1YJ9F

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yj9F00
3JAMM 3VI6A 4TZZA 2QEXF 2LBXA 1KD1H 3NMUC 1VQ9F 1VQLF 3CD6F 5DCVA 3LWRC 3RA5A 5GIPC 2CZWA 1YJ9F 3PAFA 1W3EX 1NMUB 1S72F 1VQKF 3IR9A 3NVIB 3E1YA 3CCSF 3HAXD 1Q7YH 3LWQC 1RA4A 3CPQA 2OZBA 5A2QM 1K73H 3SIVA 3E20B 4BY9D 2I6DA 2BO1A 2VGNA 1PXWA 1QVFF 3J80M 3HJWC 5GINC 3VMFB 5EO3A 2WALA 3OBWA 5FJ4C 3LWVC 2QA4F 1IPAA 1YIJF 1VQ7F 1E7KA 1W42A 1RLGA 1DT9A 3PLAC 2JNBA 5GIOC 1W41A 1Q86H 5G4UC 1GO0A 1W2BF 3CC7F 3WXMB 1VQNF 1K8AH 2HVYD 3CCRF 1T0KB 3CC4F 5FLXM 1NJIH 1X52A 3CCVF 1SDSA 5G4VC 1VQMF 5IT9M 5EWRA 3O85A 3N4ZA 3CMAF 1X7OA 3RA6A 3AGKA 3J81M 1VQ8F 1X7PA 1ZWZA 3I56F 1CN7A 3LWOC 2FC3A 1GZ0A 3GYQA 5GAPK 3CCMF 3CPWF 3SIUA 4BW0B 2KG4A 4NUTA 1M90H 3N4YA 1Q82H 3CCLF 4X3LA 3NVKE 2KTUA 3NK6A 3LFOA 1YJNF 2OHWA 3CCQF 1YI2F 1W40A 1Q81H 3G6EF 3OW2F 5GANK 3OBYA 2LBWA 4X3MA 2KTVA 1VQ6F 1VQ5F 4LCKA 3CG6A 1M1KH 3CXCF 2VGMA 1K9MH 3LWPC 3I55F 1YHQF 3CMEF 3G71F 1KC8H 3J7AR 3JCMM 3CCEF 1GO1A 1VQ4F 2OTLF 1H7MA 1QVGF 2AIFA 1YJWF 1KQSF 1JJ2F 1XBIA 3FFMA 3V7EA 3V7QA 1N8RH 1CK2A 4C4WC 3CC2F 2ALEA 3NK7A 3MCAB 1VQPF 3CCUF 2OTJF 1YITF 2QI2A 3CCJF 3G4SF 3ON1A 1VQOF
chains in the Genus database with same CATH superfamily
4I4TB 3VI6A 4TZZA 1KNJA 5DCVA 3HKEB 3M1XA 1RQ2A 2H8CA 3D00A 5LA6B 2CZWA 5CB4A 3L7QA 1W3EX 4IIJA 1S72F 3IR9A 4ZOLA 3E1YA 5AVMA 3RYFB 3LWQC 1RA4A 1W5BA 1TUBA 1VK3A 2BO1A 3JASA 5HY1A 5JVDA 5FJ4C 1IPAA 1XV2A 1VQ7F 4I4TA 3HKEA 3CC4F 5FLXM 1X52A 5HWEA 4O4LA 4X1IA 3RYFA 4X1KB 4EI9A 4WBNB 3N4ZA 2CWJA 1JFFB 2YYEA 3J81M 2DT4A 1Z5WA 4LNUB 1X7PA 1FNKA 2DYYA 4O4HA 2N48A 5CA0B 3IMPA 5GAPK 3LMEA 4PWTA 3CPWF 5EYPA 5FNVB 1W59A 3N4YA 4XCQA 4NWOB 3NK6A 5EIBD 3ZP4A 3RYIA 3WPXA 3KE1A 2CVLA 2CHSA 3F6MA 3FPIA 2L26A 3MBMA 5EB1B 2V9YA 5LXTA 4WBNA 3P10A 4B62A 5C8YB 2EWCA 1GX1A 2H6LA 3K0TA 3OBYA 5GANK 4LNUA 1J7HA 2LBWA 1R1MA 4F6RA 1OAPA 1VQ6F 4ZHWA 1VQ5F 3WPWA 4LCKA 1U43A 4U39A 1IV2A 3CXCF 5ITZB 4G4WA 1YHQF 4ZHVA 5HP7A 5IYZA 4ERHA 3RE3A 1U40A 3G71F 4M8IA 1RLUA 2G9IA 4ZI7B 1GO1A 3WJRA 5HXUA 1QU9A 3P4EA 4ZK7A 