3LWPC

Structure of h/aca rnp bound to a substrate rna containing 5brdu
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Glycosidic bond conformation preference plays a pivotal role in catalysis of RNA pseudouridylation: a combined simulation and structural study.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 38
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwpC00
1SDSA 2QI2A 1YHQF 2VGNA 2OZBA 1W3EX 3OBYA 3I56F 3CCJF 3CD6F 3V7QA 3LWRC 2OTLF 1K73H 2FC3A 3O85A 3HAXD 1GO1A 3VI6A 3VMFB 5A2QM 1VQLF 3CCVF 1W42A 2I6DA 1W41A 3E20B 3ON1A 2HVYD 5G4VC 1DT9A 2OHWA 4X3LA 3GYQA 4BW0B 1K9MH 2KTVA 5IT9M 2QEXF 4NUTA 1YJNF 1RA4A 5EO3A 3CPQA 5FLXM 5FJ4C 5DCVA 1VQNF 1VQ7F 1YITF 3J7AR 1Q7YH 1KC8H 2VGMA 1GZ0A 1S72F 2OTJF 3J81M 3WXMB 1Q86H 3G6EF 3LWPC 1NMUB 3LFOA 2AIFA 3FFMA 1VQ9F 1RLGA 3CXCF 3CMEF 3NVKE 1VQ6F 5EWRA 1Q82H 1CK2A 3E1YA 3V7EA 1VQKF 3JAMM 1X52A 3OBWA 1VQ5F 1YI2F 2KTUA 5GIOC 1XBIA 3G71F 3IR9A 3PLAC 1VQOF 1GO0A 3RA5A 3CCMF 3N4ZA 2WALA 3CCEF 5GANK 3CC2F 3CPWF 3N4YA 1YJWF 3RA6A 1NJIH 3CCLF 1QVFF 1Q81H 1QVGF 4C4WC 1K8AH 3NMUC 3SIVA 3CG6A 1VQPF 2LBXA 4X3MA 3J80M 1VQMF 2BO1A 3PAFA 1KD1H 3CCRF 1M90H 1KQSF 1YJ9F 2QA4F 3G4SF 3CCQF 5G4UC 3LWQC 3OW2F 3AGKA 1W40A 2LBWA 1X7OA 3I55F 4TZZA 1E7KA 3LWOC 1VQ4F 1W2BF 3NK6A 1H7MA 3HJWC 1VQ8F 1JJ2F 1X7PA 3CMAF 1ZWZA 5GINC 3LWVC 4BY9D 1M1KH 1T0KB 3CCSF 5GAPK 5GIPC 2JNBA 3JCMM 3NVIB 3MCAB 2KG4A 1CN7A 2ALEA 1N8RH 3CCUF 1IPAA 1YIJF 1PXWA 4LCKA 2CZWA 3CC7F 3CC4F 3NK7A 3SIUA
chains in the Genus database with same CATH superfamily
1SDSA 3JVHA 1YHQF 1SA0B 2VGNA 3P0ZA 3I56F 1VHAA 5HP7A 2ZOVA 2UYNA 5LP6A 3MDOA 2ZVYA 2R751 5A2QM 5FNVB 5J2UB 2HVYD 1W41A 3KHNA 2CSLA 4TV8A 1YQNA 1GX1A 3WJQA 5G4VC 4C8IA 4ZI7B 4X3LA 1H48A 3I3FA 5KMGB 4NUTA 1RA4A 3IKFA 5EO3A 5ITZB 1XV2A 5JQGA 1VQNF 4HNAB 4C8EA 4I55A 1Q7YH 3HKDA 1KC8H 2VGMA 1GZ0A 1OAPA 4IHJA 4WBNB 2OTJF 3J81M 3VO8A 3WXMB 3ERNA 2GZLA 2Z01A 5LXTB 3S06A 3FFMA 1JFFB 4O4LA 4KWEA 1YGYA 2LCAA 5EWRA 2LBTA 4ZOLB 4U39A 1Q82H 4C82A 2L26A 3V7EA 1X52A 2HX0A 