1YJ9F

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yj9F00
1M1KH 1PXWA 3HAXD 4X3MA 1JJ2F 3CCLF 1M90H 5GANK 1Q86H 1X7PA 3HJWC 1YJNF 3MCAB 3O85A 2QEXF 3CC2F 1NMUB 1VQLF 5EO3A 1T0KB 1VQOF 3SIUA 3CG6A 3WXMB 1YITF 1KD1H 1E7KA 3AGKA 1QVGF 2JNBA 3LWOC 2VGNA 1W41A 4X3LA 2FC3A 3CCRF 2AIFA 2KTUA 3E20B 1GO0A 5A2QM 2VGMA 3NVKE 1SDSA 1RLGA 3J80M 1W3EX 1RA4A 3CCVF 1W42A 3CC4F 1IPAA 4BY9D 3CCJF 3VMFB 3FFMA 1VQNF 5EWRA 1Q7YH 3V7EA 5G4UC 2WALA 5FJ4C 1VQ4F 2QI2A 3PAFA 3NMUC 3E1YA 3IR9A 1YI2F 3NK7A 2KTVA 3N4ZA 3CC7F 1YJ9F 3CCSF 3I56F 3PLAC 3CCQF 5GINC 3CCUF 5GIOC 2KG4A 1YJWF 2OTLF 1K8AH 3CXCF 1CK2A 3ON1A 3J81M 2OTJF 2LBXA 1K73H 1ZWZA 1X7OA 3GYQA 1QVFF 1N8RH 4LCKA 3LWQC 3CMEF 5FLXM 1W2BF 1YHQF 1X52A 3SIVA 1XBIA 2HVYD 5GAPK 3CD6F 5DCVA 3N4YA 1VQ7F 1S72F 3CPWF 3LWRC 4BW0B 1Q82H 3NK6A 1W40A 1VQ5F 4TZZA 1KQSF 3OBWA 1GO1A 3I55F 3CCMF 2OZBA 5IT9M 2LBWA 1GZ0A 1YIJF 3G71F 1VQKF 4C4WC 5G4VC 1VQ9F 1VQMF 3CMAF 1CN7A 3OW2F 1VQPF 3J7AR 3RA6A 1VQ8F 1DT9A 3V7QA 1NJIH 3G4SF 3LWVC 3NVIB 3LWPC 2BO1A 3RA5A 3JAMM 1H7MA 3CPQA 1Q81H 1VQ6F 1K9MH 3OBYA 2QA4F 4NUTA 2ALEA 2OHWA 1KC8H 3JCMM 2CZWA 5GIPC 3G6EF 2I6DA 3CCEF 3VI6A 3LFOA
chains in the Genus database with same CATH superfamily
2W8BC 3WGJA 5HXUA 1M90H 4IHJA 3VYUC 1Z5WA 4IIJB 3JVHA 5EO3A 5CB4A 4ZHVA 3N2GA 2H8EA 3WXMB 1VH8A 3UT5A 2HP3A 1E7KA 1QVGF 2JNBA 1RLUA 4TUYB 2AIFA 2KTUA 3E20B 1GO0A 5A2QM 5IJ0B 1YQNA 4O4IA 4X1IB 3QHDA 3CCVF 5IYZA 3CC4F 3QTYA 3V7EA 2RHHA 3S06A 4BT6A 1VQ4F 2OTMA 2RHOA 2IAFA 5HY0A 5GONB 3JASA 3RYCA 2UYJA 1YJ9F 5BMVA 5GINC 1VQVA 4ZK7A 3CXCF 1CK2A 4X1YB 4EI9A 4HNAB 4O4LB 2OTJF 2LBXA 1QVFF 3LWQC 3RYFB 3HTNA 3P10A 1W2BF 1YHQF 5CA1B 5HY2A 2BTOA 2Z1UA 4NWOB 5GAPK 3CD6F 1IV3A 5DCVA 2AIZP 3JAKB 4BVTA 2UYNA 4NQ3A 1QAHA 3CPWF 3C9TA 2L26A 3LWRC 4ERHA 3HKCB 1Q82H 1W40A 4TZZA 2CWJA 1GO1A 3LDTA 3I55F 1FFXA 4O4JA 1X25A 5IT9M 5LP6C 4YJ2B 2IG8A 2LBWA 2LBTA 1YIJF 3GTZA 1VQMF 5JVDB 2VAPA 3J7AR 5MN5A 3I7TA 5IJ9B 3JAWB 4WBNB 3VOBA 1OFUA 3E22B 1DT9A 3V7QA 3V3TA 3G4SF 2CVLA 2Z01A 5C8YA 4ZI7B 2ZODA 4I55A 3DC2A 