1YJ9F

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yj9F00
3I56F 3CC4F 3CPQA 1QVGF 1VQOF 5GANK 2QI2A 2HVYD 5IT9M 3CCLF 3V7QA 5EO3A 1YIJF 4X3LA 3CCQF 3J7AR 4C4WC 1Q81H 1Q86H 1NJIH 3NVKE 1H7MA 1GO0A 2OZBA 2CZWA 1PXWA 1DT9A 3CD6F 1X52A 3OW2F 3LWPC 3NK6A 3CMAF 3NVIB 1K8AH 1VQ8F 1YHQF 1YI2F 3LWOC 3CCVF 3RA6A 1VQLF 1X7PA 1N8RH 5G4VC 2QEXF 3V7EA 1W41A 3G4SF 3J81M 3OBYA 5FLXM 1GO1A 3LWVC 1YJ9F 1K9MH 2LBXA 1KD1H 1CK2A 2VGNA 1SDSA 3CXCF 4TZZA 3CMEF 3LFOA 3LWRC 5DCVA 1VQ5F 3CCRF 3E20B 3CG6A 1GZ0A 1VQKF 3CPWF 1VQ9F 3G6EF 2OTLF 1VQNF 3GYQA 3WXMB 1VQMF 2QA4F 1W42A 3CCUF 3I55F 3NK7A 1W2BF 1VQ6F 3CCEF 3JCMM 5GIPC 2KTUA 1T0KB 1XBIA 1YITF 1M90H 2ALEA 1ZWZA 1IPAA 3RA5A 3CC2F 1W40A 3PAFA 3MCAB 5G4UC 2WALA 1YJNF 2FC3A 3IR9A 3JAMM 1S72F 4NUTA 5GAPK 3N4YA 3VI6A 3FFMA 3AGKA 1JJ2F 3G71F 1M1KH 1RLGA 2BO1A 1YJWF 3N4ZA 2AIFA 1NMUB 3HAXD 2KG4A 1Q7YH 3NMUC 2LBWA 1X7OA 5FJ4C 2OHWA 3LWQC 3SIUA 4BY9D 3HJWC 1K73H 1QVFF 3PLAC 3J80M 3CCMF 1Q82H 2I6DA 3ON1A 3CCSF 1KQSF 1VQPF 1W3EX 5GINC 1RA4A 1VQ4F 2OTJF 3VMFB 3CCJF 3O85A 5GIOC 1VQ7F 3OBWA 3SIVA 2JNBA 2VGMA 4LCKA 5EWRA 4BW0B 2KTVA 3E1YA 1E7KA 1KC8H 5A2QM 4X3MA 1CN7A 3CC7F
chains in the Genus database with same CATH superfamily
5EAZA 3LDTA 3FD6A 1VH8A 4M8IA 1VHAA 4G4XA 3HKEA 1VQOF 3JAWB 4X1KA 3C9TA 3ELCA 3CB2A 5EO3A 5JQGB 1YIJF 3T80A 1FFXB 4TV9A 3ZO8A 1Q86H 4X1YB 5LYJA 3OONA 1GO0A 1JFFA 3KHNA 3S03A 1TVKA 1UFYA 1QAHA 1U40A 2BTQB 4R40B 2Z1EA 3WJRA 5IJ0B 1K8AH 2DT4A 2V9YA 4O4HB 3RA6A 4BT6A 3V7EA 5G4VC 2QEXF 2ZF8A 5BMVA 3J81M 2UZHA 5JCOC 1K9MH 3VCZA 3TD5A 2VGNA 4O2BB 4X1IB 5EZYA 4BT7A 2B33A 2YXZA 3VOBA 4DXDA 1IV3A 4DRXA 2I6RA 3WGJA 2RHJA 3ERNA 5CA1B 2QA4F 3P0ZA 5CA0B 4I4TB 4C81A 4IIJB 2ZAUA 2KTUA 1T0KB 2CW4A 1M90H 2ALEA 1ZWZA 4ZHVA 1W40A 5G4UC 2FC3A 3IEQA 4TUYB 4C82A 4HNAA 3C9UA 3IEWA 4NQ3A 3VI6A 1W581 2RB9A 2HS4A 5JCOA 3QUWA 5AVMA 2KG4A 2VAMA 3JASB 1Q7YH 1FSZA 3NMUC 5LP6C 1SA0A 3KIZA 1U3PA 2OHWA 3LWQC 3HJWC 2P6YA 1K73H 3JAKB 3CCMF 2HQSC 5ITZB 4F6RA 1VQVA 2I6DA 5J2TA 1KQSF 1U43A 1KNJA 1GX1A 1W3EX 5GINC 1TUBA 