1YJ9F

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yj9F00
1VQPF 1RLGA 1YI2F 3OW2F 3CXCF 2I6DA 1CN7A 5FJ4C 4NUTA 3CCUF 5FLXM 4BW0B 3LWOC 2FC3A 1VQOF 3JCMM 3I56F 5EO3A 1CK2A 1NJIH 3SIUA 3OBWA 5EWRA 3VMFB 3E1YA 4BY9D 2AIFA 2KTVA 1GZ0A 2CZWA 2OTLF 2OHWA 5GIPC 5IT9M 3CG6A 3CCMF 2VGNA 3CPWF 1VQ8F 1PXWA 1YITF 3G4SF 3HJWC 1YHQF 3CMAF 3NMUC 2OTJF 5GIOC 3RA5A 3NVIB 3RA6A 2JNBA 3CCEF 3LFOA 1W2BF 3E20B 3G71F 3CPQA 3G6EF 3CCQF 3JAMM 1Q7YH 1SDSA 1E7KA 3PLAC 2BO1A 1VQMF 3CC2F 2LBXA 1IPAA 2QEXF 1VQ7F 3FFMA 2KTUA 2QI2A 1W42A 3NK6A 5G4VC 1H7MA 3LWQC 3CCSF 3OBYA 3HAXD 3CC4F 3O85A 1VQNF 2ALEA 3CCRF 3AGKA 4X3MA 1M90H 1QVGF 1W41A 1VQ9F 1K9MH 3N4ZA 1N8RH 1W40A 3CMEF 1ZWZA 3ON1A 3IR9A 5GAPK 2QA4F 1Q82H 1KQSF 3CD6F 4TZZA 3LWRC 3V7QA 1XBIA 1VQLF 2HVYD 1K8AH 1NMUB 1K73H 1VQ5F 3LWVC 3CC7F 1QVFF 3CCVF 1M1KH 1KC8H 1T0KB 3J81M 1X7OA 1W3EX 1KD1H 3SIVA 1YIJF 5A2QM 3NVKE 1YJWF 1GO0A 3MCAB 5GINC 1VQ4F 4C4WC 1X52A 1S72F 3CCLF 1VQ6F 1JJ2F 1X7PA 2WALA 5G4UC 1Q86H 2LBWA 1RA4A 3J80M 3J7AR 1GO1A 1Q81H 3N4YA 3GYQA 1YJNF 3VI6A 3LWPC 2KG4A 2OZBA 4LCKA 3NK7A 3WXMB 3PAFA 4X3LA 5DCVA 1VQKF 3I55F 5GANK 2VGMA 1YJ9F 1DT9A 3CCJF 3V7EA
chains in the Genus database with same CATH superfamily
3VCZA 3ZOPA 4IIJA 4ERHA 4O4HA 5MN4A 2CW4A 2I6DA 3WPWA 3CCUF 4G4XA 5CA1B 3WPXA 4O4JB 5CA0A 2UYPA 3E22B 3TD5A 3M84A 1IV4A 3F0EA 3IMPA 3F0GA 3D00A 3FBAA 2VAWA 3OBWA 2H6LA 3HKCB 5FNVA 2AIFA 1W581 4ZHVA 2HS0A 3CG6A 1IV3A 3GTZA 3HKEB 5KMGB 2CWJA 3HJWC 3RYIB 1YHQF 3NMUC 2H8EA 5CA1A 5EB1B 5EB0A 3F0FA 3CPQA 2W8BC 3E22A 5MN5A 4E6EA 3JAMM 1Q7YH 4O2BB 2PMPA 3KJKA 3PLAC 3P0ZA 2LBXA 3KHNA 2QEXF 3FFMA 5LYJB 3CB2A 4EI7A 1W42A 3OONA 3ZO8A 3LWQC 4YJ3B 3HKEA 4ZHQA 5KMGA 5J2TB 4O4LA 4FFBA 4X1KB 4X1IB 5GONB 3P4EA 2VAPA 3KE1A 4WBNA 1M90H 5EZYA 3FPIA 1Q8RA 5C8YA 4ZI7B 5CA0B 1Q82H 3IR9A 3VTIC 4O4IA 5CB4A 4TZZA 3V7QA 2HVYD 1JFFA 5LOVB 5HY4A 4X20B 2RHOA 5FNVB 4YJ3A 2ZVZA 3HTNA 4U3JB 5A2QM 3RYFA 3VYSC 5IJ0B 3VYTC 4C82A 1GO0A 1W5EA 4C4WC 3KJJA 3RYIA 1YQNA 5G4UC 4ZOLA 4TV8B 4EB6A 3CYQA 5JQGA 5HP8A 3K14A 4O4IB 