3LWPC

Structure of h/aca rnp bound to a substrate rna containing 5brdu
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
publication title Glycosidic bond conformation preference plays a pivotal role in catalysis of RNA pseudouridylation: a combined simulation and structural study.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwpC00
3G4SF 1K73H 1Q86H 1VQLF 1W42A 3CCRF 1QVFF 1ZWZA 1GO1A 3I55F 1M90H 5GANK 1X7OA 3LWQC 3G71F 2KTUA 3AGKA 3JAMM 3HJWC 3SIUA 2BO1A 1VQ4F 1VQ8F 2QA4F 3J80M 3CC7F 3E1YA 1KQSF 2OHWA 3OW2F 2I6DA 3CCLF 1X52A 1Q81H 1KD1H 4BY9D 1NJIH 3N4YA 3ON1A 1YJNF 1X7PA 1W2BF 1VQMF 3PLAC 4LCKA 1RA4A 3CD6F 3CC4F 2LBXA 3CPQA 5G4VC 1M1KH 3CPWF 3J7AR 3NMUC 2WALA 2JNBA 1VQPF 3LFOA 1VQ6F 3CCVF 5G4UC 2KTVA 4X3LA 1VQ7F 1YJWF 3MCAB 2QEXF 3J81M 4NUTA 3NVKE 1Q82H 5A2QM 3CCSF 2ALEA 3OBWA 5FLXM 2AIFA 3CXCF 4X3MA 3IR9A 3LWVC 2OTJF 3RA6A 3CMEF 2HVYD 2CZWA 1VQKF 3LWPC 2LBWA 3CMAF 4BW0B 2VGNA 3WXMB 3RA5A 3V7QA 5FJ4C 2VGMA 3HAXD 5EO3A 3OBYA 1YI2F 1VQ9F 1S72F 1VQ5F 5DCVA 3I56F 3GYQA 3V7EA 5EWRA 1DT9A 1KC8H 3VI6A 3CCQF 1YJ9F 1YHQF 1NMUB 4C4WC 3JCMM 1VQNF 3LWOC 1Q7YH 2OZBA 1W40A 1JJ2F 3E20B 1XBIA 1YITF 1H7MA 5GIPC 5GIOC 3FFMA 1PXWA 5IT9M 1CN7A 1E7KA 5GAPK 5GINC 2KG4A 3CCJF 3PAFA 1GO0A 1CK2A 3CG6A 3NVIB 1IPAA 1SDSA 3CC2F 1W3EX 1YIJF 3CCUF 4TZZA 3CCMF 1K8AH 2FC3A 2OTLF 3SIVA 3VMFB 1K9MH 1QVGF 1N8RH 3O85A 1VQOF 3G6EF 3CCEF 3NK7A 1RLGA 3N4ZA 3LWRC 2QI2A 1GZ0A 3NK6A 1W41A 1T0KB
chains in the Genus database with same CATH superfamily
5ITZA 4WBNB 3G4SF 1K73H 3ZO8A 1Q86H 5FNVB 3MBMA 1GO1A 3L7QA 4NQ3A 4BT4A 3JARA 2Q1XA 4BT6A 2L26A 3JAWB 2AIZP 1Q8RA 4BVQA 5CA0A 1OAPA 2BO1A 3GHZA 1VQ4F 2Q1YA 4FFBB 4ZHYB 3V4DA 3E22A 4EB6A 3OW2F 3CCLF 3MCQA 1X52A 3WPWA 1NJIH 4G4VA 4O4IB 3RYHA 1X7PA 1W2BF 4HNAA 1FSZA 4BT2A 4O2BB 4C8IA 2ZOVA 3N2KA 3WGJA 3J7AR 3CPWF 4G4ZA 2CSLA 1ONIA 1IV2A 3KJKA 3I3FA 2JNBA 4YJ3A 1VQPF 1R1MA 5G4UC 1VQ7F 3JATB 1U40A 3MCAB 2UYNB 2VAMA 4IIJB 4F6RA 5LXTA 4BT7A 4NUTA 3C9UA 3HKCB 4NWOB 4XCQA 3NVKE 3KJJA 5IJ9A 1FFXB 1Z5WA 5A2QM 3OBWA 5EB0A 5J2TA 1T0AA 2HVYD 1VQKF 3S03A 1PF5A 