5EB0A 2NMUA 5IYZA 2Z1TA 3LYBA 2HRUA 3U0OA 5FNVB 2VGMA 2VAPA 3RYFB 3D54A 5CB4B 5EWRA 4RQOA 3E1YA 3DC2A 4O2AB 4ZOLB 2HX0A 1COMA 2CHSA 3E22A 3MBMA 3P4EA 5GONB 3CC4F 5HP7A 3CPQA 5J2UB 5LP6A 4IHJB 4YJ3B 4E6EA 3M1XA 3P10A 2EWCA 3HTNA 3CCQF 1XHOA 1W59A 1OFUA 3JALB 5JH7B 5KX5B 3JARB 1UI9A 2DYYA 1PF5A 2CZWA 3I7TA 5KMGA 3WPWA 3VYSC 1R1MA 3OW2F 4EI8A 4ZHQA 3IKEA 3NK6A 3CMAF 5MN6A 4RHAA 2UYNB 3CCVF 3ZP7A 3EORA 4FFBB 4EB6B 1W41A 5JVDA 5FLXM 3RYHA 5HWEA 1GO1A 5IJ9A 1SZQA 3WPXA 4PWTA 2H8EA 3CXCF 4TZZA 3LFOA 1VQ5F 3CCRF 4ZI7A 4X20A 4ERHA 1GZ0A 1VQKF 3IKFA 4WBNB 2OTLF 2HP3A 1IV4A 1Z5WA 2K1SA 1W42A 1TVKB 2CWJA 3RYIB 3CCEF 4C8EA 3CYQA 1U3LA 4G88A 3I3FA 3S0YA 3GTZA 1OAPA 1FNKA 2VAWA 3RA5A 3KJKA 3JAWA 5JQGA 5EIBD 1YJNF 3ZOPA 3L7QA 2BTUA 3IR9A 5LXTB 1FFXA 3K12A 5C8YA 4NUTA 4X1YA 5GAPK 1DBFA 2UYJA 2L26A 4LNUB 3N2KB 2GLZA 5LA6B 4BT4A 3AGKA 1JJ2F 3F0FA 2CSLA 1M1KH 2BO1A 1YJWF 1NMUB 3HAXD 3HKCB 4DRXB 3F0GA 5IJ0A 3MQWA 1W57A 1NQ3A 2KGWA 4XCQA 4O4HA 1YGYA 3ON1A 3VO8A 4O2BA 4X1IA 4ZK7A 3RYCB 1VQ4F 5LOVB 2OTJF 3V4DA 4ZHYB 5GIOC 3TD4A 1W5BA 1VQ7F 4I50B 1QD9A 2UYKA 3BYQA 3HKDA 3JATB 4BT2A 5CA1A 5CA0A 4I4TA 4O4IB 4IIJA 3C8LA 1KC8H 2IG8A 4BT3A 1CN7A 4BT5A 3N2GB 3I56F 4G4VA 3TD3A 4U39A 2Q1XA 1QVGF 5GANK 2QI2A 2HVYD 3CCLF 3V7QA 2AIZP 4X3LA 4EI7A 3J7AR 1W55A 4O4JA 2RHOA 3VYUC 3F0EA 1Q81H 3ZP4A 2RHHA 1NJIH 3NVKE 4BVSA 2OZBA 4NWOB 2QTPA 2RHLA 1DT9A 3FD5A 3JAKA 1X52A 3VOAA 3DDNA 3S0WA 4I55B 5ITZA 3LWPC 2HS0A 5EYPB 2HP0B 3KJJA 5HXUA 1YI2F 5HY0A 4BVRA 5HY4A 1VQLF 1X7PA 3UT5A 4G4WA 3G4SF 3OBYA 3LWVC 4TV8B 2ZVZA 2LBXA 1CK2A 1SDSA 3V3TA 3CMEF 4KWEA 3LWRC 3RYFA 5DCVA 5CB4A 5MN4A 3ESJA 3MCQA 4G4YA 3CPWF 3M84A 4YJ2B 3G6EF 2Z01A 3IMPA 4ZOLA 3K14A 3B6NA 4G4ZA 3CCUF 4O4LB 1W2BF 1JN1A 4C8IA 2Z1UA 5J2UA 1YITF 4IHJA 4YJ3A 4U3JB 3CC2F 2ZVYA 2UYPA 3MCAB 1XRGA 2VXYA 2PHNA 3HKEB 3JALA 1S72F 5JH7A 3HKBA 3JARA 3WGLA 4B46A 4X1KB 1Q8RA 4ZHWA 3FFMA 3KE1A 3G71F 4TV9B 2ZOVA 3N4ZA 2AIFA 2HRYA 1ONIA 5LYJB 2LBTA 1T0AA 2R751 1H47A 5FJ4C 1X7OA 3C9RA 2PMPA 1JFFB 4B62A 2CHTA 2YYEA 3FBAA 3PLAC 2UYNA 