2OTLF 4IHJA 2AIFA 1YJWF 4BT2A 3ELCA 2CSLA 3V4DA 2AMTA 2Z1UA 3HKBB 2R6R1 1T0AA 4U3JB 3I3FA 3MCAB 1H48A 2BTQB 5LP6B 4DXDA 3CCUF 2OTJF 1IV4A 3MDOA 4R40B 5ITZA 2VAWA 3FD5A 3Q8HA 2IQQA 4G4ZA 1VQOF 3VOBA 3QHDA 1VH8A 1H47A 1SA0A 4ZI7A 1NQ3A 3NMUC 5HY4A 1VQ9F 3ZP7A 3JARB 3TD5A 4G4YA 3RA5A 5GIPC 5LP6C 3S0HA 3LWRC 3OONA 1YJ9F 5BMVB 5J2TB 1NMUB 2ZAUA 1VQKF 3CCSF 3HAXD 5HY2A 2OZBA 5EB0A 4ZOLB 1FSZA 2HS4A 3E20B 2I6DA 4U3JA 2VGNA 3D01A 2ZVYA 1OFUA 2CHTA 5EO3A 2ZODA 1RLGA 5JVDB 4O2AB 3PLAC 1YGYA 5G4UC 3CC7F 1VQNF 4TV8A 3JARA 2MQEA 2HX0A 5BMVA 5MN6A 3S02A 5J2TA 3HTNA 3CCVF 3M4SA 1QAHA 1VQMF 2LCAA 4O4LB 2NMUA 5KX5A 3O85A 4X1IB 3ZO8A 3CMAF 3RA6A 1VHAA 3GHZA 3LDTA 3VIUA 5IJ0A 3N2KA 3LWOC 3EORA 2FC3A 1GZ0A 2VAMA 3CCMF 1X25A 3SIUA 4O2AA 4O4HB 5HP8A 2KG4A 3F0FA 3KIZA 1M90H 2BTUA 1Q82H 5EYPB 1CLIA 5HXZA 3QUWA 3VYSC 1KNKA 3RYCA 3DDNA 4O2BA 3JALB 3WGNA 2IG8A 3V3TA 3RYIB 1YI2F 2HP0A 3F0GA 1W40A 3K12A 1Q81H 3UT5A 2Q1XA 3G6EF 3WGLA 5LXTB 3F0EA 3ERNA 3S03A 2Z1TA 1U3PA 3U0OA 2KTVA 4TUYB 3DC2A 3KJKA 4O4IB 4F6RB 3CG6A 5B8FA 2VGMA 1JY8A 3LWPC 3HKDA 1KC8H 4BVQA 3JALA 5IYZB 3WGKA 3JCMM 5JQGA 1VQ4F 3CB2A 1H7MA 3TD4A 5EZYA 2RHJA 4IHJB 4BVRA 4EB6A 1JJ2F 4I50A 3V7QA 3C8LA 4C8EA 2YXZA 4TUYA 4O4IA 1VQVA 5LOVA 1VQPF 1YITF 3K14A 2Q1YA 2HRYA 3S06A 1Q8RA 3VOAA 3JAMM 2LBXA 1XRGA 1VQLF 1SA0B 5EAZA 3PAFA 4X1YA 1Q7YH 3CPQA 3SIVA 3IKFA 4YJ2A 4BY9D 4G4XA 3ZOPA 5GINC 2QTPA 3C9TA 5JCOA 3D54A 3OBWA 2GLZA 3LWVC 5GONB 1E7KA 1W42A 1DT9A 4BVTA 1UI9A 5GIOC 1W41A 1ODEA 2UYPA 1W2BF 3WXMB 4I55A 4C8IA 2HVYD 4HNAB 2H8EA 4TV8B 3P0ZA 1DBFA 2Z1FA 3MCQA 5EWRA 1RQ7A 3HKCA 2B33A 2OTMA 3C9UA 2HS3A 3KJJA 1X7OA 3AGKA 4TV9B 5KX5B 4ZHYB 5CA1A 1XHOA 5GONA 3GYQA 5IJ0B 1W55A 2GZLA 3N2KB 4NUTA 1FFXA 3ESJA 3CCLF 1W581 4HNAA 2IAFA 4X3LA 3S0YA 3CYPB 4G4VA 4RQOA 4YJ3A 3VO8A 3VYTC 3LFOA 4NQ3A 2GVIA 3WGJA 4B46A 3RYCB 4O2BB 3TD3A 2UYNA 3JAKB 4B5CA 1JD1A 4DRXA 3QTYA 2HP0B 4TV9A 5KMGA 3UT5B 4X3MA 4BT3A 3M84A 2UYJA 3JVHA 4BT6A 5EIBC 4C81A 3N2GA 3C9SA 3CCEF 4EI7A 3HKDB 3VCZA 4BT7A 2AIZP 3JAKA 1QVGF 5JQGB 3IEQA 1JN1A 