4LNUB 2YXZA 3V7QA 2EWCA 5C8YB 1W581 2CHTA 3JAKB 4I55A 3HAXD 3OBYA 2H6LA 1YI2F 1VQ9F 2Z1FA 1S72F 5DCVA 3LDTA 2HP3A 3VI6A 4B5CA 1U3PA 1XV2A 4ZK7A 3VYTC 1H47A 5IJ0A 4C4WC 3JCMM 1VQNF 1Q7YH 2OZBA 4TV9B 5KMGA 2MQEA 2Z1UA 3OONA 5BMVA 4B62A 3VTIC 3E20B 3K14A 1H7MA 2HS0A 2GLZA 3MDOA 1UFYA 3ELCA 4X1IB 5GIOC 1CN7A 1E7KA 1U3LA 2IQQA 3VO8A 3S0WA 2P6YA 1IPAA 3HTNA 5B8FA 3CC2F 3UT5B 4O4HB 2UYJA 5KX5B 3D01A 1GX1A 3WJPA 3P4EA 4X1YA 2R751 2GZLA 4IHJB 3C8LA 5LOVA 3F0DA 3ESJA 4I50A 4YJ2B 1T0KB 4I4TB 3S0YA 2CWJA 1VQLF 5JCOC 3TD5A 3JALB 3I55F 1SZQA 4ERHA 3QUWA 5IYZA 2W8BC 5LA6B 4TV8B 3AGKA 2BTQB 3U0OA 5CA0B 3RYCB 4O4JA 3VOAA 2BTOA 4U39A 4X1KB 3CC7F 4EB6B 2HRYA 2OHWA 5JCOA 3CYPB 2I6DA 3FD6A 1SA0B 3RYIB 3P10A 5EIBC 3N2GA 3VOBA 2HQSC 4BVSA 3PLAC 1TUBA 2HX0A 5LP6B 3NMUC 5HWEA 3EORA 3Q8HA 3HKEB 3K2XA 3M4SA 2K1SA 3LFOA 1VQ6F 4EI7A 4EI8A 2QEXF 2UZHA 1JFFA 4RHAA 2RHHA 3J81M 3P0ZA 5CB4A 3T80A 5EZYB 1TVKB 4KWEA 1FNJA 5LYJA 3CXCF 2OTJF 3RA6A 3DC2A 4BT3A 1QU9A 2IG8A 4DRXB 2CZWA 5EYPB 3RYFB 2VGNA 5HY2A 2BTUA 5JH7B 4DXDA 3F0EA 5CA1B 1IV4A 3ZP4A 4ZHWA 1QAHA 1YJ9F 4ZI7A 3LWOC 1YQNA 4BVRA 1JJ2F 1YITF 1XBIA 1W5AA 3ERNA 1PXWA 1W55A 4TUYA 5J2UA 3WGLA 4WBNA 5GINC 5FNVA 3PAFA 1GO0A 4RQOA 3ZOPA 3D00A 1SDSA 3HKDA 1RQ7A 2RHLA 2OTMA 3JAWA 5EIBD 1N8RH 4FFBA 1VQOF 1VH8A 3RE3A 2FGYA 3CCEF 4I50B 2H8EA 4ZOLB 5JQGB 4X20A 1VQVA 3N4ZA 3LWRC 1RLGA 5GONB 2QI2A 5HY4A 2NMUA 5MN5A 1W41A 4O4IA 3D54A 1QVFF 4O4LB 1W42A 1IV3A 3CCRF 3HKBB 4O2BA 1M90H 3MQWA 1FNKA 1KNJA 3LWQC 1NQ3A 3FD5A 3G71F 2KTUA 2AMTA 3JATA 3WPXA 2Z1TA 1VQ8F 3LYBA 2HP0B 2UYNA 4IIJA 4ZHQB 2H8CA 3E1YA 5JVDB 1KQSF 1FFXA 2UYKA 5HXZA 3V3TA 1W5EA 4BY9D 2DYYA 2ZODA 4G88A 3ON1A 3F6MA 4O2AB 5ITZB 1YJNF 1W59A 5EB1B 4LNUA 3CD6F 3CC4F 2LBXA 3CPQA 1RLUA 2B33A 1M1KH 2Z01A 3JARB 4E6EA 5C8YA 3JAKA 1ODEA 2GVIA 3S06A 2KTVA 5J2UB 1YJWF 2VAPA 2PMPA 3E22B 2ZVZA 2RHOA 4TV9A 3CCSF 2ALEA 1YGYA 5FLXM 3IR9A 3RYHB 3B6NA 3LWPC 4HNAB 2LBWA 3CMAF 3N2KB 3KIZA 3WXMB 2PHNA 3K12A 4YJ3B 1X25A 2V9YA 3IEQA 3UT5A 3WJRA 4O4HA 4PWTA 1VQ5F 4R40B 3GYQA 3R0PA 5EWRA 4C81A 5KX5A 3I56F 4F6RB 5LXTB 