3WGKA 4G88A 1H7MA 2HS4A 4BVRA 1VQ6F 3OBYA 3S02A 2QA4F 4YJ3B 3JALB 3N2KA 2ALEA 1JFFB 3BYQA 3V4DA 3VI6A 3ZP4A 3S03A 1W57A 3HKEB 3HAXD 5AVMA 4X3MA 5LA6A 1JJ2F 3CYQA 2QTPA 4U39A 3HJWC 1QD9A 5JQGA 2R6R1 3HKDA 3O85A 3MQWA 1VQLF 3HKBA 3CYPB 4X20B 2GLZA 4LNUA 3C9SA 3KJKA 3R0PA 4C8EA 5J2TA 1RQ2A 1TUBA 2KGWA 5J2UB 1W41A 4X3LA 3L7QA 5EZYB 5JCOA 3TD5A 3ESJA 2DT4A 4RQOA 5CB4B 3NVKE 4ZHYB 3F0EA 1RLGA 4ZOLB 4F6RB 4EB6A 1RA4A 1U43A 3U0OA 3KE1A 4DRXB 2F9ZC 2ZF8A 5EYPA 4ZHQB 1DBFA 5KMGB 3C9UA 3S0HA 4FFBA 1VQNF 4X1KB 5KX5A 2GVIA 5G4UC 2UYKA 2HRYA 4O2AB 3K12A 1W55A 3PAFA 1VHAA 1T0AA 3JARA 3IR9A 1YI2F 4BT4A 5EAZA 3ZP7A 5MN4A 5HWEA 4I50B 3I56F 1SA0B 3D54A 3PLAC 1XRGA 5EB1B 2H6LA 4M8IA 1W5EA 3M1XA 5ITZA 5GIOC 1YJWF 3ZO8A 5HXZA 3F6MA 3JATB 3MBMA 2Z1EA 3B6NA 2HRUA 1ZWZA 1UI9A 3RYIA 4BT3A 3RYCB 5HP7A 3LMEA 1N8RH 2FGYA 5FLXM 5BMVB 3SIVA 4U3JB 5FNVA 2HVYD 4O4HB 1FNJA 3VO8A 3WPXA 5HY4A 4BT7A 1NQ3A 3IKEA 3RE3A 3C9RA 2V9YA 4IIJA 4XCQA 1IV4A 3NK6A 3VTIC 1VQ5F 2BTUA 4O2BB 5JH7B 1GZ0A 5G4VC 3S0YA 2IQQA 3IEQA 3CMAF 1VQPF 3ZOPA 3FD6A 5B8FA 1ODEA 5IJ0A 1FFXB 3M84A 3DDNA 4X1IA 3NVIB 3WJPA 3LWPC 4TV9B 3RA5A 1H48A 4G4XA 1PF5A 3WPWA 1UFYA 2Z1TA 2CSLA 4C81A 5GIPC 1SZQA 2DYYA 4C8IA 3G6EF 1RQ7A 3F0FA 1K73H 3LFOA 2P6YA 4C82A 5LOVB 2LCAA 5GONA 1W59A 3WGNA 4I55B 3CCLF 1U3PA 2R751 1X7PA 2HP0A 3MCAB 4TV8B 2QEXF 3MDOA 5JCOC 1NMUB 5LYJB 3HWUA 4X1YA 3KHNA 4BT2A 4HNAA 4O4LA 1VQOF 1YITF 4I4TA 3WGMA 1KD1H 1R1MA 2HS3A 3AGKA 3RYHA 5CA0B 3WJRA 2FC3A 3HKDB 3TD4A 2VAMA 2VGMA 2YXZA 5CA1A 1SDSA 1JN1A 2CHSA 3QUWA 3WGLA 3JAKA 3WJQA 5LP6B 1FNKA 2CHTA 4R40B 3IKFA 1W42A 1TVKA 4KWEA 2B33A 3CCJF 3HKCA 1YGYA 3FD5A 5EWRA 1Q7YH 1JD1A 4G4VA 2RHJA 4YJ2A 2QI2A 3M4SA 3CC7F 2KTVA 5JVDA 3D01A 3CCSF 4IHJB 5MN6A 5IJ9A 3JAWA 4WBNA 3CCQF 5KX5B 3CCUF 3P4EA 2Q1XA 4C8GA 2GZLA 2OTLF 3K14A 3N2GB 1W5FA 4ZI7A 3P0ZA 2RB9A 3VIUA 1XHOA 3C8LA 3UT5B 3GYQA 2ZVYA 4LCKA 4YJ3A 5LXTA 3JALA 5EIBC 5EIBD 1JFFA 3CMEF 5HP8A 3KIZA 1X52A 1XBIA 3HKEA 2K1SA 2PHNA 4O4IB 3N4YA 1W5BA 1VQ7F 5IYZB 4EI8A 2EWCA 1U40A 1W5AA 1KQSF 3OBWA 4X20A 