1XBIA 5EZYB 3V7EA 1YQNA 3JATB 2BTOA 4C4WC 4EB6B 3IKEA 4RHAA 3VYUC 4I50B 3NK7A 1QD9A 3JAWA 1FNJA 5LOVB 2QI2A 3VTIC 3IEWA 3G4SF 3ON1A 3C9RA 2QEXF 4X20B 2RHHA 1KD1H 5LA6A 3E22B 4G88A 3CD6F 3NVIB 3HWUA 3JATA 2HQSC 4B45A 5A2QM 1K73H 2F9ZC 4X1YB 1QVFF 1PXWA 3J80M 3HJWC 2RB9A 4YJ2B 2UZHA 3VMFB 3WJQA 2WALA 2FGYA 1ONIA 2KGWA 3WGMA 2QA4F 4C82A 1YIJF 1W5AA 3WJPA 2VXYA 2JNBA 1Q86H 1GO0A 4X20A 1COMA 1K8AH 3E22A 2ZOVA 2HRUA 5JH7B 5J2UB 4I55B 3CCRF 1T0KB 1NJIH 4ZHQB 4X1KA 3MQWA 4BT4A 1SDSA 5JCOC 5G4VC 5IT9M 1JFFA 1U3LA 2ZF8A 3F0DA 5IJ9B 2K1SA 3HKCB 1TVKB 5LYJB 2Z1EA 1VQ8F 1W5EA 1ZWZA 5CA0A 3I56F 1CN7A 3B6NA 5FNVA 2CW4A 3FD6A 4BW0B 5CA1B 2PHNA 1IV3A 4C8GA 5MN4A 2P6YA 2RHOA 3BYQA 2PMPA 2R751 5JH7A 1FFXB 3NVKE 2KTUA 3I7TA 4O4JB 5J2UA 2I6RA 2W8BC 3R0PA 3K2XA 4KWEA 2OHWA 4BVSA 4ZHQA 3CCQF 1YJNF 4YJ3B 3T80A 5C8YA 5IJ9A 1W5FA 4BT5A 3OW2F 1PF5A 2UYNB 1TVKA 5LYJA 4DRXB 4FFBB 5KMGB 1M1KH 2RHLA 3S0WA 1K9MH 3I55F 3FBAA 3CYQA 4O4JA 3CMEF 2HP3A 5HY0A 3N2GB 3RYHB 2LBTA 3J7AR 5MN5A 4EI8A 2Z01A 3LYBA 4E6EA 5CB4B 4IIJB 1KQSF 1W57A 3HKBA 3FFMA 1N8RH 3GTZA 1CK2A 2ZVZA 3CC2F 4FFBA 1TUBB 5LP6A 2ALEA 3JASB 1IV1A 1SZQA 3CCJF 1Z5VA 3JAWB 1UFYA 3KHNA 2VAPA 2UYKA 2HS0A 3RYHA
chains in the Genus database with same CATH topology
3JAMM 3VI6A 4TZZA 2QEXF 2LBXA 1KD1H 3NMUC 5HY4A 1VQ9F 1VQLF 3CD6F 5DCVA 3LWRC 3RA5A 5GIPC 3D00A 2CZWA 1YJ9F 3PAFA 1W3EX 1NMUB 1S72F 1VQKF 3IR9A 3NVIB 3E1YA 3CCSF 3HAXD 1Q7YH 5HY2A 3LWQC 1RA4A 3CPQA 2OZBA 5A2QM 1K73H 3SIVA 2F9ZC 3E20B 4BY9D 2I6DA 2BO1A 2VGNA 1PXWA 1QVFF 3J80M 3HJWC 5GINC 5HY1A 3VMFB 5EO3A 2WALA 2FGYA 3OBWA 5FJ4C 2GLZA 3LWVC 2QA4F 1IPAA 1YIJF 1VQ7F 1E7KA 1W42A 1RLGA 1DT9A 3PLAC 2JNBA 4BVTA 5GIOC 1W41A 1Q86H 5G4UC 1GO0A 1W2BF 3CC7F 3WXMB 1VQNF 1K8AH 2HVYD 3CCRF 1T0KB 3CC4F 5FLXM 1NJIH 1X52A 3CCVF 5HWEA 1SDSA 5G4VC 1VQMF 5IT9M 5EWRA 4EI9A 3O85A 3N4ZA 3CMAF 1X7OA 3RA6A 3AGKA 3J81M 1VQ8F 1X7PA 1ZWZA 3I56F 1CN7A 3LWOC 2FC3A 1GZ0A 3GYQA 5GAPK 3CCMF 3CPWF 3SIUA 4BW0B 2KG4A 4NUTA 1M90H 3N4YA 1Q82H 3CCLF 4XCQA 5HXZA 4X3LA 3NVKE 2KTUA 3NK6A 