1QAHA

Crystal structure of perchloric acid soluble protein-a translational inhibitor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
SSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEAKQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAIAVQGPFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERCHLORIC ACID SOLUBLE PROTEIN
publication title Crystal Structure of Perchloric Acid Soluble Protein-a Translational Inhibitor
rcsb
molecule tags Alpha-beta structure
total genus 31
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.5.99.10: 2-iminobutanoate/2-iminopropanoate deaminase.
pdb deposition date 1999-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1qahA00
1JD1A 3LYBA 1J7HA 2CHSA 2EWCA 3K0TA 2DYYA 3VCZA 3D01A 1FNKA 3I7TA 2UYKA 2CWJA 2UYJA 3QUWA 1XHOA 2CHTA 3I3FA 3ZOPA 3K12A 2UYNA 1COMA 5HP8A 5HP7A 1FNJA 1UFYA 1ODEA 3M1XA 3KJJA 1X25A 3R0PA 2UYNB 3LMEA 1PF5A 1QD9A 3MQWA 1UI9A 1ONIA 1NQ3A 3ZP4A 2CSLA 2CW4A 2IG8A 3ZP7A 1QAHA 3V4DA 3ZO8A 3L7QA 1QU9A 1DBFA 4NWOB 4ZK7A 1XRGA 2UYPA 3GTZA 3KJKA 3M4SA 2CVLA 2OTMA 2B33A
chains in the Genus database with same CATH superfamily
4TV9B 5HXUA 3VCZA 4X3LA 5JH7A 5CA1A 5HY1A 3HKCA 2ZAUA 4I50B 2Q1XA 5IT9M 4RHAA 4KWEA 4BVSA 3LFOA 4EB6B 5GIPC 4G88A 5GONA 3J7AR 1X25A 4WBNB 3C9TA 5KMGB 3S0WA 3I56F 2F9ZC 3TD5A 3ZP4A 4E6EA 4BY9D 4O2AA 4IIJA 3V4DA 1W3EX 3LWRC 2LBWA 2CVLA 3CMEF 1JD1A 5LOVB 1TVKA 2AIFA 4LNUA 5JQGB 2KG4A 5EIBD 3KHNA 1M1KH 4U3JA 1FNKA 1VH8A 3IR9A 3JAMM 4G4XA 3S0YA 2I6DA 3IKFA 3CD6F 2HX0A 2VXYA 3IEQA 5LA6B 1W2BF 1VQMF 4F6RA 3S06A 1U40A 3MQWA 3JASB 3CCUF 3WGJA 3L7QA 5EB1B 2R6R1 4ZI7B 1XBIA 3WGLA 4C8GA 4O4JA 2ZODA 1VQ9F 3N2KB 1Z5VA 1H7MA 5HY2A 1SA0A 1JY8A 2H8CA 5EYPB 3PLAC 3NK6A 4X1YB 3K2XA 4EI8A 3CB2A 1YJ9F 2W8BC 1FNJA 5J2TB 2QA4F 1UFYA 3P4EA 2HP0B 3RE3A 2Z1FA 1QVGF 3HKEB 1U3LA 3CC7F 4X1IA 3C9RA 2Z01A 3DC2A 3LWOC 3F0DA 1T0AA 2VAPA 1OAPA 3P0ZA 3JARB 4BT3A 4FFBA 3CCSF 3V7EA 5IYZB 4R40B 2HRUA 3GHZA 3D00A 3RA5A 3QUWA 4BW0B 5MN5A 1CK2A 2UZHA 4DRXA 4YJ2A 1W581 3IMPA 3K12A 1S72F 2HS4A 1COMA 3F6MA 3LWPC 1XV2A 3CCMF 3VMFB 1H47A 5HP7A 2QI2A 3FD5A 1GO0A 1VK3A 2K1SA 3CG6A 4I4TB 4ZOLB 1UI9A 1NQ3A 2LCAA 3HKBB 2Q1YA 