5FNVB 1IV2A 3CCMF 2OZBA 3F0DA 2HS0A 5J2UA 5EZYA 2HX0A 3JASB 3FPIA 3T80A 3OW2F 3RA6A 1XV2A 4ZOLA 4F6RA 4DRXA 3LWVC 2RHLA 2BO1A 4ZHQA 1KNKA 5KMGA 3EORA 3IMPA 1Q81H 4G4ZA 1GX1A 3Q8HA 4X1KA 2NMUA 4NUTA 4RHAA 2BTQB 3I3FA 4O2AA 2ZVZA 2MQEA 3CCEF 3OONA 4G4YA 1OAPA 1JY8A 1PXWA 3TD3A 3ERNA 4BVSA 1M1KH 5GANK 4DXDA 4G4WA 1Q86H 2UYNB 4EI7A 4I50A 1SA0A 2Z1FA 4TUYA 2N48A 1YJNF 3CC2F 4E6EA 3MCQA 1T0KB 3JATA 4BVQA 3F0GA 3SIUA 3CG6A 4O4JB 3VYTC 1VK3A 3LWOC 2VGNA 2HP0B 3CCRF 2ZAUA 1ONIA 4U3JA 2VXYA 4O4HA 2UYPA 1IV1A 3J80M 1W3EX 3VOAA 4B62A 4I4TB 3FBAA 1COMA 5C8YB 3K0TA 3RYHB 1IPAA 4BY9D 3VMFB 3FFMA 3N2KB 2WALA 5FJ4C 4O2BA 5JH7A 1Z5VA 3NMUC 3E1YA 4B46A 1QU9A 5LA6B 3NK7A 2H8CA 1TVKB 3N4ZA 4PWTA 2HQSC 3RYFA 5JQGB 2PMPA 3IEWA 2KG4A 3HKBB 2Q1YA 1K8AH 1J7HA 3ON1A 3J81M 4TV9A 4LNUB 1X7OA 1FSZA 5J2TB 1TUBB 3VCZA 3D00A 2G9IA 1KNJA 2I6RA 3S0WA 3CB2A 5LOVA 4EB6B 3K2XA 5EYPB 2AMTA 1S72F 5LXTB 2UZHA 4TV8A 1W581 5LYJA 4BW0B 4FFBB 4B5CA 3E22A 2YYEA 5CA0A 3JARB 3G71F 1VQKF 3ELCA 4C4WC 2VAWA 3GHZA 1VQ9F 3VYSC 4B45A 1CLIA 1CN7A 1VQ8F 2CW4A 5ITZB 4ZHWA 5LP6A 1NJIH 3KJJA 2ZOVA 5EB0A 1U3LA 5HY1A 3JAMM 3CPQA 3RYIB 1K9MH 3LYBA 1Q8RA 2OHWA 1KC8H 3JCMM 2CZWA 1H47A 4BT5A 2I6DA
chains in the Genus database with same CATH topology
1M1KH 4BVSA 1PXWA 3HAXD 4X3MA 5HXUA 1JJ2F 3CCLF 1M90H 5GANK 1Q86H 1X7PA 4EI7A 3HJWC 1YJNF 3MCAB 3O85A 2QEXF 3CC2F 1NMUB 1VQLF 5EO3A 1T0KB 2GLZA 4BVQA 1VQOF 3SIUA 3CG6A 3WXMB 1YITF 1KD1H 1E7KA 3AGKA 1QVGF 2JNBA 3LWOC 2VGNA 1W41A 4X3LA 2FC3A 3CCRF 2AIFA 2KTUA 3E20B 1GO0A 5A2QM 2VGMA 3NVKE 1SDSA 1RLGA 3J80M 1W3EX 1RA4A 2F9ZC 3CCVF 1W42A 3CC4F 1IPAA 4BY9D 3CCJF 3VMFB 3FFMA 1VQNF 5EWRA 1Q7YH 3V7EA 5G4UC 2WALA 5FJ4C 1VQ4F 2QI2A 3PAFA 3NMUC 3E1YA 3IR9A 5HY0A 1YI2F 3NK7A 2KTVA 3N4ZA 3CC7F 1YJ9F 3CCSF 5HWEA 3I56F 3PLAC 3CCQF 5GINC 3CCUF 5GIOC 2KG4A 1YJWF 2OTLF 5HXZA 1K8AH 3CXCF 1CK2A 3ON1A 4EI9A 3J81M 2OTJF 2LBXA 1K73H 1ZWZA 1X7OA 3GYQA 1QVFF 3D00A 1N8RH 4LCKA 3LWQC 3CMEF 2FGYA 5FLXM 1W2BF 1YHQF 1X52A 3SIVA 1XBIA 5HY2A 2HVYD 5HY4A 5GAPK 3CD6F 5DCVA 4BVTA 