2N48A 4FFBA 4EB6A 3WJQA 5HP8A 4BVQA 1RA4A 2FGYA 1KNKA 3WJPA 2G9IA 1XV2A 5BMVB 5MN5A 3QHDA 3VMFB 3MDOA 3O85A 5C8YB 2GVIA 3OBWA 3SIVA 2JNBA 3D01A 5EZYB 4WBNA 3VIUA 3S06A 4LCKA 2IAFA 1CLIA 4BW0B 1J7HA 3RYIA 1E7KA 1QU9A 5EB1B 1FNJA 2MQEA 3D00A 5A2QM 5IT9M 3M4SA 1W5FA 2CVLA 5LXTA 4B45A 2LCAA 2AMTA 4LNUA 3N2KA 3FPIA 3WGMA 1X25A 5LA6A 3WGNA 4C4WC 4HNAB 2Z1FA 3HKCA 1H7MA 3HKDB 2F9ZC 1PXWA 3CD6F 5HXZA 5EIBC 3RE3A 1YQNA 3S02A 3NVIB 1SA0B 1VQ8F 3R0PA 1YHQF 3CYPB 4C8GA 3LWOC 3RYCA 1N8RH 5LOVA 3QTYA 4F6RB 1YJ9F 4TUYA 5J2TB 1VK3A 4I50A 1KD1H 1TUBB 3JATA 1W5EA 3VYTC 5IYZB 4BVTA 2HS3A 1JD1A 3E20B 3CG6A 3JVHA 4O4JB 5B8FA 4O4IA 1VQ9F 3JASA 3C9SA 3F6MA 1VQNF 3GYQA 3WXMB 1VQMF 1H48A 3I55F 3NK7A 3N2GA 1VQ6F 3JCMM 3GHZA 3VTIC 5GIPC 2IQQA 1XBIA 1IPAA 3PAFA 3E22B 2WALA 1RQ7A 2BTOA 3K2XA 3UT5B 3JAMM 2R6R1 5LP6B 1RLUA 3HWUA 1RQ2A 5FNVA 3N4YA 1IV1A 1RLGA 4O2AA 4I55A 5EYPA 2LBWA 2HP0A 1Z5VA 3SIUA 4BY9D 1QVFF 3J80M 5KMGB 5GONA 1ODEA 3Q8HA 4ZHQB 1IV2A 1Q82H 3CCSF 4TV8A 1VQPF 3WGKA 5HY2A 2W8BC 4EI9A 3LMEA 5JVDB 2OTMA 5IJ9B 3RYHB 3CCJF 1W5AA 2H8CA 2GZLA 4B5CA 5KX5A 3HKBB 3F0DA 4YJ2A 1JY8A 2ZODA 3S0HA 2Q1YA 2KTVA 4ZI7B 4O4LA 4X20B 5HY1A 4U3JA 4X3MA 2H6LA 3CC7F 3K0TA
chains in the Genus database with same CATH topology
3I56F 3CC4F 3CPQA 1QVGF 1VQOF 5GANK 2QI2A 2HVYD 5IT9M 3CCLF 3V7QA 5EO3A 1YIJF 4X3LA 4EI7A 3CCQF 3J7AR 4C4WC 1Q81H 1Q86H 1NJIH 3NVKE 1H7MA 4BVSA 1GO0A 2OZBA 2F9ZC 2CZWA 1PXWA 1DT9A 3CD6F 5HXZA 1X52A 3OW2F 4EI8A 3LWPC 3NK6A 3CMAF 3NVIB 1K8AH 1VQ8F 1YHQF 5HXUA 1YI2F 5HY0A 4BVRA 3LWOC 5HY4A 3RA6A 3CCVF 1VQLF 1X7PA 1N8RH 5G4VC 2QEXF 3V7EA 1W41A 3G4SF 3J81M 3OBYA 5FLXM 1GO1A 5HWEA 3LWVC 1YJ9F 1K9MH 2LBXA 1KD1H 1CK2A 2VGNA 1SDSA 3CXCF 3V3TA 4TZZA 3CMEF 3LFOA 3LWRC 5DCVA 4BVTA 1VQ5F 3CCRF 3E20B 3CG6A 1GZ0A 1VQKF 3CPWF 1VQ9F 3G6EF 2OTLF 1VQNF 3GYQA 3WXMB 1VQMF 2QA4F 1W42A 3CCUF 3I55F 3NK7A 1W2BF 1VQ6F 3CCEF 3JCMM 5GIPC 2KTUA 1T0KB 1XBIA 1YITF 1M90H 2ALEA 1ZWZA 1IPAA 3RA5A 3CC2F 1W40A 3PAFA 3MCAB 5G4UC 2WALA 1YJNF 2FC3A 3IR9A 3JAMM 1S72F 4NUTA 5GAPK 3N4YA 