4NWOB 5CB4B 2Q1XA 3N4YA 2ZF8A 1TVKB 3GYQA 5EIBC 3N2KA 5BMVA 2OZBA 3PAFA 4X3LA 3VO8A 3C9UA 3EORA 1VQKF 1GX1A 4U3JA 3ZP4A 1XRGA 4BVTA 1VQPF 1SA0B 5GONA 2NMUA 1YI2F 3CXCF 2FGYA 3F0DA 1W5BA 3L7QA 4ZOLB 2G9IA 4BW0B 3LWOC 2AMTA 5AVMA 4I55A 1PF5A 2FC3A 1OAPA 1QAHA 5KX5B 1KNJA 3JCMM 3I56F 1JD1A 1IV1A 1JFFB 3S0YA 4X20A 5GIPC 5IT9M 3IEQA 4G4VA 3RYFB 1PXWA 3TD3A 1YITF 4BT2A 5GIOC 3RA5A 3IEWA 3RA6A 2JNBA 3LFOA 3DC2A 1W2BF 4R40B 3G71F 1SZQA 4O2BA 3WJQA 2V9YA 1JY8A 2BO1A 2Z1EA 1VQMF 3CC2F 2OTMA 1W55A 3JAKB 1U3LA 1XV2A 2KTUA 1KNKA 5LXTA 3N2KB 5BMVB 3K12A 4RHAA 4EI8A 4YJ2B 2F9ZC 4X1IA 3CCSF 2Z01A 3S06A 3MDOA 3IKEA 3WGKA 1SA0A 2ALEA 5EAZA 1JN1A 3AGKA 1FFXA 3N2GB 2I6RA 1U43A 3BYQA 1VQ9F 1ODEA 3JARB 4BT4A 1K9MH 2HRUA 3JALA 1W40A 3CD6F 5ITZA 3C9RA 4LNUB 4NQ3A 5J2UA 5B8FA 3JAKA 1VQLF 3WJRA 2CSLA 5LOVA 3LWVC 3CCVF 3QTYA 4IHJB 5EIBD 3ELCA 1QD9A 1W3EX 5IJ0A 3RYCB 5JVDA 2IAFA 2HQSC 4G4YA 3MCAB 2LBTA 2YXZA 1S72F 4O2AA 3CCLF 1VQ6F 2CHTA 3JAWB 3UT5B 1X7PA 3C8LA 2GZLA 4O4JA 3V3TA 2H8CA 2L26A 1RA4A 3J80M 1GO1A 4C8IA 2R6R1 3VI6A 2KG4A 3LMEA 4BT6A 4ZHWA 3NK7A 5DCVA 4PWTA 2RHHA 2CHSA 4BVSA 1RLUA 3V7EA 3C9TA 2ZOVA 5HXZA 1RLGA 3OW2F 1U3PA 3N2GA 4NUTA 3WGJA 3WGMA 5FLXM 3DDNA 3C9SA 1IV2A 3HKDB 2DYYA 3CYPB 4TUYA 3JARA 1VQOF 4C81A 2GLZA 4B62A 3HKBA 5J2UB 1NJIH 3JASB 3VMFB 4BY9D 5IJ9A 1GZ0A 4IHJA 2OHWA 2HS4A 1T0AA 1FNKA 5HXUA 5HY0A 4BVRA 3CCMF 5JVDB 3CPWF 1VQ8F 4IIJB 3G4SF 3VYUC 3CMAF 5EZYB 4EI9A 2MQEA 2OTJF 4O2AB 3ERNA 2RB9A 1H47A 2RHLA 3I3FA 1ONIA 5C8YB 3D01A 1OFUA 4TUYB 4I4TA 1RQ2A 3RYHA 1VQ7F 3ZP7A 2IQQA 5IJ9B 4BT7A 1R1MA 3HKCA 1H7MA 2HP0A 2ZAUA 3GHZA 2LCAA 5HP7A 3MQWA 2HS3A 2CVLA 3HAXD 3CC4F 3S02A 1VQNF 2HP3A 3HWUA 1VK3A 4X3MA 4BT3A 5IYZA 1QVGF 3VOAA 2RHJA 3FD5A 3LDTA 4HNAA 3U0OA 1ZWZA 1KQSF 4KWEA 3RYHB 1XBIA 4RQOA 3HKBB 1K8AH 1K73H 1VQ5F 1VH8A 2UZHA 3M4SA 3CC7F 3JVHA 1QVFF 4I50A 1CLIA 1KC8H 2ZODA 3ESJA 1KD1H 3SIVA 5LP6C 3K0TA 3MBMA 1YJWF 2Z1FA 4FFBB 5EYPA 1X52A 3K2XA 3R0PA 4XCQA 3VIUA 1JJ2F 4U39A 2WALA 5LA6A 5KX5A 4ZI7A 3B6NA 2UYNA 4F6RA 3IKFA 4G4ZA 2AIZP 1YJNF 