4TUYB 4NWOB 4B45A 4HNAA 1RQ7A 1XRGA 3M84A 5G4VC 1FFXA 1JFFB 3K0TA 5CA0A 5LXTB 3WPWA 5KX5B 3I7TA 2UYKA 4BT5A 3IKEA 5JCOC 3RYCB 3HKDB 5IJ9B 3CCEF 4X3MA 3QTYA 5C8YA 2PMPA 1ODEA 1VQVA 4O2BA 4ZHQB 3DDNA 5LP6B 5GANK 1K8AH 3WGKA 5GIOC 4TV9A 3MDOA 1R1MA 5EZYB 5AVMA 2RB9A 3ERNA 1IV1A 1Q86H 4C81A 4XCQA 4I50A 3F0EA 5FNVB 2P6YA 2ZF8A 4DXDA 3CC4F 1KNJA 1IV2A 2N48A 5JCOA 3RA6A 4EB6A 2BTQB 1VQLF 3ELCA 2ALEA 3LDTA 3VYUC 3N4ZA 4WBNA 5KMGA 5LYJB 3JVHA 5HP8A 4ZHYB 2OZBA 5IJ0B 5JVDA 5EO3A 4IHJB 4C4WC 2IQQA 2ZOVA 5B8FA 3C9SA 5LOVA 1W5FA 1IV4A 3G6EF 1DBFA 3S03A 1VQ6F 3CMAF 2OTMA 2KTVA 2L26A 2BO1A 3D01A 2Z1TA 5LA6A 1H48A 1XHOA 1YJWF 1W5EA 1KC8H 1VQ5F 4TV8B 5MN6A 1YI2F 3JASA 5CA1B 1Q8RA 1CN7A 1PXWA 3J81M 2I6RA 1VQPF 4TZZA 4O4IB 4X1KB 1VQ7F 1QD9A 2VGMA 5HXZA 2V9YA 3CC2F 3N2KA 1T0KB 2IG8A 1RA4A 5EB0A 4ZHVA 3CCRF 2RHHA 3Q8HA 3KJKA 4C8IA 1N8RH 4EI7A 4X1YA 3OONA 3S0HA 3RYHB 2HP0A 4LNUB 3JALB 3V3TA 3WGMA 4ERHA 3NVIB 3UT5B 3HKEA 4G4WA 2H8EA 1TUBA 2UYNB 3G71F 4EI9A 2OTJF 5MN4A 5FJ4C 3WJQA 3JAWA 3JARA 1QAHA 2LBXA 3U0OA 3ZO8A 3CPWF 4I55A 1X7OA 5BMVB 5IYZA 3M4SA 1VQ8F 3VI6A 5HY0A 4O4LA 3RYFB 4G4VA 2GZLA 1M90H 1Q81H 4B62A 3FBAA 2CHTA 2H6LA 3I3FA 5HWEA 1KD1H 3V7QA 4ZOLA 1W55A 3JAKB 3HKBA 4TUYA 4BVRA 5CB4A 3BYQA 4ZHWA 1ZWZA 5J2UB 1U43A 3N2GB 1JFFA 2DT4A 3FD6A 5EIBC 5LXTA 1QU9A 5KX5A 2R751 1W5BA 2KGWA 1YQNA 3JATA 3RYCA 3HKDA 4X20B 2DYYA 5IJ9A 3NMUC 4U39A 2NMUA 1YJNF 5ITZB 4ZHQA 3LWVC 3EORA 3VYSC 1VHAA 3CYQA 4YJ2B 2ZVZA 2Z1EA 2AIZP 3KJJA 3C9UA 2BTOA 3B6NA 3ESJA 3RYIA 1W59A 5FNVA 4G4YA 2HRYA 3FPIA 4ZK7A 2MQEA 3GTZA 1QVFF 3HJWC 1CLIA 1NMUB 5LYJA 5IJ0A 1FFXB 3VTIC 2VGNA 4IHJA 3GYQA 3N4YA 3VOAA 3NK7A 2VAWA 1K73H 4YJ3B 5A2QM 4BVTA 4NQ3A 1RLUA 4BT4A 3E22B 3QHDA 1JJ2F 4BT6A 3CXCF 2GVIA 3ZP7A 5JQGA 2HQSC 5HY4A 3T80A 3CYPB 2QTPA 4B5CA 2CWJA 4O4HB 4PWTA 4TV8A 2HVYD 3SIUA 3C8LA 2KTUA 4O4IA 2IAFA 2GLZA 4X1KA 3VOBA 1W40A 4M8IA 5JH7B 1E7KA 2BTUA 3HKCB 3CCJF 4C8EA 3OW2F 4G4ZA 2WALA 5JVDB 1YIJF 5EWRA 4ZI7A 2RHOA 3I55F 2CW4A 2VAMA 3HTNA 1JN1A 3WPXA 2Z1UA 5GONB 1U3PA 4B46A 1GX1A 2HP3A 3MBMA 3OBYA 1RQ2A 1W42A 3RYHA 2RHLA 1IV3A 1YITF 3JALA 3LYBA 2YXZA 4O2AB 5EYPA 4IIJB 3UT5A 3NVKE 3HWUA 3WGNA 5J2TA 1IPAA 1GZ0A 1TVKB 