3N4YA 4NQ3A 1VQ7F 1S72F 3CPWF 3LWRC 4EI8A 4BW0B 4XCQA 1Q82H 3NK6A 1W40A 1VQ5F 4TZZA 1KQSF 3OBWA 1GO1A 3I55F 3CCMF 2OZBA 5IT9M 2LBWA 1GZ0A 1YIJF 3G71F 1VQKF 4C4WC 5G4VC 1VQ9F 1VQMF 3CMAF 1CN7A 3OW2F 1VQPF 3J7AR 3RA6A 1VQ8F 1DT9A 3V7QA 3V3TA 1NJIH 3G4SF 3LWVC 3NVIB 3LWPC 2BO1A 3RA5A 5HY1A 3JAMM 1H7MA 3CPQA 4BVRA 1Q81H 1K9MH 3OBYA 2QA4F 1VQ6F 4NUTA 2ALEA 2OHWA 1KC8H 3JCMM 2CZWA 5GIPC 3G6EF 2I6DA 3CCEF 3VI6A 3LFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K H;  1PXW A;  3HAX D;  4X3M A;  1JJ2 F;  3CCL F;  1M90 H;  5GAN K;  1Q86 H;  1X7P A;  3HJW C;  1YJN F;  3MCA B;  3O85 A;  2QEX F;  3CC2 F;  1NMU B;  1VQL F;  5EO3 A;  1T0K B;  1VQO F;  3SIU A;  3CG6 A;  3WXM B;  1YIT F;  1KD1 H;  1E7K A;  3AGK A;  1QVG F;  2JNB A;  3LWO C;  2VGN A;  1W41 A;  4X3L A;  2FC3 A;  3CCR F;  2AIF A;  2KTU A;  3E20 B;  1GO0 A;  5A2Q M;  2VGM A;  3NVK E;  1SDS A;  1RLG A;  3J80 M;  1W3E X;  1RA4 A;  3CCV F;  1W42 A;  3CC4 F;  1IPA A;  4BY9 D;  3CCJ F;  3VMF B;  3FFM A;  1VQN F;  5EWR A;  1Q7Y H;  3V7E A;  5G4U C;  2WAL A;  5FJ4 C;  1VQ4 F;  2QI2 A;  3PAF A;  3NMU C;  3E1Y A;  3IR9 A;  1YI2 F;  3NK7 A;  2KTV A;  3N4Z A;  3CC7 F;  1YJ9 F;  3CCS F;  3I56 F;  3PLA C;  3CCQ F;  5GIN C;  3CCU F;  5GIO C;  2KG4 A;  1YJW F;  2OTL F;  1K8A H;  3CXC F;  1CK2 A;  3ON1 A;  3J81 M;  2OTJ F;  2LBX A;  1K73 H;  1ZWZ A;  1X7O A;  3GYQ A;  1QVF F;  1N8R H;  4LCK A;  3LWQ C;  3CME F;  5FLX M;  1W2B F;  1YHQ F;  1X52 A;  3SIV A;  1XBI A;  2HVY D;  5GAP K;  3CD6 F;  5DCV A;  3N4Y A;  1VQ7 F;  1S72 F;  3CPW F;  3LWR C;  4BW0 B;  1Q82 H;  3NK6 A;  1W40 A;  1VQ5 F;  4TZZ A;  1KQS F;  3OBW A;  1GO1 A;  3I55 F;  3CCM F;  2OZB A;  5IT9 M;  2LBW A;  1GZ0 A;  1YIJ F;  3G71 F;  1VQK F;  4C4W C;  5G4V C;  1VQ9 F;  1VQM F;  3CMA F;  1CN7 A;  3OW2 F;  1VQP F;  3J7A R;  3RA6 A;  1VQ8 F;  1DT9 A;  3V7Q A;  1NJI H;  3G4S F;  3LWV C;  3NVI B;  3LWP C;  2BO1 A;  3RA5 A;  3JAM M;  1H7M A;  3CPQ A;  1Q81 H;  1VQ6 F;  1K9M H;  3OBY A;  2QA4 F;  4NUT A;  2ALE A;  2OHW A;  1KC8 H;  3JCM M;  2CZW A;  5GIP C;  3G6E F;  2I6D A;  3CCE F;  3VI6 A;  3LFO A; 