3LWPC 3D54A 4I50B 3WXMB 3S03A 5JH7B 1TUBA 3I55F 5GANK 2HP0B 2VGMA 1YJ9F 1DT9A 2P6YA 1X25A 4X1YA 3WGNA 3CCJF 2HRYA 1Z5WA 1CN7A 2VAMA 5FJ4C 1W5AA 5LA6B 3HKDA 3QHDA 3FD6A 1W57A 1FNJA 2UYNB 3TD4A 5JQGB 2BTUA 5JCOA 5EO3A 1CK2A 1TVKA 3SIUA 5LXTB 4G88A 5EWRA 3P10A 3E1YA 2KTVA 3JATA 2CZWA 2OTLF 4G4WA 2GVIA 4YJ2A 4TV9B 4DRXB 4C8GA 1FSZA 2VGNA 2N48A 1UI9A 3WGLA 3NVIB 3CCEF 1W59A 2IG8A 5MN6A 2ZVYA 2EWCA 4ZHYB 4DXDA 3KIZA 3E20B 2Z1TA 3G6EF 3VOBA 4I4TB 3CCQF 3JALB 4I55B 5ITZB 1SDSA 1Z5VA 1VQVA 4ZK7A 1UFYA 2UYKA 1E7KA 2QTPA 4F6RB 1YGYA 3I7TA 3WJPA 1IPAA 4B5CA 2QI2A 3JATB 5LYJA 1NQ3A 3NK6A 5G4VC 1H48A 5JH7A 4TV9A 3S0WA 4DRXA 1VHAA 3RYCA 3OBYA 2BTOA 3RE3A 4ZHQB 3O85A 4O4LB 4X1KA 5HY2A 3CCRF 5IYZB 3JAWA 3UT5A 4WBNB 1W41A 2VXYA 5LP6B 4HNAB 2DT4A 4BT5A 2PHNA 5HWEA 3N4ZA 4M8IA 1N8RH 2B33A 3CMEF 3ON1A 5GAPK 2QA4F 3LWRC 5JCOC 1NMUB 3T80A 2R751 1M1KH 1T0KB 2BTQB 1X7OA 3J81M 3MCQA 1YIJF 3NVKE 1W5FA 5GINC 1VQ4F 5EYPB 1XHOA 4C8EA 1DBFA 3F6MA 3S0HA 4O4HB 5LP6A 1FFXB 2HX0A 3QUWA 4B45A 1U40A 1Q86H 3LYBA 2LBWA 1COMA 3V4DA 3M1XA 4TV8A 2UYJA 3J7AR 4EB6B 2Q1YA 1QU9A 2KGWA 1Q81H 3JASA 3Q8HA 4LNUA 1J7HA 2K1SA 4LCKA 5HY1A 1TUBB 2YYEA 1RQ7A 4B46A 5J2TA 4X1YB 4BVQA 2Z1UA
chains in the Genus database with same CATH topology
4BVTA 5HXZA 1VQPF 1RLGA 1YI2F 3OW2F 3CXCF 2FGYA 2I6DA 1CN7A 5FJ4C 4NUTA 3CCUF 5FLXM 4BW0B 3LWOC 2FC3A 1VQOF 3JCMM 2GLZA 3I56F 5EO3A 1CK2A 3D00A 1NJIH 3SIUA 3OBWA 5EWRA 3VMFB 3E1YA 4BY9D 2AIFA 2KTVA 1GZ0A 2CZWA 2OTLF 2OHWA 5GIPC 5IT9M 5HY0A 5HXUA 3CG6A 4BVRA 3CCMF 2VGNA 3CPWF 1VQ8F 1PXWA 1YITF 3G4SF 3HJWC 1YHQF 3CMAF 4EI9A 3NMUC 2OTJF 5GIOC 3RA5A 3NVIB 3RA6A 2JNBA 3CCEF 3LFOA 1W2BF 3E20B 3G71F 3CPQA 3G6EF 3CCQF 3JAMM 1Q7YH 1SDSA 1E7KA 3PLAC 2BO1A 1VQMF 3CC2F 2LBXA 1IPAA 2QEXF 1VQ7F 3FFMA 2KTUA 4EI7A 2QI2A 1W42A 3NK6A 5G4VC 1H7MA 3LWQC 4EI8A 2F9ZC 3CCSF 3OBYA 3HAXD 3CC4F 3O85A 5HY2A 1VQNF 2ALEA 3CCRF 3AGKA 4X3MA 1M90H 1QVGF 1W41A 1VQ9F 5HWEA 1K9MH 3N4ZA 1N8RH 1W40A 3CMEF 1ZWZA 3ON1A 3IR9A 5GAPK 2QA4F 1Q82H 1KQSF 3CD6F 4NQ3A 4TZZA 3LWRC 3V7QA 1XBIA 