  3CC7 F;  3HKB B;  5KX5 A;  4O2A A;  2HP3 A;  4G4W A;  1X7O A;  3GHZ A;  1JD1 A;  3T80 A;  3KJJ A;  4BT4 A;  1W42 A;  2IG8 A;  4BT6 A;  1NJI H;  3KIZ A;  4R40 B;  1H47 A;  1QU9 A;  1IV3 A;  4ZHQ B;  1U40 A;  1NMU B;  4ZOL A;  3GYQ A;  3NVI B;  4PWT A;  5JCO A;  1TUB A;  4O4J B;  5LOV B;  1W5A A;  2HS0 A;  3UT5 B;  2GLZ A;  3BYQ A;  1OFU A;  1M1K H;  1Q8R A;  1U3P A;  4ZHV A;  2LBW A;  1CLI A;  5B8F A;  3M84 A;  3JVH A;  4TV8 A;  4U39 A;  2ZOV A;  3QHD A;  3CCS F;  1VQK F;  1SDS A;  2G9I A;  2FGY A;  1ZWZ A;  4M8I A;  3NK7 A;  2BTU A;  4U3J B;  5A2Q M;  2I6R A;  1IV4 A;  1JFF A;  5HY1 A;  3QTY A;  4XCQ A;  4YJ3 A;  3RE3 A;  3IMP A;  4RQO A;  2LBX A;  3K12 A;  3F0D A;  3JAK A;  3E20 B;  3HKB A;  4X20 B;  3JAR B;  3P10 A;  1KNJ A;  3JCM M;  1RQ7 A;  1JY8 A;  3ZOP A;  3DC2 A;  5FJ4 C;  1VQN F;  2PMP A;  3CCM F;  1M90 H;  3CC2 F;  4RHA A;  3L7Q A;  3I3F A;  3S0W A;  4ZHQ A;  1H7M A;  1W58 1;  3S0H A;  2AMT A;  5IJ0 B;  4C81 A;  1T0A A;  4IHJ B;  1E7K A;  2CSL A;  4O4J A;  5LOV A;  1KNK A;  1U43 A;  3UT5 A;  3SIU A;  1W2B F;  1YI2 F;  1RA4 A;  1XV2 A;  2CVL A;  2Q1X A;  3F0E A;  3IKE A;  3ZP7 A;  3IKF A;  3VOB A;  1IV1 A;  3ERN A;  1OAP A;  3VYU C;  3KE1 A;  3F0F A;  5G4U C;  2OZB A;  4O4I B;  4U3J A;  3IR9 A;  2MQE A;  2Z1E A;  3K2X A;  3NMU C;  3K0T A;  3CMA F;  3NK6 A;  2OTL F;  1X52 A;  2CHT A;  3IEQ A;  1VQM F;  1KQS F;  4X20 A;  4O4H B;  3LWQ C;  5HXU A;  4ZHW A;  3JAR A;  5J2T B;  4X1I B;  3TD4 A;  3M4S A;  2HQS C;  3TD5 A;  3CCJ F;  3V7E A;  1SZQ A;  1PF5 A;  1VHA A;  1XBI A;  3O85 A;  5HP7 A;  3D00 A;  1RLU A;  2CZW A;  2Q1Y A;  4O2B B;  5IJ0 A;  1VQ4 F;  3G6E F;  4IHJ A;  1GZ0 A;  4X3M A;  1Q82 H;  1W59 A;  3VCZ A;  3WJR A;  2Z01 A;  4EI9 A;  1VQ5 F;  3VYS C;  5GIP C;  1T0K B;  5CA0 B;  4BW0 B;  3VYT C;  2ZOD A;  3P4E A;  2QTP A;  4BVR A;  2OTM A;  3HJW C;  2RHH A; 
#chains in the Genus database with same CATH homology
 1QU9 A;  3L7Q A;  3I3F A;  3D01 A;  1ODE A;  3LYB A;  5HP8 A;  1PF5 A;  1UI9 A;  4ZK7 A;  5HP7 A;  1UFY A;  3QUW A;  1FNK A;  2CSL A;  3MQW A;  2EWC A;  1NQ3 A;  4NWO B;  3I7T A;  3K0T A;  1XHO A;  1J7H A;  1XRG A;  3K12 A;  1QD9 A;  2DYY A;  2UYK A;  2UYJ A;  1ONI A;  2CW4 A;  3GTZ A;  2CHT A;  3R0P A;  3VCZ A;  1X25 A;  1DBF A;  1COM A;  2CVL A;  3KJK A;  3ZP7 A;  2B33 A;  2UYN B;  1QAH A;  1JD1 A;  3LME A;  1FNJ A;  3M4S A;  3KJJ A;  3ZOP A;  3ZO8 A;  2IG8 A;  2UYN A;  2UYP A;  2CWJ A;  3M1X A;  2OTM A;  2CHS A;  3ZP4 A;  3V4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...