#chains in the Genus database with same CATH topology
 2W8B C;  3WGJ A;  5HXU A;  1M90 H;  4IHJ A;  3VYU C;  1Z5W A;  4IIJ B;  3JVH A;  5EO3 A;  5CB4 A;  4ZHV A;  3N2G A;  2H8E A;  3WXM B;  1VH8 A;  3UT5 A;  2HP3 A;  1E7K A;  1QVG F;  2JNB A;  1RLU A;  4TUY B;  2AIF A;  2KTU A;  3E20 B;  1GO0 A;  5A2Q M;  5IJ0 B;  1YQN A;  4O4I A;  4X1I B;  3QHD A;  3CCV F;  5IYZ A;  3CC4 F;  3QTY A;  3V7E A;  2RHH A;  3S06 A;  4BT6 A;  1VQ4 F;  2OTM A;  2RHO A;  2IAF A;  5HY0 A;  5GON B;  3JAS A;  3RYC A;  2UYJ A;  1YJ9 F;  5BMV A;  5GIN C;  1VQV A;  4ZK7 A;  3CXC F;  1CK2 A;  4X1Y B;  4EI9 A;  4HNA B;  4O4L B;  2OTJ F;  2LBX A;  1QVF F;  3LWQ C;  3RYF B;  3HTN A;  3P10 A;  1W2B F;  1YHQ F;  5CA1 B;  5HY2 A;  2BTO A;  2Z1U A;  4NWO B;  5GAP K;  3CD6 F;  1IV3 A;  5DCV A;  2AIZ P;  3JAK B;  4BVT A;  2UYN A;  4NQ3 A;  1QAH A;  3CPW F;  3C9T A;  2L26 A;  3LWR C;  4ERH A;  3HKC B;  1Q82 H;  1W40 A;  4TZZ A;  2CWJ A;  1GO1 A;  3LDT A;  3I55 F;  1FFX A;  4O4J A;  1X25 A;  5IT9 M;  5LP6 C;  4YJ2 B;  2IG8 A;  2LBW A;  2LBT A;  1YIJ F;  3GTZ A;  1VQM F;  5JVD B;  2VAP A;  3J7A R;  5MN5 A;  3I7T A;  5IJ9 B;  3JAW B;  4WBN B;  3VOB A;  1OFU A;  3E22 B;  1DT9 A;  3V7Q A;  3V3T A;  3G4S F;  2CVL A;  2Z01 A;  5C8Y A;  4ZI7 B;  2ZOD A;  4I55 A;  3DC2 A;  3WGK A;  4G88 A;  1H7M A;  2HS4 A;  4BVR A;  1VQ6 F;  3OBY A;  3S02 A;  2QA4 F;  4YJ3 B;  3JAL B;  3N2K A;  2ALE A;  1JFF B;  3BYQ A;  3V4D A;  3VI6 A;  3ZP4 A;  3S03 A;  1W57 A;  3HKE B;  3HAX D;  5AVM A;  4X3M A;  5LA6 A;  1JJ2 F;  3CYQ A;  2QTP A;  4U39 A;  3HJW C;  1QD9 A;  5JQG A;  2R6R 1;  3HKD A;  3O85 A;  3MQW A;  1VQL F;  3HKB A;  3CYP B;  4X20 B;  2GLZ A;  4LNU A;  3C9S A;  3KJK A;  3R0P A;  4C8E A;  5J2T A;  1RQ2 A;  1TUB A;  2KGW A;  5J2U B;  1W41 A;  4X3L A;  3L7Q A;  5EZY B;  5JCO A;  3TD5 A;  3ESJ A;  2DT4 A;  4RQO A;  5CB4 B;  3NVK E;  4ZHY B;  3F0E A;  1RLG A;  4ZOL B;  4F6R B;  4EB6 A;  1RA4 A;  1U43 A;  3U0O A;  3KE1 A;  