1VQLF 2HVYD 1K8AH 1NMUB 1K73H 1VQ5F 3LWVC 3CC7F 1QVFF 3CCVF 5HY4A 1M1KH 1KC8H 1T0KB 3J81M 1X7OA 1W3EX 1KD1H 3SIVA 1YIJF 5A2QM 3NVKE 1YJWF 1GO0A 3MCAB 5GINC 1VQ4F 4C4WC 1X52A 1S72F 4XCQA 3CCLF 1VQ6F 1JJ2F 1X7PA 2WALA 5G4UC 1Q86H 3V3TA 2LBWA 1RA4A 3J80M 3J7AR 1GO1A 1Q81H 3N4YA 3GYQA 1YJNF 3VI6A 3LWPC 2KG4A 2OZBA 4LCKA 3NK7A 3WXMB 5HY1A 3PAFA 4X3LA 5DCVA 1VQKF 3I55F 5GANK 2VGMA 1YJ9F 1DT9A 3CCJF 4BVSA 3V7EA 4BVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP F;  1RLG A;  1YI2 F;  3OW2 F;  3CXC F;  2I6D A;  1CN7 A;  5FJ4 C;  4NUT A;  3CCU F;  5FLX M;  4BW0 B;  3LWO C;  2FC3 A;  1VQO F;  3JCM M;  3I56 F;  5EO3 A;  1CK2 A;  1NJI H;  3SIU A;  3OBW A;  5EWR A;  3VMF B;  3E1Y A;  4BY9 D;  2AIF A;  2KTV A;  1GZ0 A;  2CZW A;  2OTL F;  2OHW A;  5GIP C;  5IT9 M;  3CG6 A;  3CCM F;  2VGN A;  3CPW F;  1VQ8 F;  1PXW A;  1YIT F;  3G4S F;  3HJW C;  1YHQ F;  3CMA F;  3NMU C;  2OTJ F;  5GIO C;  3RA5 A;  3NVI B;  3RA6 A;  2JNB A;  3CCE F;  3LFO A;  1W2B F;  3E20 B;  3G71 F;  3CPQ A;  3G6E F;  3CCQ F;  3JAM M;  1Q7Y H;  1SDS A;  1E7K A;  3PLA C;  2BO1 A;  1VQM F;  3CC2 F;  2LBX A;  1IPA A;  2QEX F;  1VQ7 F;  3FFM A;  2KTU A;  2QI2 A;  1W42 A;  3NK6 A;  5G4V C;  1H7M A;  3LWQ C;  3CCS F;  3OBY A;  3HAX D;  3CC4 F;  3O85 A;  1VQN F;  2ALE A;  3CCR F;  3AGK A;  4X3M A;  1M90 H;  1QVG F;  1W41 A;  1VQ9 F;  1K9M H;  3N4Z A;  1N8R H;  1W40 A;  3CME F;  1ZWZ A;  3ON1 A;  3IR9 A;  5GAP K;  2QA4 F;  1Q82 H;  1KQS F;  3CD6 F;  4TZZ A;  3LWR C;  3V7Q A;  1XBI A;  1VQL F;  2HVY D;  1K8A H;  1NMU B;  1K73 H;  1VQ5 F;  3LWV C;  3CC7 F;  1QVF F;  3CCV F;  1M1K H;  1KC8 H;  1T0K B;  3J81 M;  1X7O A;  1W3E X;  1KD1 H;  3SIV A;  1YIJ F;  5A2Q M;  3NVK E;  1YJW F;  1GO0 A;  3MCA B;  5GIN C;  1VQ4 F;  4C4W C;  1X52 A;  1S72 F;  3CCL F;  1VQ6 F;  1JJ2 F;  1X7P A;  2WAL A;  5G4U C;  1Q86 H;  2LBW A;  1RA4 A;  3J80 M;  3J7A R;  1GO1 A;  1Q81 H;  3N4Y A;  3GYQ A;  1YJN F;  3VI6 A;  3LWP C;  2KG4 A;  2OZB A;  4LCK A;  3NK7 A;  3WXM B;  3PAF A;  4X3L A;  5DCV A;  1VQK F;  3I55 F;  5GAN K;  2VGM A;  1YJ9 F;  1DT9 A;  3CCJ F;  3V7E A; 