1NMUB 2ZF8A 1U43A 2QTPA 5IJ9B 3C9SA 4IHJA 5MN4A 2F9ZC 1W40A 5J2TB 4C8EA 4YJ2A 3IKFA 5GIPC 4I4TA 5IT9M 3FPIA 5GAPK 2KG4A 4M8IA 3CCJF 1CK2A 3JASA 3JALA 4C8GA 3HKDB 3CG6A 1QD9A 3FBAA 3CYQA 4I55B 1YIJF 3CCUF 1VK3A 5LA6A 1H48A 3CCMF 1K8AH 4TV8A 4U3JA 3C9RA 3SIVA 1K9MH 1QVGF 3RYCA 5LP6C 3IMPA 3O85A 4X1KA 5IJ0B 1XRGA 3TD4A 5KMGB 5HY1A 2HRUA 1JY8A 4X20B 5BMVB 1SA0A 3RYIA 2HS3A 3BYQA 3M1XA 2YYEA 2LBTA 3WGKA 1OFUA 1ZWZA 2LCAA 5HP8A 5LP6A 5GANK 1X7OA 3ZP7A 2ZVYA 2VXYA 3HKEA 1COMA 3JAMM 3HJWC 3SIUA 1W57A 2QA4F 3QTYA 5HXUA 3J80M 1JN1A 1RQ2A 2CVLA 4X1YB 1J7HA 5HY0A 3JVHA 2VAWA 5EZYA 1TVKA 2HS4A 3VCZA 5LOVB 1Q81H 1KD1H 2R6R1 3C9TA 3N4YA 4DRXA 5EYPA 1VQMF 1JD1A 4LCKA 1RA4A 3LMEA 3RYFA 4G4WA 5G4VC 5JH7A 5IYZB 4ZHVA 2WALA 5CA1A 4C82A 4O2AA 3CCVF 3IKEA 4X3LA 2N48A 2DT4A 4O4JB 2CHSA 1IV1A 1Q82H 3F0FA 3HKCA 2IAFA 2AIFA 4X3MA 3LWVC 3N2GB 2RB9A 3VIUA 3CMEF 1CLIA 2ZAUA 5AVMA 2CW4A 1TUBB 3GTZA 3QHDA 3VYSC 4BW0B 1VHAA 3RA5A 5FJ4C 3KHNA 4BVTA 2VGMA 5EO3A 2I6RA 1W5FA 3M84A 3V7EA 1DT9A 1KC8H 3TD3A 3CCQF 1JFFB 3VYUC 1YHQF 2UYPA 5CB4B 3WJQA 3KE1A 1XHOA 3CB2A 3WGMA 3S0HA 5LYJB 4ZOLA 4B45A 5JQGA 2KGWA 2RHJA 3HWUA 3IEWA 5MN6A 5GONA 2Z1EA 3FFMA 3K0TA 4B46A 3JASB 4X1IA 4O4LA 3HKBA 1W5BA 3NVIB 1W3EX 4G4XA 5HP7A 4TZZA 3S02A 3I7TA 4U3JB 2FC3A 2G9IA 3F0GA 2OTLF 3VMFB 1DBFA 2HP0A 5EAZA 4ZHQA 4EI9A 5JVDA 4ZI7B 3WGNA 3G6EF 1Z5VA 3NK7A 1UI9A 4BT5A 4G4YA 3DDNA 1GZ0A 3NK6A 1KNKA 4TUYB
chains in the Genus database with same CATH topology
3G4SF 1K73H 1Q86H 1VQLF 1W42A 3CCRF 1QVFF 1ZWZA 1GO1A 3I55F 1M90H 4NQ3A 5GANK 1X7OA 3LWQC 4BVQA 3G71F 2KTUA 3AGKA 3JAMM 3HJWC 3SIUA 2BO1A 1VQ4F 1VQ8F 2QA4F 3J80M 5HXUA 3CC7F 3E1YA 1KQSF 2OHWA 5HY0A 3OW2F 2I6DA 3CCLF 5HXZA 1X52A 3V3TA 1Q81H 1KD1H 4BY9D 1NJIH 3N4YA 3ON1A 1YJNF 1X7PA 4BVSA 1W2BF 1VQMF 3PLAC 4LCKA 1RA4A 3CD6F 3CC4F 2LBXA 3CPQA 5G4VC 1M1KH 3CPWF 3J7AR 3NMUC 5HWEA 2WALA 2JNBA 1VQPF 3LFOA 1VQ6F 3CCVF 4EI7A 2KTVA 4X3LA 1VQ7F 1YJWF 5G4UC 4EI8A 3MCAB 2QEXF 3J81M 4NUTA 4XCQA 3NVKE 1Q82H 5A2QM 3CCSF 2ALEA 3OBWA 5FLXM 2AIFA 3CXCF 4X3MA 3IR9A 3LWVC 2OTJF 3RA6A 3CMEF 2HVYD 