2UYNA 4U3JB 3VO8A 3WXMB 1KNKA 1VQ4F 3TD3A 5BMVA 1YGYA 2YYEA 3AGKA 3CCQF 4C82A 3HAXD 1FSZA 2OHWA 4F6RB 3F0GA 3RYFA 2UYPA 3PAFA 3F0FA 3VIUA 1YHQF 3O85A 3MCQA 3JAKA 1X7PA 4O4JB 4BVQA 5G4UC 3CCVF 4I4TA 1SA0B 2AMTA 5LP6C 5J2UA 3N2GA 4RQOA 2PHNA 3E20B 4BT2A 1X52A 1VQKF 3S02A 1PF5A 3P10A 4NUTA 3TD4A 1ONIA 1KQSF 1RLGA 1TUBB 3KIZA 3WJPA 3IEWA 3G4SF 4X20A 2LBTA 2JNBA 3JAWB 2RHJA 5ITZA 4X1IB 4BT7A 5DCVA 3OBWA 3CCLF 2CHSA 4I55B 2EWCA 1Z5WA 2UYJA 1W57A 1OFUA 3D54A 3ZOPA 4FFBB 4O4LB 5LP6A 5FLXM 2QEXF 2HS3A 1GO1A 3M1XA 4DRXB 3SIVA 1W41A 5EZYA 2G9IA 5EAZA 5CB4B 1Q82H 2FGYA 1VQNF 2OTLF 3JCMM 1NJIH 2B33A 1VQOF 1J7HA 1DT9A 1K9MH 4YJ3A 1Q7YH 3CPQA 4HNAB 1W5AA 2CZWA 3JATB 3E22A 3KE1A 3J80M 5CA0B 5GAPK 1SDSA 3E1YA 4LCKA 2ZVYA 1SZQA 3R0PA 5GINC 3LMEA 2FC3A 3ON1A 2CSLA 5C8YB 4O4HA 3WJRA 4O2BB 3MCAB 3VYTC 2HS0A 3FFMA 3RYIB 3K14A 3LWQC
chains in the Genus database with same CATH topology
1JD1A 3LYBA 1J7HA 2CHSA 2EWCA 3K0TA 2DYYA 3VCZA 3D01A 1FNKA 3I7TA 2UYKA 2CWJA 2UYJA 3QUWA 1XHOA 2CHTA 3I3FA 3ZOPA 3K12A 2UYNA 1COMA 5HP8A 5HP7A 1FNJA 1UFYA 1ODEA 3M1XA 3KJJA 1X25A 3R0PA 2UYNB 3LMEA 1PF5A 1QD9A 3MQWA 1UI9A 1ONIA 1NQ3A 3ZP4A 2CSLA 2CW4A 2IG8A 3ZP7A 1QAHA 3V4DA 3ZO8A 3L7QA 1QU9A 1DBFA 4NWOB 4ZK7A 1XRGA 2UYPA 3GTZA 3KJKA 3M4SA 2CVLA 2OTMA 2B33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JD1 A;  3LYB A;  1J7H A;  2CHS A;  2EWC A;  3K0T A;  2DYY A;  3VCZ A;  3D01 A;  1FNK A;  3I7T A;  2UYK A;  2CWJ A;  2UYJ A;  3QUW A;  1XHO A;  2CHT A;  3I3F A;  3ZOP A;  3K12 A;  2UYN A;  1COM A;  5HP8 A;  5HP7 A;  1FNJ A;  1UFY A;  1ODE A;  3M1X A;  3KJJ A;  1X25 A;  3R0P A;  2UYN B;  3LME A;  1PF5 A;  1QD9 A;  3MQW A;  1UI9 A;  1ONI A;  1NQ3 A;  3ZP4 A;  2CSL A;  2CW4 A;  2IG8 A;  3ZP7 A;  1QAH A;  3V4D A;  3ZO8 A;  3L7Q A;  1QU9 A;  1DBF A;  4NWO B;  4ZK7 A;  1XRG A;  2UYP A;  3GTZ A;  3KJK A;  3M4S A;  2CVL A;  2OTM A;  2B33 A; 
#chains in the Genus database with same CATH topology