#chains in the Genus database with same CATH topology
 3VCZ A;  3ZOP A;  4IIJ A;  4ERH A;  4O4H A;  5MN4 A;  2CW4 A;  2I6D A;  3WPW A;  3CCU F;  4G4X A;  5CA1 B;  3WPX A;  4O4J B;  5CA0 A;  2UYP A;  3E22 B;  3TD5 A;  3M84 A;  1IV4 A;  3F0E A;  3IMP A;  3F0G A;  3D00 A;  3FBA A;  2VAW A;  3OBW A;  2H6L A;  3HKC B;  5FNV A;  2AIF A;  1W58 1;  4ZHV A;  2HS0 A;  3CG6 A;  1IV3 A;  3GTZ A;  3HKE B;  5KMG B;  2CWJ A;  3HJW C;  3RYI B;  1YHQ F;  3NMU C;  2H8E A;  5CA1 A;  5EB1 B;  5EB0 A;  3F0F A;  3CPQ A;  2W8B C;  3E22 A;  5MN5 A;  4E6E A;  3JAM M;  1Q7Y H;  4O2B B;  2PMP A;  3KJK A;  3PLA C;  3P0Z A;  2LBX A;  3KHN A;  2QEX F;  3FFM A;  5LYJ B;  3CB2 A;  4EI7 A;  1W42 A;  3OON A;  3ZO8 A;  3LWQ C;  4YJ3 B;  3HKE A;  4ZHQ A;  5KMG A;  5J2T B;  4O4L A;  4FFB A;  4X1K B;  4X1I B;  5GON B;  3P4E A;  2VAP A;  3KE1 A;  4WBN A;  1M90 H;  5EZY A;  3FPI A;  1Q8R A;  5C8Y A;  4ZI7 B;  5CA0 B;  1Q82 H;  3IR9 A;  3VTI C;  4O4I A;  5CB4 A;  4TZZ A;  3V7Q A;  2HVY D;  1JFF A;  5LOV B;  5HY4 A;  4X20 B;  2RHO A;  5FNV B;  4YJ3 A;  2ZVZ A;  3HTN A;  4U3J B;  5A2Q M;  3RYF A;  3VYS C;  5IJ0 B;  3VYT C;  4C82 A;  1GO0 A;  1W5E A;  4C4W C;  3KJJ A;  3RYI A;  1YQN A;  5G4U C;  4ZOL A;  4TV8 B;  4EB6 A;  3CYQ A;  5JQG A;  5HP8 A;  3K14 A;  4O4I B;  4NWO B;  5CB4 B;  2Q1X A;  3N4Y A;  2ZF8 A;  1TVK B;  3GYQ A;  5EIB C;  3N2K A;  5BMV A;  2OZB A;  3PAF A;  4X3L A;  3VO8 A;  3C9U A;  3EOR A;  1VQK F;  1GX1 A;  4U3J A;  3ZP4 A;  1XRG A;  4BVT A;  1VQP F;  1SA0 B;  5GON A;  2NMU A;  1YI2 F;  3CXC F;  2FGY A;  3F0D A;  1W5B A;  3L7Q A;  4ZOL B;  2G9I A;  4BW0 B;  3LWO C;  2AMT A;  5AVM A;  4I55 A;  1PF5 A;  2FC3 A;  1OAP A;  1QAH A;  5KX5 B;  1KNJ A;  3JCM M;  3I56 F;  1JD1 A;  1IV1 A;  1JFF B;  3S0Y A;  4X20 A;  5GIP C;  5IT9 M;  3IEQ A;  4G4V A;  3RYF B;  1PXW A;  3TD3 A;  1YIT F;  4BT2 A;  5GIO C;  3RA5 A;  3IEW A;  3RA6 A;  2JNB A;  3LFO A;  3DC2 A;  1W2B F;  4R40 B;  3G71 F;  1SZQ A;  