3LFOA 4NQ3A 4BVSA 1YJNF 2OHWA 3CCQF 3V3TA 1YI2F 1W40A 1Q81H 3G6EF 3OW2F 5GANK 3OBYA 2LBWA 4X3MA 2KTVA 1VQ6F 1VQ5F 4LCKA 3CG6A 1M1KH 3CXCF 2VGMA 1K9MH 3LWPC 3I55F 1YHQF 3CMEF 5HY0A 3G71F 1KC8H 4BVQA 3J7AR 3JCMM 3CCEF 4EI7A 1GO1A 1VQ4F 2OTLF 1H7MA 4EI8A 1QVGF 2AIFA 1YJWF 4BVRA 1KQSF 1JJ2F 1XBIA 3FFMA 3V7EA 3V7QA 1N8RH 1CK2A 4C4WC 3CC2F 2ALEA 3NK7A 3MCAB 1VQPF 3CCUF 2OTJF 1YITF 2QI2A 3CCJF 3G4SF 3ON1A 1VQOF 5HXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM M;  3VI6 A;  4TZZ A;  2QEX F;  2LBX A;  1KD1 H;  3NMU C;  1VQ9 F;  1VQL F;  3CD6 F;  5DCV A;  3LWR C;  3RA5 A;  5GIP C;  2CZW A;  1YJ9 F;  3PAF A;  1W3E X;  1NMU B;  1S72 F;  1VQK F;  3IR9 A;  3NVI B;  3E1Y A;  3CCS F;  3HAX D;  1Q7Y H;  3LWQ C;  1RA4 A;  3CPQ A;  2OZB A;  5A2Q M;  1K73 H;  3SIV A;  3E20 B;  4BY9 D;  2I6D A;  2BO1 A;  2VGN A;  1PXW A;  1QVF F;  3J80 M;  3HJW C;  5GIN C;  3VMF B;  5EO3 A;  2WAL A;  3OBW A;  5FJ4 C;  3LWV C;  2QA4 F;  1IPA A;  1YIJ F;  1VQ7 F;  1E7K A;  1W42 A;  1RLG A;  1DT9 A;  3PLA C;  2JNB A;  5GIO C;  1W41 A;  1Q86 H;  5G4U C;  1GO0 A;  1W2B F;  3CC7 F;  3WXM B;  1VQN F;  1K8A H;  2HVY D;  3CCR F;  1T0K B;  3CC4 F;  5FLX M;  1NJI H;  1X52 A;  3CCV F;  1SDS A;  5G4V C;  1VQM F;  5IT9 M;  5EWR A;  3O85 A;  3N4Z A;  3CMA F;  1X7O A;  3RA6 A;  3AGK A;  3J81 M;  1VQ8 F;  1X7P A;  1ZWZ A;  3I56 F;  1CN7 A;  3LWO C;  2FC3 A;  1GZ0 A;  3GYQ A;  5GAP K;  3CCM F;  3CPW F;  3SIU A;  4BW0 B;  2KG4 A;  4NUT A;  1M90 H;  3N4Y A;  1Q82 H;  3CCL F;  4X3L A;  3NVK E;  2KTU A;  3NK6 A;  3LFO A;  1YJN F;  2OHW A;  3CCQ F;  1YI2 F;  1W40 A;  1Q81 H;  3G6E F;  3OW2 F;  5GAN K;  3OBY A;  2LBW A;  4X3M A;  2KTV A;  1VQ6 F;  1VQ5 F;  4LCK A;  3CG6 A;  1M1K H;  3CXC F;  2VGM A;  1K9M H;  3LWP C;  3I55 F;  1YHQ F;  3CME F;  3G71 F;  1KC8 H;  3J7A R;  3JCM M;  3CCE F;  1GO1 A;  1VQ4 F;  2OTL F;  1H7M A;  1QVG F;  2AIF A;  1YJW F;  1KQS F;  1JJ2 F;  1XBI A;  3FFM A;  3V7E A;  3V7Q A;  1N8R H;  1CK2 A;  4C4W C;  3CC2 F;  2ALE A;  3NK7 A;  3MCA B;  1VQP F;  3CCU F;  2OTJ F;  1YIT F;  2QI2 A;  3CCJ F;  3G4S F;  3ON1 A;  1VQO F; 