 4TV9 B;  5HXU A;  3VCZ A;  4X3L A;  5JH7 A;  5CA1 A;  5HY1 A;  3HKC A;  2ZAU A;  4I50 B;  2Q1X A;  5IT9 M;  4RHA A;  4KWE A;  4BVS A;  3LFO A;  4EB6 B;  5GIP C;  4G88 A;  5GON A;  3J7A R;  1X25 A;  4WBN B;  3C9T A;  5KMG B;  3S0W A;  3I56 F;  2F9Z C;  3TD5 A;  3ZP4 A;  4E6E A;  4BY9 D;  4O2A A;  4IIJ A;  3V4D A;  1W3E X;  3LWR C;  2LBW A;  2CVL A;  3CME F;  1JD1 A;  5LOV B;  1TVK A;  2AIF A;  4LNU A;  5JQG B;  2KG4 A;  5EIB D;  3KHN A;  1M1K H;  4U3J A;  1FNK A;  1VH8 A;  3IR9 A;  3JAM M;  4G4X A;  3S0Y A;  2I6D A;  3IKF A;  3CD6 F;  2HX0 A;  2VXY A;  3IEQ A;  5LA6 B;  1W2B F;  1VQM F;  4F6R A;  3S06 A;  1U40 A;  3MQW A;  3JAS B;  3CCU F;  3WGJ A;  3L7Q A;  5EB1 B;  2R6R 1;  4ZI7 B;  1XBI A;  3WGL A;  4C8G A;  4O4J A;  2ZOD A;  1VQ9 F;  3N2K B;  1Z5V A;  1H7M A;  5HY2 A;  1SA0 A;  1JY8 A;  2H8C A;  5EYP B;  3PLA C;  3NK6 A;  4X1Y B;  3K2X A;  4EI8 A;  3CB2 A;  1YJ9 F;  2W8B C;  1FNJ A;  5J2T B;  2QA4 F;  1UFY A;  3P4E A;  2HP0 B;  3RE3 A;  2Z1F A;  1QVG F;  3HKE B;  1U3L A;  3CC7 F;  4X1I A;  3C9R A;  2Z01 A;  3DC2 A;  3LWO C;  3F0D A;  1T0A A;  2VAP A;  1OAP A;  3P0Z A;  3JAR B;  4BT3 A;  4FFB A;  3CCS F;  3V7E A;  5IYZ B;  4R40 B;  2HRU A;  3GHZ A;  3D00 A;  3RA5 A;  3QUW A;  4BW0 B;  5MN5 A;  1CK2 A;  2UZH A;  4DRX A;  4YJ2 A;  1W58 1;  3IMP A;  3K12 A;  1S72 F;  2HS4 A;  1COM A;  3F6M A;  3LWP C;  1XV2 A;  3CCM F;  3VMF B;  1H47 A;  5HP7 A;  2QI2 A;  3FD5 A;  1GO0 A;  1VK3 A;  2K1S A;  3CG6 A;  4I4T B;  4ZOL B;  1UI9 A;  1NQ3 A;  2LCA A;  3HKB B;  2Q1Y A;  4TUY B;  4NWO B;  4B45 A;  4HNA A;  1RQ7 A;  1XRG A;  3M84 A;  5G4V C;  1FFX A;  1JFF B;  3K0T A;  5CA0 A;  5LXT B;  3WPW A;  5KX5 B;  3I7T A;  2UYK A;  4BT5 A;  3IKE A;  5JCO C;  3RYC B;  3HKD B;  5IJ9 B;  3CCE F;  4X3M A;  3QTY A;  5C8Y A;  2PMP A;  1ODE A;  1VQV A;  4O2B A;  4ZHQ B;  3DDN A;  5LP6 B;  5GAN K;  1K8A H;  3WGK A;  5GIO C;  4TV9 A;  3MDO A;  1R1M A;  5EZY B;  5AVM A;  2RB9 A;  3ERN A;  1IV1 A;  1Q86 H;  4C81 A;  4XCQ A;  4I50 A;  3F0E A;  5FNV B;  2P6Y A;  2ZF8 A;  4DXD A;  3CC4 F;  1KNJ A;  1IV2 A;  2N48 A;  5JCO A;  3RA6 A;  4EB6 A;  2BTQ B;  1VQL F;  3ELC A;  2ALE A;  3LDT A;  3VYU C;  3N4Z A;  4WBN A;  5KMG A;  5LYJ B;  3JVH A;  5HP8 A;  4ZHY B;  2OZB A;  5IJ0 B;  5JVD A;  5EO3 A;  4IHJ B;  4C4W C;  2IQQ A;  2ZOV A;  5B8F A;  3C9S A;  5LOV A;  1W5F A;  1IV4 A;  3G6E F;  1DBF A;  3S03 A;  1VQ6 F;  