2CZWA 1VQKF 3LWPC 2LBWA 3CMAF 4BW0B 2VGNA 5HY2A 3WXMB 3RA5A 3V7QA 5FJ4C 4BVTA 2VGMA 3HAXD 5EO3A 3OBYA 1YI2F 1VQ9F 1S72F 1VQ5F 5DCVA 3I56F 3GYQA 3V7EA 5EWRA 1DT9A 1KC8H 3VI6A 3CCQF 1YJ9F 1YHQF 1NMUB 4C4WC 3JCMM 1VQNF 3LWOC 1Q7YH 2OZBA 2F9ZC 1W40A 4BVRA 1JJ2F 3E20B 1XBIA 1YITF 1H7MA 5GIPC 2GLZA 5GIOC 3FFMA 1PXWA 5IT9M 1CN7A 1E7KA 5GAPK 5GINC 2KG4A 3CCJF 3PAFA 1GO0A 1CK2A 3CG6A 3NVIB 3D00A 1IPAA 1SDSA 3CC2F 1W3EX 1YIJF 3CCUF 4TZZA 3CCMF 1K8AH 2FC3A 2OTLF 3SIVA 3VMFB 1K9MH 1QVGF 1N8RH 3O85A 1VQOF 4EI9A 2FGYA 3G6EF 5HY1A 3CCEF 3NK7A 1RLGA 3N4ZA 3LWRC 5HY4A 2QI2A 1GZ0A 3NK6A 1W41A 1T0KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S F;  1K73 H;  1Q86 H;  1VQL F;  1W42 A;  3CCR F;  1QVF F;  1ZWZ A;  1GO1 A;  3I55 F;  1M90 H;  5GAN K;  1X7O A;  3LWQ C;  3G71 F;  2KTU A;  3AGK A;  3JAM M;  3HJW C;  3SIU A;  2BO1 A;  1VQ4 F;  1VQ8 F;  2QA4 F;  3J80 M;  3CC7 F;  3E1Y A;  1KQS F;  2OHW A;  3OW2 F;  2I6D A;  3CCL F;  1X52 A;  1Q81 H;  1KD1 H;  4BY9 D;  1NJI H;  3N4Y A;  3ON1 A;  1YJN F;  1X7P A;  1W2B F;  1VQM F;  3PLA C;  4LCK A;  1RA4 A;  3CD6 F;  3CC4 F;  2LBX A;  3CPQ A;  5G4V C;  1M1K H;  3CPW F;  3J7A R;  3NMU C;  2WAL A;  2JNB A;  1VQP F;  3LFO A;  1VQ6 F;  3CCV F;  5G4U C;  2KTV A;  4X3L A;  1VQ7 F;  1YJW F;  3MCA B;  2QEX F;  3J81 M;  4NUT A;  3NVK E;  1Q82 H;  5A2Q M;  3CCS F;  2ALE A;  3OBW A;  5FLX M;  2AIF A;  3CXC F;  4X3M A;  3IR9 A;  3LWV C;  2OTJ F;  3RA6 A;  3CME F;  2HVY D;  2CZW A;  1VQK F;  3LWP C;  2LBW A;  3CMA F;  4BW0 B;  2VGN A;  3WXM B;  3RA5 A;  3V7Q A;  5FJ4 C;  2VGM A;  3HAX D;  5EO3 A;  3OBY A;  1YI2 F;  1VQ9 F;  1S72 F;  1VQ5 F;  5DCV A;  3I56 F;  3GYQ A;  3V7E A;  5EWR A;  1DT9 A;  1KC8 H;  3VI6 A;  3CCQ F;  1YJ9 F;  1YHQ F;  1NMU B;  4C4W C;  3JCM M;  1VQN F;  3LWO C;  1Q7Y H;  2OZB A;  1W40 A;  1JJ2 F;  3E20 B;  1XBI A;  1YIT F;  1H7M A;  5GIP C;  5GIO C;  3FFM A;  1PXW A;  5IT9 M;  1CN7 A;  1E7K A;  5GAP K;  5GIN C;  2KG4 A;  3CCJ F;  3PAF A;  1GO0 A;  1CK2 A;  3CG6 A;  3NVI B;  1IPA A;  1SDS A;  3CC2 F;  1W3E X;  1YIJ F;  3CCU F;  4TZZ A;  3CCM F;  1K8A H;  2FC3 A;  2OTL F;  3SIV A;  3VMF B;  1K9M H;  1QVG F;  1N8R H;  3O85 A;  1VQO F;  3G6E F;  3CCE F;  3NK7 A;  1RLG A;  3N4Z A;  3LWR C;  2QI2 A;  1GZ0 A;  3NK6 A;  1W41 A;  1T0K B; 