2GLZA 4NQ3A 3VI6A 3FFMA 3AGKA 1JJ2F 3G71F 1M1KH 1RLGA 2BO1A 1YJWF 3N4ZA 2AIFA 1NMUB 3HAXD 2KG4A 1Q7YH 3NMUC 2LBWA 1X7OA 5FJ4C 2OHWA 3LWQC 3SIUA 4BY9D 3HJWC 1K73H 1QVFF 3PLAC 3J80M 3CCMF 4XCQA 1Q82H 2I6DA 3ON1A 3CCSF 1KQSF 1VQPF 4BVQA 5HY2A 1W3EX 4EI9A 5GINC 1RA4A 2FGYA 1VQ4F 2OTJF 3VMFB 3CCJF 3O85A 5GIOC 1VQ7F 3OBWA 3SIVA 2JNBA 2VGMA 4LCKA 5EWRA 4BW0B 2KTVA 3E1YA 5HY1A 1E7KA 1KC8H 3D00A 5A2QM 4X3MA 1CN7A 3CC7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 F;  3CC4 F;  3CPQ A;  1QVG F;  1VQO F;  5GAN K;  2QI2 A;  2HVY D;  5IT9 M;  3CCL F;  3V7Q A;  5EO3 A;  1YIJ F;  4X3L A;  3CCQ F;  3J7A R;  4C4W C;  1Q81 H;  1Q86 H;  1NJI H;  3NVK E;  1H7M A;  1GO0 A;  2OZB A;  2CZW A;  1PXW A;  1DT9 A;  3CD6 F;  1X52 A;  3OW2 F;  3LWP C;  3NK6 A;  3CMA F;  3NVI B;  1K8A H;  1VQ8 F;  1YHQ F;  1YI2 F;  3LWO C;  3CCV F;  3RA6 A;  1VQL F;  1X7P A;  1N8R H;  5G4V C;  2QEX F;  3V7E A;  1W41 A;  3G4S F;  3J81 M;  3OBY A;  5FLX M;  1GO1 A;  3LWV C;  1YJ9 F;  1K9M H;  2LBX A;  1KD1 H;  1CK2 A;  2VGN A;  1SDS A;  3CXC F;  4TZZ A;  3CME F;  3LFO A;  3LWR C;  5DCV A;  1VQ5 F;  3CCR F;  3E20 B;  3CG6 A;  1GZ0 A;  1VQK F;  3CPW F;  1VQ9 F;  3G6E F;  2OTL F;  1VQN F;  3GYQ A;  3WXM B;  1VQM F;  2QA4 F;  1W42 A;  3CCU F;  3I55 F;  3NK7 A;  1W2B F;  1VQ6 F;  3CCE F;  3JCM M;  5GIP C;  2KTU A;  1T0K B;  1XBI A;  1YIT F;  1M90 H;  2ALE A;  1ZWZ A;  1IPA A;  3RA5 A;  3CC2 F;  1W40 A;  3PAF A;  3MCA B;  5G4U C;  2WAL A;  1YJN F;  2FC3 A;  3IR9 A;  3JAM M;  1S72 F;  4NUT A;  5GAP K;  3N4Y A;  3VI6 A;  3FFM A;  3AGK A;  1JJ2 F;  3G71 F;  1M1K H;  1RLG A;  2BO1 A;  1YJW F;  3N4Z A;  2AIF A;  1NMU B;  3HAX D;  2KG4 A;  1Q7Y H;  3NMU C;  2LBW A;  1X7O A;  5FJ4 C;  2OHW A;  3LWQ C;  3SIU A;  4BY9 D;  3HJW C;  1K73 H;  1QVF F;  3PLA C;  3J80 M;  3CCM F;  1Q82 H;  2I6D A;  3ON1 A;  3CCS F;  1KQS F;  1VQP F;  1W3E X;  5GIN C;  1RA4 A;  1VQ4 F;  2OTJ F;  3VMF B;  3CCJ F;  3O85 A;  5GIO C;  1VQ7 F;  3OBW A;  3SIV A;  2JNB A;  2VGM A;  4LCK A;  5EWR A;  4BW0 B;  2KTV A;  3E1Y A;  1E7K A;  1KC8 H;  5A2Q M;  4X3M A;  1CN7 A;  3CC7 F; 