3CMA F;  2OTM A;  2KTV A;  2L26 A;  2BO1 A;  3D01 A;  2Z1T A;  5LA6 A;  1H48 A;  1XHO A;  1YJW F;  1W5E A;  1KC8 H;  1VQ5 F;  4TV8 B;  5MN6 A;  1YI2 F;  3JAS A;  5CA1 B;  1Q8R A;  1CN7 A;  1PXW A;  3J81 M;  2I6R A;  1VQP F;  4TZZ A;  4O4I B;  4X1K B;  1VQ7 F;  1QD9 A;  2VGM A;  5HXZ A;  2V9Y A;  3CC2 F;  3N2K A;  1T0K B;  2IG8 A;  1RA4 A;  5EB0 A;  4ZHV A;  3CCR F;  2RHH A;  3Q8H A;  3KJK A;  4C8I A;  1N8R H;  4EI7 A;  4X1Y A;  3OON A;  3S0H A;  3RYH B;  2HP0 A;  4LNU B;  3JAL B;  3V3T A;  3WGM A;  4ERH A;  3NVI B;  3UT5 B;  3HKE A;  4G4W A;  2H8E A;  1TUB A;  2UYN B;  3G71 F;  4EI9 A;  2OTJ F;  5MN4 A;  5FJ4 C;  3WJQ A;  3JAW A;  3JAR A;  1QAH A;  2LBX A;  3U0O A;  3ZO8 A;  3CPW F;  4I55 A;  1X7O A;  5BMV B;  5IYZ A;  3M4S A;  1VQ8 F;  3VI6 A;  5HY0 A;  4O4L A;  3RYF B;  4G4V A;  2GZL A;  1M90 H;  1Q81 H;  4B62 A;  3FBA A;  2CHT A;  2H6L A;  3I3F A;  5HWE A;  1KD1 H;  3V7Q A;  4ZOL A;  1W55 A;  3JAK B;  3HKB A;  4TUY A;  4BVR A;  5CB4 A;  3BYQ A;  4ZHW A;  1ZWZ A;  5J2U B;  1U43 A;  3N2G B;  1JFF A;  2DT4 A;  3FD6 A;  5EIB C;  5LXT A;  1QU9 A;  5KX5 A;  2R75 1;  1W5B A;  2KGW A;  1YQN A;  3JAT A;  3RYC A;  3HKD A;  4X20 B;  2DYY A;  5IJ9 A;  3NMU C;  4U39 A;  2NMU A;  1YJN F;  5ITZ B;  4ZHQ A;  3LWV C;  3EOR A;  3VYS C;  1VHA A;  3CYQ A;  4YJ2 B;  2ZVZ A;  2Z1E A;  2AIZ P;  3KJJ A;  3C9U A;  2BTO A;  3B6N A;  3ESJ A;  3RYI A;  1W59 A;  5FNV A;  4G4Y A;  2HRY A;  3FPI A;  4ZK7 A;  2MQE A;  3GTZ A;  1QVF F;  3HJW C;  1CLI A;  1NMU B;  5LYJ A;  5IJ0 A;  1FFX B;  3VTI C;  2VGN A;  4IHJ A;  3GYQ A;  3N4Y A;  3VOA A;  3NK7 A;  2VAW A;  1K73 H;  4YJ3 B;  5A2Q M;  4BVT A;  4NQ3 A;  1RLU A;  4BT4 A;  3E22 B;  3QHD A;  1JJ2 F;  4BT6 A;  3CXC F;  2GVI A;  3ZP7 A;  5JQG A;  2HQS C;  5HY4 A;  3T80 A;  3CYP B;  2QTP A;  4B5C A;  2CWJ A;  4O4H B;  4PWT A;  4TV8 A;  2HVY D;  3SIU A;  3C8L A;  2KTU A;  4O4I A;  2IAF A;  2GLZ A;  4X1K A;  3VOB A;  1W40 A;  4M8I A;  5JH7 B;  1E7K A;  2BTU A;  3HKC B;  3CCJ F;  4C8E A;  3OW2 F;  4G4Z A;  2WAL A;  5JVD B;  1YIJ F;  5EWR A;  4ZI7 A;  2RHO A;  3I55 F;  2CW4 A;  2VAM A;  3HTN A;  1JN1 A;  3WPX A;  2Z1U A;  5GON B;  1U3P A;  4B46 A;  