#chains in the Genus database with same CATH topology
 5ITZ A;  4WBN B;  3G4S F;  1K73 H;  3ZO8 A;  1Q86 H;  5FNV B;  3MBM A;  1GO1 A;  3L7Q A;  4NQ3 A;  4BT4 A;  3JAR A;  2Q1X A;  4BT6 A;  2L26 A;  3JAW B;  2AIZ P;  1Q8R A;  4BVQ A;  5CA0 A;  1OAP A;  2BO1 A;  3GHZ A;  1VQ4 F;  2Q1Y A;  4FFB B;  4ZHY B;  3V4D A;  3E22 A;  4EB6 A;  3OW2 F;  3CCL F;  3MCQ A;  1X52 A;  3WPW A;  1NJI H;  4G4V A;  4O4I B;  3RYH A;  1X7P A;  1W2B F;  4HNA A;  1FSZ A;  4BT2 A;  4O2B B;  4C8I A;  2ZOV A;  3N2K A;  3WGJ A;  3J7A R;  3CPW F;  4G4Z A;  2CSL A;  1ONI A;  1IV2 A;  3KJK A;  3I3F A;  2JNB A;  4YJ3 A;  1VQP F;  1R1M A;  5G4U C;  1VQ7 F;  3JAT B;  1U40 A;  3MCA B;  2UYN B;  2VAM A;  4IIJ B;  4F6R A;  5LXT A;  4BT7 A;  4NUT A;  3C9U A;  3HKC B;  4NWO B;  4XCQ A;  3NVK E;  3KJJ A;  5IJ9 A;  1FFX B;  1Z5W A;  5A2Q M;  3OBW A;  5EB0 A;  5J2T A;  1T0A A;  2HVY D;  1VQK F;  3S03 A;  1PF5 A;  4LNU B;  2YXZ A;  3V7Q A;  2EWC A;  5C8Y B;  1W58 1;  2CHT A;  3JAK B;  4I55 A;  3HAX D;  3OBY A;  2H6L A;  1YI2 F;  1VQ9 F;  2Z1F A;  1S72 F;  5DCV A;  3LDT A;  2HP3 A;  3VI6 A;  4B5C A;  1U3P A;  1XV2 A;  4ZK7 A;  3VYT C;  1H47 A;  5IJ0 A;  4C4W C;  3JCM M;  1VQN F;  1Q7Y H;  2OZB A;  4TV9 B;  5KMG A;  2MQE A;  2Z1U A;  3OON A;  5BMV A;  4B62 A;  3VTI C;  3E20 B;  3K14 A;  1H7M A;  2HS0 A;  2GLZ A;  3MDO A;  1UFY A;  3ELC A;  4X1I B;  5GIO C;  1CN7 A;  1E7K A;  1U3L A;  2IQQ A;  3VO8 A;  3S0W A;  2P6Y A;  1IPA A;  3HTN A;  5B8F A;  3CC2 F;  3UT5 B;  4O4H B;  2UYJ A;  5KX5 B;  3D01 A;  1GX1 A;  3WJP A;  3P4E A;  4X1Y A;  2R75 1;  2GZL A;  4IHJ B;  3C8L A;  5LOV A;  3F0D A;  3ESJ A;  4I50 A;  4YJ2 B;  1T0K B;  4I4T B;  3S0Y A;  2CWJ A;  1VQL F;  5JCO C;  3TD5 A;  3JAL B;  3I55 F;  1SZQ A;  4ERH A;  3QUW A;  5IYZ A;  2W8B C;  5LA6 B;  4TV8 B;  3AGK A;  2BTQ B;  3U0O A;  5CA0 B;  3RYC B;  4O4J