#chains in the Genus database with same CATH topology
 5EAZ A;  3LDT A;  3FD6 A;  1VH8 A;  4M8I A;  1VHA A;  4G4X A;  3HKE A;  1VQO F;  3JAW B;  4X1K A;  3C9T A;  3ELC A;  3CB2 A;  5EO3 A;  5JQG B;  1YIJ F;  3T80 A;  1FFX B;  4TV9 A;  3ZO8 A;  1Q86 H;  4X1Y B;  5LYJ A;  3OON A;  1GO0 A;  1JFF A;  3KHN A;  3S03 A;  1TVK A;  1UFY A;  1QAH A;  1U40 A;  2BTQ B;  4R40 B;  2Z1E A;  3WJR A;  5IJ0 B;  1K8A H;  2DT4 A;  2V9Y A;  4O4H B;  3RA6 A;  4BT6 A;  3V7E A;  5G4V C;  2QEX F;  2ZF8 A;  5BMV A;  3J81 M;  2UZH A;  5JCO C;  1K9M H;  3VCZ A;  3TD5 A;  2VGN A;  4O2B B;  4X1I B;  5EZY A;  4BT7 A;  2B33 A;  2YXZ A;  3VOB A;  4DXD A;  1IV3 A;  4DRX A;  2I6R A;  3WGJ A;  2RHJ A;  3ERN A;  5CA1 B;  2QA4 F;  3P0Z A;  5CA0 B;  4I4T B;  4C81 A;  4IIJ B;  2ZAU A;  2KTU A;  1T0K B;  2CW4 A;  1M90 H;  2ALE A;  1ZWZ A;  4ZHV A;  1W40 A;  5G4U C;  2FC3 A;  3IEQ A;  4TUY B;  4C82 A;  4HNA A;  3C9U A;  3IEW A;  4NQ3 A;  3VI6 A;  1W58 1;  2RB9 A;  2HS4 A;  5JCO A;  3QUW A;  5AVM A;  2KG4 A;  2VAM A;  3JAS B;  1Q7Y H;  1FSZ A;  3NMU C;  5LP6 C;  1SA0 A;  3KIZ A;  1U3P A;  2OHW A;  3LWQ C;  3HJW C;  2P6Y A;  1K73 H;  3JAK B;  3CCM F;  2HQS C;  5ITZ B;  4F6R A;  1VQV A;  2I6D A;  5J2T A;  1KQS F;  1U43 A;  1KNJ A;  1GX1 A;  1W3E X;  5GIN C;  1TUB A;  5EB0 A;  2NMU A;  5IYZ A;  2Z1T A;  3LYB A;  2HRU A;  3U0O A;  5FNV B;  2VGM A;  2VAP A;  3RYF B;  3D54 A;  5CB4 B;  5EWR A;  4RQO A;  3E1Y A;  3DC2 A;  4O2A B;  4ZOL B;  2HX0 A;  1COM A;  2CHS A;  3E22 A;  3MBM A;  3P4E A;  5GON B;  3CC4 F;  5HP7 A;  3CPQ A;  5J2U B;  5LP6 A;  4IHJ B;  4YJ3 B;  4E6E A;  3M1X A;  3P10 A;  2EWC A;  3HTN A;  3CCQ F;  1XHO A;  1W59 A;  1OFU A;  3JAL B;  5JH7 B;  5KX5 B;  3JAR B;  1UI9 A;  2DYY A;  1PF5 A;  2CZW A;  3I7T A;  5KMG A;  3WPW A;  3VYS C;  1R1M A;  3OW2 F;  4EI8 A;  4ZHQ A;  3IKE A;  3NK6 A;  3CMA F;  5MN6 A;  4RHA A;  2UYN B;  3CCV F;  3ZP7 A;  3EOR A;  4FFB B;  4EB6 B;  1W41 A;  5JVD A;  5FLX M;  