3S03A 4LNUA 1U40A 4NWOB 5J2TB 1YI2F 5GIOC 1XBIA 3PLAC 4YJ3A 3RYCA 1NQ3A 5MN4A 1GO0A 2VXYA 2BTQB 5CB4A 3JAWA 5IJ0B 3LYBA 4X1KB 3CYPB 1YJWF 3HKEB 2MQEA 4DRXA 5LOVB 3RYIA 3NMUC 4IIJA 3SIVA 4RQOA 3J80M 3ZO8A 1COMA 4PWTA 3IMPA 3M4SA 4EB6B 2YYEA 1W5BA 5HXUA 4O4HA 3TD4A 1W57A 3G4SF 5EYPB 3CCQF 4DXDA 3MQWA 5EZYA 2GVIA 5JH7B 4F6RA 1X7OA 1E7KA 3JASB 2HS0A 3N2KA 3F0EA 5GONA 1W2BF 1VQ4F 4O4JA 2QTPA 2HP0A 3CYQA 4X1YA 1JJ2F 3S0WA 4BY9D 1T0KB 3VYUC 5CA1B 3LMEA 3L7QA 2G9IA 3R0PA 3E22B 3RYFA 4M8IA 4BT3A 4ZHYB 3MCAB 2KG4A 1R1MA 1IPAA 1YIJF 1W55A 4LCKA 3NK7A 2UYKA 3SIUA 5KX5B 3C9SA 3OBYA 4BT5A 3CCJF 1QD9A 3OONA 5EB0A 3LWRC 3HKBB 1K73H 3I7TA 3D54A 3RE3A 5BMVB 3VI6A 4X1IB 3VMFB 5EIBC 3P4EA 5LYJB 1W42A 2I6DA 3CCVF 4R40B 1W5FA 2CW4A 1DT9A 4X20B 3HKCA 1X25A 2OTMA 2QEXF 1YJNF 3WJRA 4U3JB 3WGJA 5HY0A 4ZHQB 3CPQA 2Z1UA 1FFXA 3V4DA 3F0FA 1VQ7F 2HS3A 1IV3A 1JN1A 4B62A 4TV9B 3C9UA 4O4IB 3N2GB 3LFOA 2AIFA 3JATA 1XHOA 2PHNA 5IJ9B 2HRYA 2UZHA 1CK2A 5LA6B 5LP6C 3JAMM 4B45A 2HP3A 3FPIA 2VAWA 1TVKA 4O2AA 3EORA 3N4ZA 1W5EA 2WALA 2H8CA 5GANK 3DDNA 3N4YA 1NJIH 4O2BB 3CCLF 5IYZA 1QVFF 1KNKA 2Z1TA 3B6NA 1TUBA 2RHJA 2KGWA 3ESJA 1ODEA 2ZF8A 4BT7A 1VQMF 1UFYA 5JVDA 5CA0A 4XCQA 4EI7A 4RHAA 1YJ9F 3ZP7A 1Q8RA 2EWCA 3OW2F 3AGKA 2B33A 3IKEA 4ZK7A 5EIBD 3RYHB 3LWOC 2P6YA 1CLIA 1JD1A 3JALB 2VAPA 3GTZA 1X7PA 3T80A 2FGYA 3TD3A 5GINC 4I4TA 1M1KH 2H6LA 4I50A 3JAKB 3WPXA 2V9YA 2UYJA 3CCSF 5GAPK 5GIPC 3C8LA 3P10A 3FD5A 1ONIA 3WGNA 3UT5A 2F9ZC 4FFBA 4YJ2B 1CN7A 4EI8A 2ALEA 5HP8A 4ZHWA 3HWUA 2AMTA 5C8YB 3FBAA 3D01A 4TUYB 2NMUA 2CZWA 3CC7F 3JARA 1W3EX 1SA0A 2CHTA 1Z5WA 2CHSA 2UYNB 3KJJA 3HAXD 2IG8A 5LP6B 3K0TA 3MBMA 1OFUA 1GO1A 1VQLF 4BT6A 5FNVA 4TV8B 3VOBA 3C9TA 5J2UA 1VH8A 2IQQA 2OHWA 4ZI7A 3LDTA 4BW0B 5HXZA 2KTVA 4G4VA 5IT9M 5KMGA 2HRUA 3HTNA 3K2XA 5JQGB 4G4XA 3DC2A 3VIUA 5DCVA 2Z1FA 4NQ3A 3WGLA 4HNAA 4I55B 3J7AR 3HKDB 4ERHA 4IHJB 3WGMA 2Z1EA 3QUWA 1FNKA 1Q86H 3G6EF 3LWPC 1NMUB 1TUBB 5HY2A 5LXTA 4O4LB 1VQ9F 1JFFA 1RLGA 3CMEF 1U43A 4G88A 2RB9A 4LNUB 3OBWA 3V3TA 1VQ5F 5J2TA 