#chains in the Genus database with same CATH topology
 4I4T B;  3VI6 A;  4TZZ A;  1KNJ A;  5DCV A;  3HKE B;  3M1X A;  1RQ2 A;  2H8C A;  3D00 A;  5LA6 B;  2CZW A;  5CB4 A;  3L7Q A;  1W3E X;  4IIJ A;  1S72 F;  3IR9 A;  4ZOL A;  3E1Y A;  5AVM A;  3RYF B;  3LWQ C;  1RA4 A;  1W5B A;  1TUB A;  1VK3 A;  2BO1 A;  3JAS A;  5HY1 A;  5JVD A;  5FJ4 C;  1IPA A;  1XV2 A;  1VQ7 F;  4I4T A;  3HKE A;  3CC4 F;  5FLX M;  1X52 A;  5HWE A;  4O4L A;  4X1I A;  3RYF A;  4X1K B;  4EI9 A;  4WBN B;  3N4Z A;  2CWJ A;  1JFF B;  2YYE A;  3J81 M;  2DT4 A;  1Z5W A;  4LNU B;  1X7P A;  1FNK A;  2DYY A;  4O4H A;  2N48 A;  5CA0 B;  3IMP A;  5GAP K;  3LME A;  4PWT A;  3CPW F;  5EYP A;  5FNV B;  1W59 A;  3N4Y A;  4XCQ A;  4NWO B;  3NK6 A;  5EIB D;  3ZP4 A;  3RYI A;  3WPX A;  3KE1 A;  2CVL A;  2CHS A;  3F6M A;  3FPI A;  2L26 A;  3MBM A;  5EB1 B;  2V9Y A;  5LXT A;  4WBN A;  3P10 A;  4B62 A;  5C8Y B;  2EWC A;  1GX1 A;  2H6L A;  3K0T A;  3OBY A;  5GAN K;  4LNU A;  1J7H A;  2LBW A;  1R1M A;  4F6R A;  1OAP A;  1VQ6 F;  4ZHW A;  1VQ5 F;  3WPW A;  4LCK A;  1U43 A;  4U39 A;  1IV2 A;  3CXC F;  5ITZ B;  4G4W A;  1YHQ F;  4ZHV A;  5HP7 A;  5IYZ A;  4ERH A;  3RE3 A;  1U40 A;  3G71 F;  4M8I A;  1RLU A;  2G9I A;  4ZI7 B;  1GO1 A;  3WJR A;  5HXU A;  1QU9 A;  3P4E A;  4ZK7 A;  2OTL F;  4IHJ A;  2AIF A;  1YJW F;  4BT2 A;  3ELC A;  2CSL A;  3V4D A;  2AMT A;  2Z1U A;  3HKB B;  2R6R 1;  1T0A A;  4U3J B;  3I3F A;  3MCA B;  1H48 A;  2BTQ B;  5LP6 B;  4DXD A;  3CCU F;  2OTJ F;  1IV4 A;  3MDO A;  4R40 B;  5ITZ A;  2VAW A;  3FD5 A;  3Q8H A;  2IQQ A;  4G4Z A;  1VQO F;  3VOB A;  3QHD A;  1VH8 A;  1H47 A;  1SA0 A;  4ZI7 A;  1NQ3 A;  3NMU C;  5HY4 A;  1VQ9 F;  3ZP7 A;  3JAR B;  3TD5 A;  4G4Y A;  3RA5 A;  5GIP C;  5LP6 C;  3S0H A;  3LWR C;  3OON A;  1YJ9 F;  5BMV B;  5J2T B;  1NMU B;  2ZAU A;  1VQK F;  3CCS F;  3HAX D;  5HY2 A;  2OZB A;  5EB0 A;  4ZOL B;  1FSZ A;  2HS4 A;  3E20 B;  2I6D A;  4U3J A;  2VGN A;  3D01 A;  2ZVY A;  