4DRX B;  2F9Z C;  2ZF8 A;  5EYP A;  4ZHQ B;  1DBF A;  5KMG B;  3C9U A;  3S0H A;  4FFB A;  1VQN F;  4X1K B;  5KX5 A;  2GVI A;  5G4U C;  2UYK A;  2HRY A;  4O2A B;  3K12 A;  1W55 A;  3PAF A;  1VHA A;  1T0A A;  3JAR A;  3IR9 A;  1YI2 F;  4BT4 A;  5EAZ A;  3ZP7 A;  5MN4 A;  5HWE A;  4I50 B;  3I56 F;  1SA0 B;  3D54 A;  3PLA C;  1XRG A;  5EB1 B;  2H6L A;  4M8I A;  1W5E A;  3M1X A;  5ITZ A;  5GIO C;  1YJW F;  3ZO8 A;  5HXZ A;  3F6M A;  3JAT B;  3MBM A;  2Z1E A;  3B6N A;  2HRU A;  1ZWZ A;  1UI9 A;  3RYI A;  4BT3 A;  3RYC B;  5HP7 A;  3LME A;  1N8R H;  2FGY A;  5FLX M;  5BMV B;  3SIV A;  4U3J B;  5FNV A;  2HVY D;  4O4H B;  1FNJ A;  3VO8 A;  3WPX A;  5HY4 A;  4BT7 A;  1NQ3 A;  3IKE A;  3RE3 A;  3C9R A;  2V9Y A;  4IIJ A;  4XCQ A;  1IV4 A;  3NK6 A;  3VTI C;  1VQ5 F;  2BTU A;  4O2B B;  5JH7 B;  1GZ0 A;  5G4V C;  3S0Y A;  2IQQ A;  3IEQ A;  3CMA F;  1VQP F;  3ZOP A;  3FD6 A;  5B8F A;  1ODE A;  5IJ0 A;  1FFX B;  3M84 A;  3DDN A;  4X1I A;  3NVI B;  3WJP A;  3LWP C;  4TV9 B;  3RA5 A;  1H48 A;  4G4X A;  1PF5 A;  3WPW A;  1UFY A;  2Z1T A;  2CSL A;  4C81 A;  5GIP C;  1SZQ A;  2DYY A;  4C8I A;  3G6E F;  1RQ7 A;  3F0F A;  1K73 H;  3LFO A;  2P6Y A;  4C82 A;  5LOV B;  2LCA A;  5GON A;  1W59 A;  3WGN A;  4I55 B;  3CCL F;  1U3P A;  2R75 1;  1X7P A;  2HP0 A;  3MCA B;  4TV8 B;  2QEX F;  3MDO A;  5JCO C;  1NMU B;  5LYJ B;  3HWU A;  4X1Y A;  3KHN A;  4BT2 A;  4HNA A;  4O4L A;  1VQO F;  1YIT F;  4I4T A;  3WGM A;  1KD1 H;  1R1M A;  2HS3 A;  3AGK A;  3RYH A;  5CA0 B;  3WJR A;  2FC3 A;  3HKD B;  3TD4 A;  2VAM A;  2VGM A;  2YXZ A;  5CA1 A;  1SDS A;  1JN1 A;  2CHS A;  3QUW A;  3WGL A;  3JAK A;  3WJQ A;  5LP6 B;  1FNK A;  2CHT A;  4R40 B;  3IKF A;  1W42 A;  1TVK A;  4KWE A;  2B33 A;  3CCJ F;  3HKC A;  1YGY A;  3FD5 A;  5EWR A;  1Q7Y H;  1JD1 A;  4G4V A;  2RHJ A;  4YJ2 A;  2QI2 A;  3M4S A;  3CC7 F;  2KTV A;  5JVD A;  3D01 A;  3CCS F;  4IHJ B;  5MN6 A;  5IJ9 A;  3JAW A;  4WBN A;  3CCQ F;  5KX5 B;  3CCU F;  3P4E A;  2Q1X A;  4C8G A;  2GZL A;  2OTL F;  3K14 A;  3N2G B;  