1GX1 A;  2HP3 A;  3MBM A;  3OBY A;  1RQ2 A;  1W42 A;  3RYH A;  2RHL A;  1IV3 A;  1YIT F;  3JAL A;  3LYB A;  2YXZ A;  4O2A B;  5EYP A;  4IIJ B;  3UT5 A;  3NVK E;  3HWU A;  3WGN A;  5J2T A;  1IPA A;  1GZ0 A;  1TVK B;  2UYN A;  4U3J B;  3VO8 A;  3WXM B;  1KNK A;  1VQ4 F;  3TD3 A;  5BMV A;  1YGY A;  2YYE A;  3AGK A;  3CCQ F;  4C82 A;  3HAX D;  1FSZ A;  2OHW A;  4F6R B;  3F0G A;  3RYF A;  2UYP A;  3PAF A;  3F0F A;  3VIU A;  1YHQ F;  3O85 A;  3MCQ A;  3JAK A;  1X7P A;  4O4J B;  4BVQ A;  5G4U C;  3CCV F;  4I4T A;  1SA0 B;  2AMT A;  5LP6 C;  5J2U A;  3N2G A;  4RQO A;  2PHN A;  3E20 B;  4BT2 A;  1X52 A;  1VQK F;  3S02 A;  1PF5 A;  3P10 A;  4NUT A;  3TD4 A;  1ONI A;  1KQS F;  1RLG A;  1TUB B;  3KIZ A;  3WJP A;  3IEW A;  3G4S F;  4X20 A;  2LBT A;  2JNB A;  3JAW B;  2RHJ A;  5ITZ A;  4X1I B;  4BT7 A;  5DCV A;  3OBW A;  3CCL F;  2CHS A;  4I55 B;  2EWC A;  1Z5W A;  2UYJ A;  1W57 A;  1OFU A;  3D54 A;  3ZOP A;  4FFB B;  4O4L B;  5LP6 A;  5FLX M;  2QEX F;  2HS3 A;  1GO1 A;  3M1X A;  4DRX B;  3SIV A;  1W41 A;  5EZY A;  2G9I A;  5EAZ A;  5CB4 B;  1Q82 H;  2FGY A;  1VQN F;  2OTL F;  3JCM M;  1NJI H;  2B33 A;  1VQO F;  1J7H A;  1DT9 A;  1K9M H;  4YJ3 A;  1Q7Y H;  3CPQ A;  4HNA B;  1W5A A;  2CZW A;  3JAT B;  3E22 A;  3KE1 A;  3J80 M;  5CA0 B;  5GAP K;  1SDS A;  3E1Y A;  4LCK A;  2ZVY A;  1SZQ A;  3R0P A;  5GIN C;  3LME A;  2FC3 A;  3ON1 A;  2CSL A;  5C8Y B;  4O4H A;  3WJR A;  4O2B B;  3MCA B;  3VYT C;  2HS0 A;  3FFM A;  3RYI B;  3K14 A;  3LWQ C; 
#chains in the Genus database with same CATH homology
 1JD1 A;  3LYB A;  1J7H A;  2CHS A;  2EWC A;  3K0T A;  2DYY A;  3VCZ A;  3D01 A;  1FNK A;  3I7T A;  2UYK A;  2CWJ A;  2UYJ A;  3QUW A;  1XHO A;  2CHT A;  3I3F A;  3ZOP A;  3K12 A;  2UYN A;  1COM A;  5HP8 A;  5HP7 A;  1FNJ A;  1UFY A;  1ODE A;  3M1X A;  3KJJ A;  1X25 A;  3R0P A;  2UYN B;  3LME A;  1PF5 A;  1QD9 A;  3MQW A;  1UI9 A;  1ONI A;  1NQ3 A;  3ZP4 A;  2CSL A;  2CW4 A;  2IG8 A;  3ZP7 A;  1QAH A;  3V4D A;  3ZO8 A;  3L7Q A;  1QU9 A;  1DBF A;  4NWO B;  4ZK7 A;  1XRG A;  2UYP A;  3GTZ A;  3KJK A;  3M4S A;  2CVL A;  2OTM A;  2B33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...