1OFU A;  2CHT A;  5EO3 A;  2ZOD A;  1RLG A;  5JVD B;  4O2A B;  3PLA C;  1YGY A;  5G4U C;  3CC7 F;  1VQN F;  4TV8 A;  3JAR A;  2MQE A;  2HX0 A;  5BMV A;  5MN6 A;  3S02 A;  5J2T A;  3HTN A;  3CCV F;  3M4S A;  1QAH A;  1VQM F;  2LCA A;  4O4L B;  2NMU A;  5KX5 A;  3O85 A;  4X1I B;  3ZO8 A;  3CMA F;  3RA6 A;  1VHA A;  3GHZ A;  3LDT A;  3VIU A;  5IJ0 A;  3N2K A;  3LWO C;  3EOR A;  2FC3 A;  1GZ0 A;  2VAM A;  3CCM F;  1X25 A;  3SIU A;  4O2A A;  4O4H B;  5HP8 A;  2KG4 A;  3F0F A;  3KIZ A;  1M90 H;  2BTU A;  1Q82 H;  5EYP B;  1CLI A;  5HXZ A;  3QUW A;  3VYS C;  1KNK A;  3RYC A;  3DDN A;  4O2B A;  3JAL B;  3WGN A;  2IG8 A;  3V3T A;  3RYI B;  1YI2 F;  2HP0 A;  3F0G A;  1W40 A;  3K12 A;  1Q81 H;  3UT5 A;  2Q1X A;  3G6E F;  3WGL A;  5LXT B;  3F0E A;  3ERN A;  3S03 A;  2Z1T A;  1U3P A;  3U0O A;  2KTV A;  4TUY B;  3DC2 A;  3KJK A;  4O4I B;  4F6R B;  3CG6 A;  5B8F A;  2VGM A;  1JY8 A;  3LWP C;  3HKD A;  1KC8 H;  4BVQ A;  3JAL A;  5IYZ B;  3WGK A;  3JCM M;  5JQG A;  1VQ4 F;  3CB2 A;  1H7M A;  3TD4 A;  5EZY A;  2RHJ A;  4IHJ B;  4BVR A;  4EB6 A;  1JJ2 F;  4I50 A;  3V7Q A;  3C8L A;  4C8E A;  2YXZ A;  4TUY A;  4O4I A;  1VQV A;  5LOV A;  1VQP F;  1YIT F;  3K14 A;  2Q1Y A;  2HRY A;  3S06 A;  1Q8R A;  3VOA A;  3JAM M;  2LBX A;  1XRG A;  1VQL F;  1SA0 B;  5EAZ A;  3PAF A;  4X1Y A;  1Q7Y H;  3CPQ A;  3SIV A;  3IKF A;  4YJ2 A;  4BY9 D;  4G4X A;  3ZOP A;  5GIN C;  2QTP A;  3C9T A;  5JCO A;  3D54 A;  3OBW A;  2GLZ A;  3LWV C;  5GON B;  1E7K A;  1W42 A;  1DT9 A;  4BVT A;  1UI9 A;  5GIO C;  1W41 A;  1ODE A;  2UYP A;  1W2B F;  3WXM B;  4I55 A;  4C8I A;  2HVY D;  4HNA B;  2H8E A;  4TV8 B;  3P0Z A;  1DBF A;  2Z1F A;  3MCQ A;  5EWR A;  1RQ7 A;  3HKC A;  2B33 A;  2OTM A;  3C9U A;  2HS3 A;  3KJJ A;  1X7O A;  3AGK A;  4TV9 B;  5KX5 B;  4ZHY B;  5CA1 A;  1XHO A;  5GON A;  3GYQ A;  5IJ0 B;  1W55 A;  2GZL A;  3N2K B;  4NUT A;  1FFX A;  3ESJ A;  3CCL F;  1W58 1;  4HNA A;  2IAF A;  4X3L A;  3S0Y A;  3CYP B;  4G4V A;  4RQO A;  4YJ3 A;  3VO8 A;  3VYT C;  3LFO A;  4NQ3 A;  