A;  3VOA A;  2BTO A;  4U39 A;  4X1K B;  3CC7 F;  4EB6 B;  2HRY A;  2OHW A;  5JCO A;  3CYP B;  2I6D A;  3FD6 A;  1SA0 B;  3RYI B;  3P10 A;  5EIB C;  3N2G A;  3VOB A;  2HQS C;  4BVS A;  3PLA C;  1TUB A;  2HX0 A;  5LP6 B;  3NMU C;  5HWE A;  3EOR A;  3Q8H A;  3HKE B;  3K2X A;  3M4S A;  2K1S A;  3LFO A;  1VQ6 F;  4EI7 A;  4EI8 A;  2QEX F;  2UZH A;  1JFF A;  4RHA A;  2RHH A;  3J81 M;  3P0Z A;  5CB4 A;  3T80 A;  5EZY B;  1TVK B;  4KWE A;  1FNJ A;  5LYJ A;  3CXC F;  2OTJ F;  3RA6 A;  3DC2 A;  4BT3 A;  1QU9 A;  2IG8 A;  4DRX B;  2CZW A;  5EYP B;  3RYF B;  2VGN A;  5HY2 A;  2BTU A;  5JH7 B;  4DXD A;  3F0E A;  5CA1 B;  1IV4 A;  3ZP4 A;  4ZHW A;  1QAH A;  1YJ9 F;  4ZI7 A;  3LWO C;  1YQN A;  4BVR A;  1JJ2 F;  1YIT F;  1XBI A;  1W5A A;  3ERN A;  1PXW A;  1W55 A;  4TUY A;  5J2U A;  3WGL A;  4WBN A;  5GIN C;  5FNV A;  3PAF A;  1GO0 A;  4RQO A;  3ZOP A;  3D00 A;  1SDS A;  3HKD A;  1RQ7 A;  2RHL A;  2OTM A;  3JAW A;  5EIB D;  1N8R H;  4FFB A;  1VQO F;  1VH8 A;  3RE3 A;  2FGY A;  3CCE F;  4I50 B;  2H8E A;  4ZOL B;  5JQG B;  4X20 A;  1VQV A;  3N4Z A;  3LWR C;  1RLG A;  5GON B;  2QI2 A;  5HY4 A;  2NMU A;  5MN5 A;  1W41 A;  4O4I A;  3D54 A;  1QVF F;  4O4L B;  1W42 A;  1IV3 A;  3CCR F;  3HKB B;  4O2B A;  1M90 H;  3MQW A;  1FNK A;  1KNJ A;  3LWQ C;  1NQ3 A;  3FD5 A;  3G71 F;  2KTU A;  2AMT A;  3JAT A;  3WPX A;  2Z1T A;  1VQ8 F;  3LYB A;  2HP0 B;  2UYN A;  4IIJ A;  4ZHQ B;  2H8C A;  3E1Y A;  5JVD B;  1KQS F;  1FFX A;  2UYK A;  5HXZ A;  3V3T A;  1W5E A;  4BY9 D;  2DYY A;  2ZOD A;  4G88 A;  3ON1 A;  3F6M A;  4O2A B;  5ITZ B;  1YJN F;  1W59 A;  5EB1 B;  4LNU A;  3CD6 F;  3CC4 F;  2LBX A;  3CPQ A;  1RLU A;  2B33 A;  1M1K H;  2Z01 A;  3JAR B;  4E6E A;  5C8Y A;  3JAK A;  1ODE A;  2GVI A;  3S06 A;  2KTV A;  5J2U B;  1YJW F;  2VAP A;  2PMP A;  3E22 B;  2ZVZ A;  2RHO A;  4TV9 A;  3CCS F;  2ALE A;  1YGY A;  5FLX M;  3IR9 A;  3RYH B;  3B6N A;  3LWP C;  4HNA B;  2LBW A;  3CMA F;  3N2K B;  3KIZ A;  3WXM B;  2PHN A;  3K12 A;  4YJ3 B;  1X25 A;  2V9Y A;  3IEQ A;  3UT5 A;  3WJR A;  4O4H A;  4PWT A;  1VQ5 