3RYH A;  5HWE A;  1GO1 A;  5IJ9 A;  1SZQ A;  3WPX A;  4PWT A;  2H8E A;  3CXC F;  4TZZ A;  3LFO A;  1VQ5 F;  3CCR F;  4ZI7 A;  4X20 A;  4ERH A;  1GZ0 A;  1VQK F;  3IKF A;  4WBN B;  2OTL F;  2HP3 A;  1IV4 A;  1Z5W A;  2K1S A;  1W42 A;  1TVK B;  2CWJ A;  3RYI B;  3CCE F;  4C8E A;  3CYQ A;  1U3L A;  4G88 A;  3I3F A;  3S0Y A;  3GTZ A;  1OAP A;  1FNK A;  2VAW A;  3RA5 A;  3KJK A;  3JAW A;  5JQG A;  5EIB D;  1YJN F;  3ZOP A;  3L7Q A;  2BTU A;  3IR9 A;  5LXT B;  1FFX A;  3K12 A;  5C8Y A;  4NUT A;  4X1Y A;  5GAP K;  1DBF A;  2UYJ A;  2L26 A;  4LNU B;  3N2K B;  2GLZ A;  5LA6 B;  4BT4 A;  3AGK A;  1JJ2 F;  3F0F A;  2CSL A;  1M1K H;  2BO1 A;  1YJW F;  1NMU B;  3HAX D;  3HKC B;  4DRX B;  3F0G A;  5IJ0 A;  3MQW A;  1W57 A;  1NQ3 A;  2KGW A;  4XCQ A;  4O4H A;  1YGY A;  3ON1 A;  3VO8 A;  4O2B A;  4X1I A;  4ZK7 A;  3RYC B;  1VQ4 F;  5LOV B;  2OTJ F;  3V4D A;  4ZHY B;  5GIO C;  3TD4 A;  1W5B A;  1VQ7 F;  4I50 B;  1QD9 A;  2UYK A;  3BYQ A;  3HKD A;  3JAT B;  4BT2 A;  5CA1 A;  5CA0 A;  4I4T A;  4O4I B;  4IIJ A;  3C8L A;  1KC8 H;  2IG8 A;  4BT3 A;  1CN7 A;  4BT5 A;  3N2G B;  3I56 F;  4G4V A;  3TD3 A;  4U39 A;  2Q1X A;  1QVG F;  5GAN K;  2QI2 A;  2HVY D;  3CCL F;  3V7Q A;  2AIZ P;  4X3L A;  4EI7 A;  3J7A R;  1W55 A;  4O4J A;  2RHO A;  3VYU C;  3F0E A;  1Q81 H;  3ZP4 A;  2RHH A;  1NJI H;  3NVK E;  4BVS A;  2OZB A;  4NWO B;  2QTP A;  2RHL A;  1DT9 A;  3FD5 A;  3JAK A;  1X52 A;  3VOA A;  3DDN A;  3S0W A;  4I55 B;  5ITZ A;  3LWP C;  2HS0 A;  5EYP B;  2HP0 B;  3KJJ A;  5HXU A;  1YI2 F;  5HY0 A;  4BVR A;  5HY4 A;  1VQL F;  1X7P A;  3UT5 A;  4G4W A;  3G4S F;  3OBY A;  3LWV C;  4TV8 B;  2ZVZ A;  2LBX A;  1CK2 A;  1SDS A;  3V3T A;  3CME F;  4KWE A;  3LWR C;  3RYF A;  5DCV A;  5CB4 A;  5MN4 A;  3ESJ A;  3MCQ A;  4G4Y A;  3CPW F;  3M84 A;  4YJ2 B;  3G6E F;  2Z01 A;  3IMP A;  4ZOL A;  3K14 A;  3B6N A;  4G4Z A;  3CCU F;  4O4L B;  1W2B F;  1JN1 A;  4C8I A;  2Z1U A;  5J2U A;  1YIT F;  4IHJ A;  4YJ3 A;  4U3J B;  3CC2 F;  2ZVY A;  2UYP A;  3MCA B;  1XRG A;  2VXY A;  