1W5F A;  4ZI7 A;  3P0Z A;  2RB9 A;  3VIU A;  1XHO A;  3C8L A;  3UT5 B;  3GYQ A;  2ZVY A;  4LCK A;  4YJ3 A;  5LXT A;  3JAL A;  5EIB C;  5EIB D;  1JFF A;  3CME F;  5HP8 A;  3KIZ A;  1X52 A;  1XBI A;  3HKE A;  2K1S A;  2PHN A;  4O4I B;  3N4Y A;  1W5B A;  1VQ7 F;  5IYZ B;  4EI8 A;  2EWC A;  1U40 A;  1W5A A;  1KQS F;  3OBW A;  4X20 A;  5FNV B;  1IV2 A;  3CCM F;  2OZB A;  3F0D A;  2HS0 A;  5J2U A;  5EZY A;  2HX0 A;  3JAS B;  3FPI A;  3T80 A;  3OW2 F;  3RA6 A;  1XV2 A;  4ZOL A;  4F6R A;  4DRX A;  3LWV C;  2RHL A;  2BO1 A;  4ZHQ A;  1KNK A;  5KMG A;  3EOR A;  3IMP A;  1Q81 H;  4G4Z A;  1GX1 A;  3Q8H A;  4X1K A;  2NMU A;  4NUT A;  4RHA A;  2BTQ B;  3I3F A;  4O2A A;  2ZVZ A;  2MQE A;  3CCE F;  3OON A;  4G4Y A;  1OAP A;  1JY8 A;  1PXW A;  3TD3 A;  3ERN A;  4BVS A;  1M1K H;  5GAN K;  4DXD A;  4G4W A;  1Q86 H;  2UYN B;  4EI7 A;  4I50 A;  1SA0 A;  2Z1F A;  4TUY A;  2N48 A;  1YJN F;  3CC2 F;  4E6E A;  3MCQ A;  1T0K B;  3JAT A;  4BVQ A;  3F0G A;  3SIU A;  3CG6 A;  4O4J B;  3VYT C;  1VK3 A;  3LWO C;  2VGN A;  2HP0 B;  3CCR F;  2ZAU A;  1ONI A;  4U3J A;  2VXY A;  4O4H A;  2UYP A;  1IV1 A;  3J80 M;  1W3E X;  3VOA A;  4B62 A;  4I4T B;  3FBA A;  1COM A;  5C8Y B;  3K0T A;  3RYH B;  1IPA A;  4BY9 D;  3VMF B;  3FFM A;  3N2K B;  2WAL A;  5FJ4 C;  4O2B A;  5JH7 A;  1Z5V A;  3NMU C;  3E1Y A;  4B46 A;  1QU9 A;  5LA6 B;  3NK7 A;  2H8C A;  1TVK B;  3N4Z A;  4PWT A;  2HQS C;  3RYF A;  5JQG B;  2PMP A;  3IEW A;  2KG4 A;  3HKB B;  2Q1Y A;  1K8A H;  1J7H A;  3ON1 A;  3J81 M;  4TV9 A;  4LNU B;  1X7O A;  1FSZ A;  5J2T B;  1TUB B;  3VCZ A;  3D00 A;  2G9I A;  1KNJ A;  2I6R A;  3S0W A;  3CB2 A;  5LOV A;  4EB6 B;  3K2X A;  5EYP B;  2AMT A;  1S72 F;  5LXT B;  2UZH A;  4TV8 A;  1W58 1;  5LYJ A;  4BW0 B;  4FFB B;  4B5C A;  3E22 A;  2YYE A;  5CA0 A;  3JAR B;  3G71 F;  1VQK F;  3ELC A;  4C4W C;  2VAW A;  3GHZ A;  1VQ9 F;  3VYS C;  4B45 A;  1CLI A;  1CN7 A;  1VQ8 F;  2CW4 A;  5ITZ B;  4ZHW A;  5LP6 A;  1NJI H;  3KJJ A;  2ZOV A;  5EB0 A;  1U3L A;  5HY1 A;  3JAM M;  3CPQ A;  3RYI B;  1K9M H;  3LYB A;  1Q8R A;  2OHW A;  1KC8 H;  3JCM M;  2CZW A;  1H47 A;  4BT5 A;  2I6D A; 