F;  4R40 B;  3GYQ A;  3R0P A;  5EWR A;  4C81 A;  5KX5 A;  3I56 F;  4F6R B;  5LXT B;  1NMU B;  2ZF8 A;  1U43 A;  2QTP A;  5IJ9 B;  3C9S A;  4IHJ A;  5MN4 A;  2F9Z C;  1W40 A;  5J2T B;  4C8E A;  4YJ2 A;  3IKF A;  5GIP C;  4I4T A;  5IT9 M;  3FPI A;  5GAP K;  2KG4 A;  4M8I A;  3CCJ F;  1CK2 A;  3JAS A;  3JAL A;  4C8G A;  3HKD B;  3CG6 A;  1QD9 A;  3FBA A;  3CYQ A;  4I55 B;  1YIJ F;  3CCU F;  1VK3 A;  5LA6 A;  1H48 A;  3CCM F;  1K8A H;  4TV8 A;  4U3J A;  3C9R A;  3SIV A;  1K9M H;  1QVG F;  3RYC A;  5LP6 C;  3IMP A;  3O85 A;  4X1K A;  5IJ0 B;  1XRG A;  3TD4 A;  5KMG B;  5HY1 A;  2HRU A;  1JY8 A;  4X20 B;  5BMV B;  1SA0 A;  3RYI A;  2HS3 A;  3BYQ A;  3M1X A;  2YYE A;  2LBT A;  3WGK A;  1OFU A;  1ZWZ A;  2LCA A;  5HP8 A;  5LP6 A;  5GAN K;  1X7O A;  3ZP7 A;  2ZVY A;  2VXY A;  3HKE A;  1COM A;  3JAM M;  3HJW C;  3SIU A;  1W57 A;  2QA4 F;  3QTY A;  5HXU A;  3J80 M;  1JN1 A;  1RQ2 A;  2CVL A;  4X1Y B;  1J7H A;  5HY0 A;  3JVH A;  2VAW A;  5EZY A;  1TVK A;  2HS4 A;  3VCZ A;  5LOV B;  1Q81 H;  1KD1 H;  2R6R 1;  3C9T A;  3N4Y A;  4DRX A;  5EYP A;  1VQM F;  1JD1 A;  4LCK A;  1RA4 A;  3LME A;  3RYF A;  4G4W A;  5G4V C;  5JH7 A;  5IYZ B;  4ZHV A;  2WAL A;  5CA1 A;  4C82 A;  4O2A A;  3CCV F;  3IKE A;  4X3L A;  2N48 A;  2DT4 A;  4O4J B;  2CHS A;  1IV1 A;  1Q82 H;  3F0F A;  3HKC A;  2IAF A;  2AIF A;  4X3M A;  3LWV C;  3N2G B;  2RB9 A;  3VIU A;  3CME F;  1CLI A;  2ZAU A;  5AVM A;  2CW4 A;  1TUB B;  3GTZ A;  3QHD A;  3VYS C;  4BW0 B;  1VHA A;  3RA5 A;  5FJ4 C;  3KHN A;  4BVT A;  2VGM A;  5EO3 A;  2I6R A;  1W5F A;  3M84 A;  3V7E A;  1DT9 A;  1KC8 H;  3TD3 A;  3CCQ F;  1JFF B;  3VYU C;  1YHQ F;  2UYP A;  5CB4 B;  3WJQ A;  3KE1 A;  1XHO A;  3CB2 A;  3WGM A;  3S0H A;  5LYJ B;  4ZOL A;  4B45 A;  5JQG A;  2KGW A;  2RHJ A;  3HWU A;  3IEW A;  5MN6 A;  5GON A;  2Z1E A;  3FFM A;  3K0T A;  4B46 A;  3JAS B;  4X1I A;  4O4L A;  3HKB A;  1W5B A;  3NVI B;  1W3E X;  4G4X A;  5HP7 A;  4TZZ A;  3S02 A;  3I7T A;  4U3J B;  2FC3 A;  2G9I A;  3F0G A;  2OTL F;  3VMF B;  1DBF A;  2HP0 A;  5EAZ A;  4ZHQ A;  4EI9 A;  5JVD A;  4ZI7 B;  3WGN A;  3G6E F;  1Z5V A;  3NK7 A;  1UI9 A;  4BT5 A;  4G4Y A;  3DDN A;  1GZ0 A;  3NK6 A;  1KNK A;  4TUY B; 