5EB1B 4YJ3B 3U0OA 3RYCB 1FNJA 5JCOA 2DYYA 5HWEA 5CB4B 3CCMF 2RHLA 2K1SA 3JAWB 4BT2A 3CCEF 1VQVA 5IJ0A 5MN5A 3CC2F 3CPWF 1T0AA 4X1KA 5HY1A 4C8GA 3WPWA 4DRXB 3HKEA 1FSZA 3RYIB 5LOVA 1QVGF 4C4WC 1J7HA 3K14A 4IIJB 5MN6A 3Q8HA 3ELCA 1IV4A 2RHOA 3F0GA 3WJPA 4X3MA 3VCZA 3S0YA 2BO1A 3VTIC 5AVMA 1M90H 3M1XA 4EB6A 4O4HB 2QA4F 2W8BC 3F0DA 5EYPA 4BVSA 3LWQC 5EZYB 3KJKA 4F6RB 5JH7A 3I55F 1KNJA 3N2KB 4B46A 3JASA 5GONB 4G4WA 3C9RA 1UI9A 4C81A 3ZOPA 4O4JB 2HP0B 4X1YB 1H7MA 3CMAF 1ZWZA 3LWVC 3F6MA 5CA1A 3RYFB 2JNBA 2HQSC 3E22A 1W59A 1QAHA 2ZODA 3QHDA 4E6EA 3CB2A 3BYQA 3CC4F 2RHHA 2Q1YA 1XRGA 2QI2A 5KX5A 2OZBA 4ZHVA 3CD6F 3V7QA 3IEWA 2OTLF 2GLZA 3VYTC 2FC3A 3HKBA 3O85A 2IAFA 5BMVA 4X1IA 2I6RA 1IV2A 3E20B 3ON1A 5LYJA 3GHZA 1RQ2A 2ZAUA 3GYQA 3HKCB 4X20A 5EAZA 1Z5VA 1K9MH 1IV1A 4U3JA 1FFXB 4ZHQA 3S02A 5FLXM 5FJ4C 1VK3A 2H8EA 4BVTA 3TD5A 1YITF 4BT4A 2CVLA 3D00A 4EI9A 4TV9A 4B5CA 1S72F 2AIZP 4O4IA 3IEQA 4G4YA 3N2GA 1PF5A 2HS4A 3CXCF 3NVKE 1VQ6F 3JATB 5IJ9A 5LA6A 3E1YA 1VQKF 2DT4A 2YXZA 1SZQA 1TVKB 4O2AB 2KTUA 3G71F 3IR9A 1VQOF 1DBFA 5ITZA 3RA5A 4BVRA 2Q1XA 1W5AA 3RA6A 5IYZB 3S0HA 4WBNA 4O2BA 3FD6A 3WGKA 2R6R1 3KE1A 1Q81H 3VYSC 1K8AH 3CG6A 1RQ7A 2BTUA 5JVDB 2LBXA 5CA0B 1VQPF 3VOAA 2UYPA 2VAMA 3PAFA 1KD1H 3CCRF 4ZOLA 1KQSF 2CWJA 3QTYA 3MCQA 2ZVZA 5G4UC 1U3PA 1W581 3M84A 4G4ZA 1W40A 5B8FA 2LBWA 4TZZA 3K12A 3ZP4A 3RYHA 1H47A 2BTOA 3NK6A 5JCOC 5HY4A 3JALA 1VQ8F 3HJWC 4BVQA 4I4TB 4I50B 3JAKA 3UT5B 3JCMM 3NVIB 4FFBB 1RLUA 4YJ2A 1N8RH 3CCUF 3KIZA 1QU9A 2PMPA 1U3LA 5C8YA 1PXWA 2N48A 4TUYA 1JY8A 3JARB
chains in the Genus database with same CATH topology
1SDSA 2QI2A 1YHQF 2VGNA 2OZBA 1W3EX 3OBYA 3I56F 3CCJF 3CD6F 3V7QA 3LWRC 2OTLF 2GLZA 1K73H 2FC3A 3O85A 3HAXD 1GO1A 3VI6A 3VMFB 5A2QM 1VQLF 3CCVF 1W42A 2I6DA 1W41A 3E20B 3ON1A 2HVYD 5G4VC 1DT9A 2OHWA 4X3LA 3GYQA 4BW0B 5HXZA 1K9MH 2KTVA 5IT9M 2QEXF 4NUTA 1YJNF 1RA4A 5HY0A 5EO3A 3CPQA 5FLXM 5FJ4C 5DCVA 4NQ3A 4BVTA 1VQNF 1VQ7F 1YITF 3J7AR 1Q7YH 3D00A 1KC8H 4EI9A 2VGMA 1GZ0A 1S72F 2OTJF 3J81M 3WXMB 1Q86H 