#chains in the Genus database with same CATH homology
 1M1K H;  4BVS A;  1PXW A;  3HAX D;  4X3M A;  5HXU A;  1JJ2 F;  3CCL F;  1M90 H;  5GAN K;  1Q86 H;  1X7P A;  4EI7 A;  3HJW C;  1YJN F;  3MCA B;  3O85 A;  2QEX F;  3CC2 F;  1NMU B;  1VQL F;  5EO3 A;  1T0K B;  2GLZ A;  4BVQ A;  1VQO F;  3SIU A;  3CG6 A;  3WXM B;  1YIT F;  1KD1 H;  1E7K A;  3AGK A;  1QVG F;  2JNB A;  3LWO C;  2VGN A;  1W41 A;  4X3L A;  2FC3 A;  3CCR F;  2AIF A;  2KTU A;  3E20 B;  1GO0 A;  5A2Q M;  2VGM A;  3NVK E;  1SDS A;  1RLG A;  3J80 M;  1W3E X;  1RA4 A;  2F9Z C;  3CCV F;  1W42 A;  3CC4 F;  1IPA A;  4BY9 D;  3CCJ F;  3VMF B;  3FFM A;  1VQN F;  5EWR A;  1Q7Y H;  3V7E A;  5G4U C;  2WAL A;  5FJ4 C;  1VQ4 F;  2QI2 A;  3PAF A;  3NMU C;  3E1Y A;  3IR9 A;  5HY0 A;  1YI2 F;  3NK7 A;  2KTV A;  3N4Z A;  3CC7 F;  1YJ9 F;  3CCS F;  5HWE A;  3I56 F;  3PLA C;  3CCQ F;  5GIN C;  3CCU F;  5GIO C;  2KG4 A;  1YJW F;  2OTL F;  5HXZ A;  1K8A H;  3CXC F;  1CK2 A;  3ON1 A;  4EI9 A;  3J81 M;  2OTJ F;  2LBX A;  1K73 H;  1ZWZ A;  1X7O A;  3GYQ A;  1QVF F;  3D00 A;  1N8R H;  4LCK A;  3LWQ C;  3CME F;  2FGY A;  5FLX M;  1W2B F;  1YHQ F;  1X52 A;  3SIV A;  1XBI A;  5HY2 A;  2HVY D;  5HY4 A;  5GAP K;  3CD6 F;  5DCV A;  4BVT A;  3N4Y A;  4NQ3 A;  1VQ7 F;  1S72 F;  3CPW F;  3LWR C;  4EI8 A;  4BW0 B;  4XCQ A;  1Q82 H;  3NK6 A;  1W40 A;  1VQ5 F;  4TZZ A;  1KQS F;  3OBW A;  1GO1 A;  3I55 F;  3CCM F;  2OZB A;  5IT9 M;  2LBW A;  1GZ0 A;  1YIJ F;  3G71 F;  1VQK F;  4C4W C;  5G4V C;  1VQ9 F;  1VQM F;  3CMA F;  1CN7 A;  3OW2 F;  1VQP F;  3J7A R;  3RA6 A;  1VQ8 F;  1DT9 A;  3V7Q A;  3V3T A;  1NJI H;  3G4S F;  3LWV C;  3NVI B;  3LWP C;  2BO1 A;  3RA5 A;  5HY1 A;  3JAM M;  1H7M A;  3CPQ A;  4BVR A;  1Q81 H;  1K9M H;  3OBY A;  2QA4 F;  1VQ6 F;  4NUT A;  2ALE A;  2OHW A;  1KC8 H;  3JCM M;  2CZW A;  5GIP C;  3G6E F;  2I6D A;  3CCE F;  3VI6 A;  3LFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...