#chains in the Genus database with same CATH homology
 3G4S F;  1K73 H;  1Q86 H;  1VQL F;  1W42 A;  3CCR F;  1QVF F;  1ZWZ A;  1GO1 A;  3I55 F;  1M90 H;  4NQ3 A;  5GAN K;  1X7O A;  3LWQ C;  4BVQ A;  3G71 F;  2KTU A;  3AGK A;  3JAM M;  3HJW C;  3SIU A;  2BO1 A;  1VQ4 F;  1VQ8 F;  2QA4 F;  3J80 M;  5HXU A;  3CC7 F;  3E1Y A;  1KQS F;  2OHW A;  5HY0 A;  3OW2 F;  2I6D A;  3CCL F;  5HXZ A;  1X52 A;  3V3T A;  1Q81 H;  1KD1 H;  4BY9 D;  1NJI H;  3N4Y A;  3ON1 A;  1YJN F;  1X7P A;  4BVS A;  1W2B F;  1VQM F;  3PLA C;  4LCK A;  1RA4 A;  3CD6 F;  3CC4 F;  2LBX A;  3CPQ A;  5G4V C;  1M1K H;  3CPW F;  3J7A R;  3NMU C;  5HWE A;  2WAL A;  2JNB A;  1VQP F;  3LFO A;  1VQ6 F;  3CCV F;  4EI7 A;  2KTV A;  4X3L A;  1VQ7 F;  1YJW F;  5G4U C;  4EI8 A;  3MCA B;  2QEX F;  3J81 M;  4NUT A;  4XCQ A;  3NVK E;  1Q82 H;  5A2Q M;  3CCS F;  2ALE A;  3OBW A;  5FLX M;  2AIF A;  3CXC F;  4X3M A;  3IR9 A;  3LWV C;  2OTJ F;  3RA6 A;  3CME F;  2HVY D;  2CZW A;  1VQK F;  3LWP C;  2LBW A;  3CMA F;  4BW0 B;  2VGN A;  5HY2 A;  3WXM B;  3RA5 A;  3V7Q A;  5FJ4 C;  4BVT A;  2VGM A;  3HAX D;  5EO3 A;  3OBY A;  1YI2 F;  1VQ9 F;  1S72 F;  1VQ5 F;  5DCV A;  3I56 F;  3GYQ A;  3V7E A;  5EWR A;  1DT9 A;  1KC8 H;  3VI6 A;  3CCQ F;  1YJ9 F;  1YHQ F;  1NMU B;  4C4W C;  3JCM M;  1VQN F;  3LWO C;  1Q7Y H;  2OZB A;  2F9Z C;  1W40 A;  4BVR A;  1JJ2 F;  3E20 B;  1XBI A;  1YIT F;  1H7M A;  5GIP C;  2GLZ A;  5GIO C;  3FFM A;  1PXW A;  5IT9 M;  1CN7 A;  1E7K A;  5GAP K;  5GIN C;  2KG4 A;  3CCJ F;  3PAF A;  1GO0 A;  1CK2 A;  3CG6 A;  3NVI B;  3D00 A;  1IPA A;  1SDS A;  3CC2 F;  1W3E X;  1YIJ F;  3CCU F;  4TZZ A;  3CCM F;  1K8A H;  2FC3 A;  2OTL F;  3SIV A;  3VMF B;  1K9M H;  1QVG F;  1N8R H;  3O85 A;  1VQO F;  4EI9 A;  2FGY A;  3G6E F;  5HY1 A;  3CCE F;  3NK7 A;  1RLG A;  3N4Z A;  3LWR C;  5HY4 A;  2QI2 A;  1GZ0 A;  3NK6 A;  1W41 A;  1T0K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...