3G6EF 3LWPC 1NMUB 5HY2A 3LFOA 2AIFA 3FFMA 1VQ9F 1RLGA 3CXCF 3CMEF 3NVKE 1VQ6F 5EWRA 1Q82H 1CK2A 3E1YA 3V7EA 1VQKF 3JAMM 1X52A 3OBWA 3V3TA 1VQ5F 1YI2F 2KTUA 5GIOC 1XBIA 3G71F 3IR9A 3PLAC 1VQOF 1GO0A 3RA5A 5HWEA 3CCMF 3N4ZA 2WALA 4BVRA 3CCEF 5GANK 3CC2F 3CPWF 3N4YA 5HY1A 3RA6A 1YJWF 1NJIH 3CCLF 1QVFF 1Q81H 1QVGF 4C4WC 1K8AH 3NMUC 3SIVA 3CG6A 1VQPF 2LBXA 4X3MA 3J80M 1VQMF 2BO1A 3PAFA 4XCQA 1KD1H 3CCRF 1M90H 4EI7A 1KQSF 1YJ9F 2QA4F 5HXUA 3G4SF 3CCQF 5G4UC 4BVSA 3LWQC 3OW2F 3AGKA 1W40A 2LBWA 1X7OA 3I55F 4TZZA 1E7KA 3LWOC 1VQ4F 1W2BF 3NK6A 1H7MA 3HJWC 5HY4A 1VQ8F 1JJ2F 1X7PA 3CMAF 2FGYA 4BVQA 1ZWZA 5GINC 3LWVC 4BY9D 1M1KH 1T0KB 3CCSF 5GAPK 5GIPC 2JNBA 3JCMM 3NVIB 2F9ZC 3MCAB 2KG4A 1CN7A 4EI8A 2ALEA 1N8RH 3CCUF 1IPAA 1YIJF 1PXWA 4LCKA 2CZWA 3CC7F 3CC4F 3NK7A 3SIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDS A;  2QI2 A;  1YHQ F;  2VGN A;  2OZB A;  1W3E X;  3OBY A;  3I56 F;  3CCJ F;  3CD6 F;  3V7Q A;  3LWR C;  2OTL F;  1K73 H;  2FC3 A;  3O85 A;  3HAX D;  1GO1 A;  3VI6 A;  3VMF B;  5A2Q M;  1VQL F;  3CCV F;  1W42 A;  2I6D A;  1W41 A;  3E20 B;  3ON1 A;  2HVY D;  5G4V C;  1DT9 A;  2OHW A;  4X3L A;  3GYQ A;  4BW0 B;  1K9M H;  2KTV A;  5IT9 M;  2QEX F;  4NUT A;  1YJN F;  1RA4 A;  5EO3 A;  3CPQ A;  5FLX M;  5FJ4 C;  5DCV A;  1VQN F;  1VQ7 F;  1YIT F;  3J7A R;  1Q7Y H;  1KC8 H;  2VGM A;  1GZ0 A;  1S72 F;  2OTJ F;  3J81 M;  3WXM B;  1Q86 H;  3G6E F;  3LWP C;  1NMU B;  3LFO A;  2AIF A;  3FFM A;  1VQ9 F;  1RLG A;  3CXC F;  3CME F;  3NVK E;  1VQ6 F;  5EWR A;  1Q82 H;  1CK2 A;  3E1Y A;  3V7E A;  1VQK F;  3JAM M;  1X52 A;  3OBW A;  1VQ5 F;  1YI2 F;  2KTU A;  5GIO C;  1XBI A;  3G71 F;  3IR9 A;  3PLA C;  1VQO F;  1GO0 A;  3RA5 A;  3CCM F;  3N4Z A;  2WAL A;  3CCE F;  5GAN K;  3CC2 F;  3CPW F;  3N4Y A;  1YJW F;  3RA6 A;  1NJI H;  3CCL F;  1QVF F;  1Q81 H;  1QVG F;  4C4W C;  1K8A H;  3NMU C;  3SIV A;  3CG6 A;  1VQP F;  2LBX A;  4X3M A;  3J80 M;  1VQM F;  2BO1 A;  3PAF A;  1KD1 H;  3CCR F;  1M90 H;  1KQS F;  1YJ9 F;  2QA4 F;  3G4S F;  