2GVI A;  3WGJ A;  4B46 A;  3RYC B;  4O2B B;  3TD3 A;  2UYN A;  3JAK B;  4B5C A;  1JD1 A;  4DRX A;  3QTY A;  2HP0 B;  4TV9 A;  5KMG A;  3UT5 B;  4X3M A;  4BT3 A;  3M84 A;  2UYJ A;  3JVH A;  4BT6 A;  5EIB C;  4C81 A;  3N2G A;  3C9S A;  3CCE F;  4EI7 A;  3HKD B;  3VCZ A;  4BT7 A;  2AIZ P;  3JAK A;  1QVG F;  5JQG B;  3IEQ A;  1JN1 A;  1XBI A;  5EZY B;  3V7E A;  1YQN A;  3JAT B;  2BTO A;  4C4W C;  4EB6 B;  3IKE A;  4RHA A;  3VYU C;  4I50 B;  3NK7 A;  1QD9 A;  3JAW A;  1FNJ A;  5LOV B;  2QI2 A;  3VTI C;  3IEW A;  3G4S F;  3ON1 A;  3C9R A;  2QEX F;  4X20 B;  2RHH A;  1KD1 H;  5LA6 A;  3E22 B;  4G88 A;  3CD6 F;  3NVI B;  3HWU A;  3JAT A;  2HQS C;  4B45 A;  5A2Q M;  1K73 H;  2F9Z C;  4X1Y B;  1QVF F;  1PXW A;  3J80 M;  3HJW C;  2RB9 A;  4YJ2 B;  2UZH A;  3VMF B;  3WJQ A;  2WAL A;  2FGY A;  1ONI A;  2KGW A;  3WGM A;  2QA4 F;  4C82 A;  1YIJ F;  1W5A A;  3WJP A;  2VXY A;  2JNB A;  1Q86 H;  1GO0 A;  4X20 A;  1COM A;  1K8A H;  3E22 A;  2ZOV A;  2HRU A;  5JH7 B;  5J2U B;  4I55 B;  3CCR F;  1T0K B;  1NJI H;  4ZHQ B;  4X1K A;  3MQW A;  4BT4 A;  1SDS A;  5JCO C;  5G4V C;  5IT9 M;  1JFF A;  1U3L A;  2ZF8 A;  3F0D A;  5IJ9 B;  2K1S A;  3HKC B;  1TVK B;  5LYJ B;  2Z1E A;  1VQ8 F;  1W5E A;  1ZWZ A;  5CA0 A;  3I56 F;  1CN7 A;  3B6N A;  5FNV A;  2CW4 A;  3FD6 A;  4BW0 B;  5CA1 B;  2PHN A;  1IV3 A;  4C8G A;  5MN4 A;  2P6Y A;  2RHO A;  3BYQ A;  2PMP A;  2R75 1;  5JH7 A;  1FFX B;  3NVK E;  2KTU A;  3I7T A;  4O4J B;  5J2U A;  2I6R A;  2W8B C;  3R0P A;  3K2X A;  4KWE A;  2OHW A;  4BVS A;  4ZHQ A;  3CCQ F;  1YJN F;  4YJ3 B;  3T80 A;  5C8Y A;  5IJ9 A;  1W5F A;  4BT5 A;  3OW2 F;  1PF5 A;  2UYN B;  1TVK A;  5LYJ A;  4DRX B;  4FFB B;  5KMG B;  1M1K H;  2RHL A;  3S0W A;  1K9M H;  3I55 F;  3FBA A;  3CYQ A;  4O4J A;  3CME F;  2HP3 A;  5HY0 A;  3N2G B;  3RYH B;  2LBT A;  3J7A R;  5MN5 A;  4EI8 A;  2Z01 A;  3LYB A;  4E6E A;  5CB4 B;  4IIJ B;  1KQS F;  1W57 A;  3HKB A;  3FFM A;  1N8R H;  3GTZ A;  1CK2 A;  2ZVZ A;  3CC2 F;  4FFB A;  1TUB B;  5LP6 A;  2ALE A;  3JAS B;  1IV1 A;  1SZQ A;  3CCJ F;  1Z5V A;  3JAW B;  1UFY A;  3KHN A;  2VAP A;  2UYK A;  2HS0 A;  3RYH A; 