4O2B A;  3WJQ A;  2V9Y A;  1JY8 A;  2BO1 A;  2Z1E A;  1VQM F;  3CC2 F;  2OTM A;  1W55 A;  3JAK B;  1U3L A;  1XV2 A;  2KTU A;  1KNK A;  5LXT A;  3N2K B;  5BMV B;  3K12 A;  4RHA A;  4EI8 A;  4YJ2 B;  2F9Z C;  4X1I A;  3CCS F;  2Z01 A;  3S06 A;  3MDO A;  3IKE A;  3WGK A;  1SA0 A;  2ALE A;  5EAZ A;  1JN1 A;  3AGK A;  1FFX A;  3N2G B;  2I6R A;  1U43 A;  3BYQ A;  1VQ9 F;  1ODE A;  3JAR B;  4BT4 A;  1K9M H;  2HRU A;  3JAL A;  1W40 A;  3CD6 F;  5ITZ A;  3C9R A;  4LNU B;  4NQ3 A;  5J2U A;  5B8F A;  3JAK A;  1VQL F;  3WJR A;  2CSL A;  5LOV A;  3LWV C;  3CCV F;  3QTY A;  4IHJ B;  5EIB D;  3ELC A;  1QD9 A;  1W3E X;  5IJ0 A;  3RYC B;  5JVD A;  2IAF A;  2HQS C;  4G4Y A;  3MCA B;  2LBT A;  2YXZ A;  1S72 F;  4O2A A;  3CCL F;  1VQ6 F;  2CHT A;  3JAW B;  3UT5 B;  1X7P A;  3C8L A;  2GZL A;  4O4J A;  3V3T A;  2H8C A;  2L26 A;  1RA4 A;  3J80 M;  1GO1 A;  4C8I A;  2R6R 1;  3VI6 A;  2KG4 A;  3LME A;  4BT6 A;  4ZHW A;  3NK7 A;  5DCV A;  4PWT A;  2RHH A;  2CHS A;  4BVS A;  1RLU A;  3V7E A;  3C9T A;  2ZOV A;  5HXZ A;  1RLG A;  3OW2 F;  1U3P A;  3N2G A;  4NUT A;  3WGJ A;  3WGM A;  5FLX M;  3DDN A;  3C9S A;  1IV2 A;  3HKD B;  2DYY A;  3CYP B;  4TUY A;  3JAR A;  1VQO F;  4C81 A;  2GLZ A;  4B62 A;  3HKB A;  5J2U B;  1NJI H;  3JAS B;  3VMF B;  4BY9 D;  5IJ9 A;  1GZ0 A;  4IHJ A;  2OHW A;  2HS4 A;  1T0A A;  1FNK A;  5HXU A;  5HY0 A;  4BVR A;  3CCM F;  5JVD B;  3CPW F;  1VQ8 F;  4IIJ B;  3G4S F;  3VYU C;  3CMA F;  5EZY B;  4EI9 A;  2MQE A;  2OTJ F;  4O2A B;  3ERN A;  2RB9 A;  1H47 A;  2RHL A;  3I3F A;  1ONI A;  5C8Y B;  3D01 A;  1OFU A;  4TUY B;  4I4T A;  1RQ2 A;  3RYH A;  1VQ7 F;  3ZP7 A;  2IQQ A;  5IJ9 B;  4BT7 A;  1R1M A;  3HKC A;  1H7M A;  2HP0 A;  2ZAU A;  3GHZ A;  2LCA A;  5HP7 A;  3MQW A;  2HS3 A;  2CVL A;  3HAX D;  3CC4 F;  3S02 A;  1VQN F;  2HP3 A;  3HWU A;  1VK3 A;  4X3M A;  4BT3 A;  5IYZ A;  1QVG F;  3VOA A;  2RHJ A;  3FD5 A;  3LDT A;  4HNA A;  3U0O A;  1ZWZ A;  1KQS F;  4KWE A;  3RYH B;  1XBI A;  4RQO A;  3HKB B;  1K8A H;  1K73 H;  1VQ5 F;  1VH8 A;  