3CCQ F;  5G4U C;  3LWQ C;  3OW2 F;  3AGK A;  1W40 A;  2LBW A;  1X7O A;  3I55 F;  4TZZ A;  1E7K A;  3LWO C;  1VQ4 F;  1W2B F;  3NK6 A;  1H7M A;  3HJW C;  1VQ8 F;  1JJ2 F;  1X7P A;  3CMA F;  1ZWZ A;  5GIN C;  3LWV C;  4BY9 D;  1M1K H;  1T0K B;  3CCS F;  5GAP K;  5GIP C;  2JNB A;  3JCM M;  3NVI B;  3MCA B;  2KG4 A;  1CN7 A;  2ALE A;  1N8R H;  3CCU F;  1IPA A;  1YIJ F;  1PXW A;  4LCK A;  2CZW A;  3CC7 F;  3CC4 F;  3NK7 A;  3SIU A; 
#chains in the Genus database with same CATH topology
 1SDS A;  3JVH A;  1YHQ F;  1SA0 B;  2VGN A;  3P0Z A;  3I56 F;  1VHA A;  5HP7 A;  2ZOV A;  2UYN A;  5LP6 A;  3MDO A;  2ZVY A;  2R75 1;  5A2Q M;  5FNV B;  5J2U B;  2HVY D;  1W41 A;  3KHN A;  2CSL A;  4TV8 A;  1YQN A;  1GX1 A;  3WJQ A;  5G4V C;  4C8I A;  4ZI7 B;  4X3L A;  1H48 A;  3I3F A;  5KMG B;  4NUT A;  1RA4 A;  3IKF A;  5EO3 A;  5ITZ B;  1XV2 A;  5JQG A;  1VQN F;  4HNA B;  4C8E A;  4I55 A;  1Q7Y H;  3HKD A;  1KC8 H;  2VGM A;  1GZ0 A;  1OAP A;  4IHJ A;  4WBN B;  2OTJ F;  3J81 M;  3VO8 A;  3WXM B;  3ERN A;  2GZL A;  2Z01 A;  5LXT B;  3S06 A;  3FFM A;  1JFF B;  4O4L A;  4KWE A;  1YGY A;  2LCA A;  5EWR A;  2LBT A;  4ZOL B;  4U39 A;  1Q82 H;  4C82 A;  2L26 A;  3V7E A;  1X52 A;  2HX0 A;  3S03 A;  4LNU A;  1U40 A;  4NWO B;  5J2T B;  1YI2 F;  5GIO C;  1XBI A;  3PLA C;  4YJ3 A;  3RYC A;  1NQ3 A;  5MN4 A;  1GO0 A;  2VXY A;  2BTQ B;  5CB4 A;  3JAW A;  5IJ0 B;  3LYB A;  4X1K B;  3CYP B;  1YJW F;  3HKE B;  2MQE A;  4DRX A;  5LOV B;  3RYI A;  3NMU C;  4IIJ A;  3SIV A;  4RQO A;  3J80 M;  3ZO8 A;  1COM A;  4PWT A;  3IMP A;  3M4S A;  4EB6 B;  2YYE A;  1W5B A;  5HXU A;  4O4H A;  3TD4 A;  1W57 A;  3G4S F;  5EYP B;  3CCQ F;  4DXD A;  3MQW A;  5EZY A;  2GVI A;  5JH7 B;  4F6R A;  1X7O A;  1E7K A;  3JAS B;  2HS0 A;  3N2K A;  3F0E A;  5GON A;  1W2B F;  1VQ4 F;  4O4J A;  2QTP A;  2HP0 A;  3CYQ A;  4X1Y A;  1JJ2 F;  3S0W A;  4BY9 D;  1T0K B;  3VYU C;  5CA1 B;  3LME A;  3L7Q A;  2G9I A;  3R0P A;  3E22 B;  3RYF A;  4M8I A;  4BT3 A;  4ZHY B;  3MCA B;  2KG4 A;  1R1M