2PHN A;  3HKE B;  3JAL A;  1S72 F;  5JH7 A;  3HKB A;  3JAR A;  3WGL A;  4B46 A;  4X1K B;  1Q8R A;  4ZHW A;  3FFM A;  3KE1 A;  3G71 F;  4TV9 B;  2ZOV A;  3N4Z A;  2AIF A;  2HRY A;  1ONI A;  5LYJ B;  2LBT A;  1T0A A;  2R75 1;  1H47 A;  5FJ4 C;  1X7O A;  3C9R A;  2PMP A;  1JFF B;  4B62 A;  2CHT A;  2YYE A;  3FBA A;  3PLA C;  2UYN A;  2N48 A;  4FFB A;  4EB6 A;  3WJQ A;  5HP8 A;  4BVQ A;  1RA4 A;  2FGY A;  1KNK A;  3WJP A;  2G9I A;  1XV2 A;  5BMV B;  5MN5 A;  3QHD A;  3VMF B;  3MDO A;  3O85 A;  5C8Y B;  2GVI A;  3OBW A;  3SIV A;  2JNB A;  3D01 A;  5EZY B;  4WBN A;  3VIU A;  3S06 A;  4LCK A;  2IAF A;  1CLI A;  4BW0 B;  1J7H A;  3RYI A;  1E7K A;  1QU9 A;  5EB1 B;  1FNJ A;  2MQE A;  3D00 A;  5A2Q M;  5IT9 M;  3M4S A;  1W5F A;  2CVL A;  5LXT A;  4B45 A;  2LCA A;  2AMT A;  4LNU A;  3N2K A;  3FPI A;  3WGM A;  1X25 A;  5LA6 A;  3WGN A;  4C4W C;  4HNA B;  2Z1F A;  3HKC A;  1H7M A;  3HKD B;  2F9Z C;  1PXW A;  3CD6 F;  5HXZ A;  5EIB C;  3RE3 A;  1YQN A;  3S02 A;  3NVI B;  1SA0 B;  1VQ8 F;  3R0P A;  1YHQ F;  3CYP B;  4C8G A;  3LWO C;  3RYC A;  1N8R H;  5LOV A;  3QTY A;  4F6R B;  1YJ9 F;  4TUY A;  5J2T B;  1VK3 A;  4I50 A;  1KD1 H;  1TUB B;  3JAT A;  1W5E A;  3VYT C;  5IYZ B;  4BVT A;  2HS3 A;  1JD1 A;  3E20 B;  3CG6 A;  3JVH A;  4O4J B;  5B8F A;  4O4I A;  1VQ9 F;  3JAS A;  3C9S A;  3F6M A;  1VQN F;  3GYQ A;  3WXM B;  1VQM F;  1H48 A;  3I55 F;  3NK7 A;  3N2G A;  1VQ6 F;  3JCM M;  3GHZ A;  3VTI C;  5GIP C;  2IQQ A;  1XBI A;  1IPA A;  3PAF A;  3E22 B;  2WAL A;  1RQ7 A;  2BTO A;  3K2X A;  3UT5 B;  3JAM M;  2R6R 1;  5LP6 B;  1RLU A;  3HWU A;  1RQ2 A;  5FNV A;  3N4Y A;  1IV1 A;  1RLG A;  4O2A A;  4I55 A;  5EYP A;  2LBW A;  2HP0 A;  1Z5V A;  3SIU A;  4BY9 D;  1QVF F;  3J80 M;  5KMG B;  5GON A;  1ODE A;  3Q8H A;  4ZHQ B;  1IV2 A;  1Q82 H;  3CCS F;  4TV8 A;  1VQP F;  3WGK A;  5HY2 A;  2W8B C;  4EI9 A;  3LME A;  5JVD B;  2OTM A;  5IJ9 B;  3RYH B;  3CCJ F;  1W5A A;  2H8C A;  2GZL A;  4B5C A;  5KX5 A;  3HKB B;  3F0D A;  4YJ2 A;  1JY8 A;  2ZOD A;  3S0H A;  2Q1Y A;  2KTV A;  4ZI7 B;  4O4L A;  4X20 B;  5HY1 A;  4U3J A;  4X3M A;  2H6L A;  3CC7 F;  3K0T A; 