2UZH A;  3M4S A;  3CC7 F;  3JVH A;  1QVF F;  4I50 A;  1CLI A;  1KC8 H;  2ZOD A;  3ESJ A;  1KD1 H;  3SIV A;  5LP6 C;  3K0T A;  3MBM A;  1YJW F;  2Z1F A;  4FFB B;  5EYP A;  1X52 A;  3K2X A;  3R0P A;  4XCQ A;  3VIU A;  1JJ2 F;  4U39 A;  2WAL A;  5LA6 A;  5KX5 A;  4ZI7 A;  3B6N A;  2UYN A;  4F6R A;  3IKF A;  4G4Z A;  2AIZ P;  1YJN F;  3LWP C;  3D54 A;  4I50 B;  3WXM B;  3S03 A;  5JH7 B;  1TUB A;  3I55 F;  5GAN K;  2HP0 B;  2VGM A;  1YJ9 F;  1DT9 A;  2P6Y A;  1X25 A;  4X1Y A;  3WGN A;  3CCJ F;  2HRY A;  1Z5W A;  1CN7 A;  2VAM A;  5FJ4 C;  1W5A A;  5LA6 B;  3HKD A;  3QHD A;  3FD6 A;  1W57 A;  1FNJ A;  2UYN B;  3TD4 A;  5JQG B;  2BTU A;  5JCO A;  5EO3 A;  1CK2 A;  1TVK A;  3SIU A;  5LXT B;  4G88 A;  5EWR A;  3P10 A;  3E1Y A;  2KTV A;  3JAT A;  2CZW A;  2OTL F;  4G4W A;  2GVI A;  4YJ2 A;  4TV9 B;  4DRX B;  4C8G A;  1FSZ A;  2VGN A;  2N48 A;  1UI9 A;  3WGL A;  3NVI B;  3CCE F;  1W59 A;  2IG8 A;  5MN6 A;  2ZVY A;  2EWC A;  4ZHY B;  4DXD A;  3KIZ A;  3E20 B;  2Z1T A;  3G6E F;  3VOB A;  4I4T B;  3CCQ F;  3JAL B;  4I55 B;  5ITZ B;  1SDS A;  1Z5V A;  1VQV A;  4ZK7 A;  1UFY A;  2UYK A;  1E7K A;  2QTP A;  4F6R B;  1YGY A;  3I7T A;  3WJP A;  1IPA A;  4B5C A;  2QI2 A;  3JAT B;  5LYJ A;  1NQ3 A;  3NK6 A;  5G4V C;  1H48 A;  5JH7 A;  4TV9 A;  3S0W A;  4DRX A;  1VHA A;  3RYC A;  3OBY A;  2BTO A;  3RE3 A;  4ZHQ B;  3O85 A;  4O4L B;  4X1K A;  5HY2 A;  3CCR F;  5IYZ B;  3JAW A;  3UT5 A;  4WBN B;  1W41 A;  2VXY A;  5LP6 B;  4HNA B;  2DT4 A;  4BT5 A;  2PHN A;  5HWE A;  3N4Z A;  4M8I A;  1N8R H;  2B33 A;  3CME F;  3ON1 A;  5GAP K;  2QA4 F;  3LWR C;  5JCO C;  1NMU B;  3T80 A;  2R75 1;  1M1K H;  1T0K B;  2BTQ B;  1X7O A;  3J81 M;  3MCQ A;  1YIJ F;  3NVK E;  1W5F A;  5GIN C;  1VQ4 F;  5EYP B;  1XHO A;  4C8E A;  1DBF A;  3F6M A;  3S0H A;  4O4H B;  5LP6 A;  1FFX B;  2HX0 A;  3QUW A;  4B45 A;  1U40 A;  1Q86 H;  3LYB A;  2LBW A;  1COM A;  3V4D A;  3M1X A;  4TV8 A;  2UYJ A;  3J7A R;  4EB6 B;  2Q1Y A;  1QU9 A;  2KGW A;  1Q81 H;  3JAS A;  3Q8H A;  4LNU A;  1J7H A;  2K1S A;  4LCK A;  5HY1 A;  1TUB B;  2YYE A;  1RQ7 A;  4B46 A;  5J2T A;  4X1Y B;  4BVQ A;  2Z1U A; 