A;  1IPA A;  1YIJ F;  1W55 A;  4LCK A;  3NK7 A;  2UYK A;  3SIU A;  5KX5 B;  3C9S A;  3OBY A;  4BT5 A;  3CCJ F;  1QD9 A;  3OON A;  5EB0 A;  3LWR C;  3HKB B;  1K73 H;  3I7T A;  3D54 A;  3RE3 A;  5BMV B;  3VI6 A;  4X1I B;  3VMF B;  5EIB C;  3P4E A;  5LYJ B;  1W42 A;  2I6D A;  3CCV F;  4R40 B;  1W5F A;  2CW4 A;  1DT9 A;  4X20 B;  3HKC A;  1X25 A;  2OTM A;  2QEX F;  1YJN F;  3WJR A;  4U3J B;  3WGJ A;  5HY0 A;  4ZHQ B;  3CPQ A;  2Z1U A;  1FFX A;  3V4D A;  3F0F A;  1VQ7 F;  2HS3 A;  1IV3 A;  1JN1 A;  4B62 A;  4TV9 B;  3C9U A;  4O4I B;  3N2G B;  3LFO A;  2AIF A;  3JAT A;  1XHO A;  2PHN A;  5IJ9 B;  2HRY A;  2UZH A;  1CK2 A;  5LA6 B;  5LP6 C;  3JAM M;  4B45 A;  2HP3 A;  3FPI A;  2VAW A;  1TVK A;  4O2A A;  3EOR A;  3N4Z A;  1W5E A;  2WAL A;  2H8C A;  5GAN K;  3DDN A;  3N4Y A;  1NJI H;  4O2B B;  3CCL F;  5IYZ A;  1QVF F;  1KNK A;  2Z1T A;  3B6N A;  1TUB A;  2RHJ A;  2KGW A;  3ESJ A;  1ODE A;  2ZF8 A;  4BT7 A;  1VQM F;  1UFY A;  5JVD A;  5CA0 A;  4XCQ A;  4EI7 A;  4RHA A;  1YJ9 F;  3ZP7 A;  1Q8R A;  2EWC A;  3OW2 F;  3AGK A;  2B33 A;  3IKE A;  4ZK7 A;  5EIB D;  3RYH B;  3LWO C;  2P6Y A;  1CLI A;  1JD1 A;  3JAL B;  2VAP A;  3GTZ A;  1X7P A;  3T80 A;  2FGY A;  3TD3 A;  5GIN C;  4I4T A;  1M1K H;  2H6L A;  4I50 A;  3JAK B;  3WPX A;  2V9Y A;  2UYJ A;  3CCS F;  5GAP K;  5GIP C;  3C8L A;  3P10 A;  3FD5 A;  1ONI A;  3WGN A;  3UT5 A;  2F9Z C;  4FFB A;  4YJ2 B;  1CN7 A;  4EI8 A;  2ALE A;  5HP8 A;  4ZHW A;  3HWU A;  2AMT A;  5C8Y B;  3FBA A;  3D01 A;  4TUY B;  2NMU A;  2CZW A;  3CC7 F;  3JAR A;  1W3E X;  1SA0 A;  2CHT A;  1Z5W A;  2CHS A;  2UYN B;  3KJJ A;  3HAX D;  2IG8 A;  5LP6 B;  3K0T A;  3MBM A;  1OFU A;  1GO1 A;  1VQL F;  4BT6 A;  5FNV A;  4TV8 B;  3VOB A;  3C9T A;  5J2U A;  1VH8 A;  2IQQ A;  2OHW A;  4ZI7 A;  3LDT A;  4BW0 B;  5HXZ A;  2KTV A;  4G4V A;  5IT9 M;  5KMG A;  2HRU A;  3HTN A;  3K2X A;  5JQG B;  4G4X A;  3DC2 A;  3VIU A;  5DCV A;  2Z1F A;  4NQ3 A;  3WGL A;  4HNA A;  4I55 B;  3J7A R;  3HKD B;  4ERH A;  4IHJ B;  3WGM A;  