#chains in the Genus database with same CATH homology
 3I56 F;  3CC4 F;  3CPQ A;  1QVG F;  1VQO F;  5GAN K;  2QI2 A;  2HVY D;  5IT9 M;  3CCL F;  3V7Q A;  5EO3 A;  1YIJ F;  4X3L A;  4EI7 A;  3CCQ F;  3J7A R;  4C4W C;  1Q81 H;  1Q86 H;  1NJI H;  3NVK E;  1H7M A;  4BVS A;  1GO0 A;  2OZB A;  2F9Z C;  2CZW A;  1PXW A;  1DT9 A;  3CD6 F;  5HXZ A;  1X52 A;  3OW2 F;  4EI8 A;  3LWP C;  3NK6 A;  3CMA F;  3NVI B;  1K8A H;  1VQ8 F;  1YHQ F;  5HXU A;  1YI2 F;  5HY0 A;  4BVR A;  3LWO C;  5HY4 A;  3RA6 A;  3CCV F;  1VQL F;  1X7P A;  1N8R H;  5G4V C;  2QEX F;  3V7E A;  1W41 A;  3G4S F;  3J81 M;  3OBY A;  5FLX M;  1GO1 A;  5HWE A;  3LWV C;  1YJ9 F;  1K9M H;  2LBX A;  1KD1 H;  1CK2 A;  2VGN A;  1SDS A;  3CXC F;  3V3T A;  4TZZ A;  3CME F;  3LFO A;  3LWR C;  5DCV A;  4BVT A;  1VQ5 F;  3CCR F;  3E20 B;  3CG6 A;  1GZ0 A;  1VQK F;  3CPW F;  1VQ9 F;  3G6E F;  2OTL F;  1VQN F;  3GYQ A;  3WXM B;  1VQM F;  2QA4 F;  1W42 A;  3CCU F;  3I55 F;  3NK7 A;  1W2B F;  1VQ6 F;  3CCE F;  3JCM M;  5GIP C;  2KTU A;  1T0K B;  1XBI A;  1YIT F;  1M90 H;  2ALE A;  1ZWZ A;  1IPA A;  3RA5 A;  3CC2 F;  1W40 A;  3PAF A;  3MCA B;  5G4U C;  2WAL A;  1YJN F;  2FC3 A;  3IR9 A;  3JAM M;  1S72 F;  4NUT A;  5GAP K;  3N4Y A;  2GLZ A;  4NQ3 A;  3VI6 A;  3FFM A;  3AGK A;  1JJ2 F;  3G71 F;  1M1K H;  1RLG A;  2BO1 A;  1YJW F;  3N4Z A;  2AIF A;  1NMU B;  3HAX D;  2KG4 A;  1Q7Y H;  3NMU C;  2LBW A;  1X7O A;  5FJ4 C;  2OHW A;  3LWQ C;  3SIU A;  4BY9 D;  3HJW C;  1K73 H;  1QVF F;  3PLA C;  3J80 M;  3CCM F;  4XCQ A;  1Q82 H;  2I6D A;  3ON1 A;  3CCS F;  1KQS F;  1VQP F;  4BVQ A;  5HY2 A;  1W3E X;  4EI9 A;  5GIN C;  1RA4 A;  2FGY A;  1VQ4 F;  2OTJ F;  3VMF B;  3CCJ F;  3O85 A;  5GIO C;  1VQ7 F;  3OBW A;  3SIV A;  2JNB A;  2VGM A;  4LCK A;  5EWR A;  4BW0 B;  2KTV A;  3E1Y A;  5HY1 A;  1E7K A;  1KC8 H;  3D00 A;  5A2Q M;  4X3M A;  1CN7 A;  3CC7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...