#chains in the Genus database with same CATH homology
 3JAM M;  3VI6 A;  4TZZ A;  2QEX F;  2LBX A;  1KD1 H;  3NMU C;  5HY4 A;  1VQ9 F;  1VQL F;  3CD6 F;  5DCV A;  3LWR C;  3RA5 A;  5GIP C;  3D00 A;  2CZW A;  1YJ9 F;  3PAF A;  1W3E X;  1NMU B;  1S72 F;  1VQK F;  3IR9 A;  3NVI B;  3E1Y A;  3CCS F;  3HAX D;  1Q7Y H;  5HY2 A;  3LWQ C;  1RA4 A;  3CPQ A;  2OZB A;  5A2Q M;  1K73 H;  3SIV A;  2F9Z C;  3E20 B;  4BY9 D;  2I6D A;  2BO1 A;  2VGN A;  1PXW A;  1QVF F;  3J80 M;  3HJW C;  5GIN C;  5HY1 A;  3VMF B;  5EO3 A;  2WAL A;  2FGY A;  3OBW A;  5FJ4 C;  2GLZ A;  3LWV C;  2QA4 F;  1IPA A;  1YIJ F;  1VQ7 F;  1E7K A;  1W42 A;  1RLG A;  1DT9 A;  3PLA C;  2JNB A;  4BVT A;  5GIO C;  1W41 A;  1Q86 H;  5G4U C;  1GO0 A;  1W2B F;  3CC7 F;  3WXM B;  1VQN F;  1K8A H;  2HVY D;  3CCR F;  1T0K B;  3CC4 F;  5FLX M;  1NJI H;  1X52 A;  3CCV F;  5HWE A;  1SDS A;  5G4V C;  1VQM F;  5IT9 M;  5EWR A;  4EI9 A;  3O85 A;  3N4Z A;  3CMA F;  1X7O A;  3RA6 A;  3AGK A;  3J81 M;  1VQ8 F;  1X7P A;  1ZWZ A;  3I56 F;  1CN7 A;  3LWO C;  2FC3 A;  1GZ0 A;  3GYQ A;  5GAP K;  3CCM F;  3CPW F;  3SIU A;  4BW0 B;  2KG4 A;  4NUT A;  1M90 H;  3N4Y A;  1Q82 H;  3CCL F;  4XCQ A;  5HXZ A;  4X3L A;  3NVK E;  2KTU A;  3NK6 A;  3LFO A;  4NQ3 A;  4BVS A;  1YJN F;  2OHW A;  3CCQ F;  3V3T A;  1YI2 F;  1W40 A;  1Q81 H;  3G6E F;  3OW2 F;  5GAN K;  3OBY A;  2LBW A;  4X3M A;  2KTV A;  1VQ6 F;  1VQ5 F;  4LCK A;  3CG6 A;  1M1K H;  3CXC F;  2VGM A;  1K9M H;  3LWP C;  3I55 F;  1YHQ F;  3CME F;  5HY0 A;  3G71 F;  1KC8 H;  4BVQ A;  3J7A R;  3JCM M;  3CCE F;  4EI7 A;  1GO1 A;  1VQ4 F;  2OTL F;  1H7M A;  4EI8 A;  1QVG F;  2AIF A;  1YJW F;  4BVR A;  1KQS F;  1JJ2 F;  1XBI A;  3FFM A;  3V7E A;  3V7Q A;  1N8R H;  1CK2 A;  4C4W C;  3CC2 F;  2ALE A;  3NK7 A;  3MCA B;  1VQP F;  3CCU F;  2OTJ F;  1YIT F;  2QI2 A;  3CCJ F;  3G4S F;  3ON1 A;  1VQO F;  5HXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...