#chains in the Genus database with same CATH homology
 4BVT A;  5HXZ A;  1VQP F;  1RLG A;  1YI2 F;  3OW2 F;  3CXC F;  2FGY A;  2I6D A;  1CN7 A;  5FJ4 C;  4NUT A;  3CCU F;  5FLX M;  4BW0 B;  3LWO C;  2FC3 A;  1VQO F;  3JCM M;  2GLZ A;  3I56 F;  5EO3 A;  1CK2 A;  3D00 A;  1NJI H;  3SIU A;  3OBW A;  5EWR A;  3VMF B;  3E1Y A;  4BY9 D;  2AIF A;  2KTV A;  1GZ0 A;  2CZW A;  2OTL F;  2OHW A;  5GIP C;  5IT9 M;  5HY0 A;  5HXU A;  3CG6 A;  4BVR A;  3CCM F;  2VGN A;  3CPW F;  1VQ8 F;  1PXW A;  1YIT F;  3G4S F;  3HJW C;  1YHQ F;  3CMA F;  4EI9 A;  3NMU C;  2OTJ F;  5GIO C;  3RA5 A;  3NVI B;  3RA6 A;  2JNB A;  3CCE F;  3LFO A;  1W2B F;  3E20 B;  3G71 F;  3CPQ A;  3G6E F;  3CCQ F;  3JAM M;  1Q7Y H;  1SDS A;  1E7K A;  3PLA C;  2BO1 A;  1VQM F;  3CC2 F;  2LBX A;  1IPA A;  2QEX F;  1VQ7 F;  3FFM A;  2KTU A;  4EI7 A;  2QI2 A;  1W42 A;  3NK6 A;  5G4V C;  1H7M A;  3LWQ C;  4EI8 A;  2F9Z C;  3CCS F;  3OBY A;  3HAX D;  3CC4 F;  3O85 A;  5HY2 A;  1VQN F;  2ALE A;  3CCR F;  3AGK A;  4X3M A;  1M90 H;  1QVG F;  1W41 A;  1VQ9 F;  5HWE A;  1K9M H;  3N4Z A;  1N8R H;  1W40 A;  3CME F;  1ZWZ A;  3ON1 A;  3IR9 A;  5GAP K;  2QA4 F;  1Q82 H;  1KQS F;  3CD6 F;  4NQ3 A;  4TZZ A;  3LWR C;  3V7Q A;  1XBI A;  1VQL F;  2HVY D;  1K8A H;  1NMU B;  1K73 H;  1VQ5 F;  3LWV C;  3CC7 F;  1QVF F;  3CCV F;  5HY4 A;  1M1K H;  1KC8 H;  1T0K B;  3J81 M;  1X7O A;  1W3E X;  1KD1 H;  3SIV A;  1YIJ F;  5A2Q M;  3NVK E;  1YJW F;  1GO0 A;  3MCA B;  5GIN C;  1VQ4 F;  4C4W C;  1X52 A;  1S72 F;  4XCQ A;  3CCL F;  1VQ6 F;  1JJ2 F;  1X7P A;  2WAL A;  5G4U C;  1Q86 H;  3V3T A;  2LBW A;  1RA4 A;  3J80 M;  3J7A R;  1GO1 A;  1Q81 H;  3N4Y A;  3GYQ A;  1YJN F;  3VI6 A;  3LWP C;  2KG4 A;  2OZB A;  4LCK A;  3NK7 A;  3WXM B;  5HY1 A;  3PAF A;  4X3L A;  5DCV A;  1VQK F;  3I55 F;  5GAN K;  2VGM A;  1YJ9 F;  1DT9 A;  3CCJ F;  4BVS A;  3V7E A;  4BVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...