2Z1E A;  3QUW A;  1FNK A;  1Q86 H;  3G6E F;  3LWP C;  1NMU B;  1TUB B;  5HY2 A;  5LXT A;  4O4L B;  1VQ9 F;  1JFF A;  1RLG A;  3CME F;  1U43 A;  4G88 A;  2RB9 A;  4LNU B;  3OBW A;  3V3T A;  1VQ5 F;  5J2T A;  5EB1 B;  4YJ3 B;  3U0O A;  3RYC B;  1FNJ A;  5JCO A;  2DYY A;  5HWE A;  5CB4 B;  3CCM F;  2RHL A;  2K1S A;  3JAW B;  4BT2 A;  3CCE F;  1VQV A;  5IJ0 A;  5MN5 A;  3CC2 F;  3CPW F;  1T0A A;  4X1K A;  5HY1 A;  4C8G A;  3WPW A;  4DRX B;  3HKE A;  1FSZ A;  3RYI B;  5LOV A;  1QVG F;  4C4W C;  1J7H A;  3K14 A;  4IIJ B;  5MN6 A;  3Q8H A;  3ELC A;  1IV4 A;  2RHO A;  3F0G A;  3WJP A;  4X3M A;  3VCZ A;  3S0Y A;  2BO1 A;  3VTI C;  5AVM A;  1M90 H;  3M1X A;  4EB6 A;  4O4H B;  2QA4 F;  2W8B C;  3F0D A;  5EYP A;  4BVS A;  3LWQ C;  5EZY B;  3KJK A;  4F6R B;  5JH7 A;  3I55 F;  1KNJ A;  3N2K B;  4B46 A;  3JAS A;  5GON B;  4G4W A;  3C9R A;  1UI9 A;  4C81 A;  3ZOP A;  4O4J B;  2HP0 B;  4X1Y B;  1H7M A;  3CMA F;  1ZWZ A;  3LWV C;  3F6M A;  5CA1 A;  3RYF B;  2JNB A;  2HQS C;  3E22 A;  1W59 A;  1QAH A;  2ZOD A;  3QHD A;  4E6E A;  3CB2 A;  3BYQ A;  3CC4 F;  2RHH A;  2Q1Y A;  1XRG A;  2QI2 A;  5KX5 A;  2OZB A;  4ZHV A;  3CD6 F;  3V7Q A;  3IEW A;  2OTL F;  2GLZ A;  3VYT C;  2FC3 A;  3HKB A;  3O85 A;  2IAF A;  5BMV A;  4X1I A;  2I6R A;  1IV2 A;  3E20 B;  3ON1 A;  5LYJ A;  3GHZ A;  1RQ2 A;  2ZAU A;  3GYQ A;  3HKC B;  4X20 A;  5EAZ A;  1Z5V A;  1K9M H;  1IV1 A;  4U3J A;  1FFX B;  4ZHQ A;  3S02 A;  5FLX M;  5FJ4 C;  1VK3 A;  2H8E A;  4BVT A;  3TD5 A;  1YIT F;  4BT4 A;  2CVL A;  3D00 A;  4EI9 A;  4TV9 A;  4B5C A;  1S72 F;  2AIZ P;  4O4I A;  3IEQ A;  4G4Y A;  3N2G A;  1PF5 A;  2HS4 A;  3CXC F;  3NVK E;  1VQ6 F;  3JAT B;  5IJ9 A;  5LA6 A;  3E1Y A;  1VQK F;  2DT4 A;  2YXZ A;  1SZQ A;  1TVK B;  4O2A B;  2KTU A;  3G71 F;  3IR9 A;  1VQO F;  1DBF A;  5ITZ A;  3RA5 A;  4BVR A;  2Q1X A;  1W5A A;  3RA6 A;  5IYZ B;  3S0H A;  4WBN A;  4O2B A;  3FD6 A;  3WGK A;  2R6R 1;  3KE1 A;  1Q81 H;  3VYS C;  1K8A H;  3CG6 A;  1RQ7 A;  2BTU A;  5JVD B;  2LBX A;  5CA0 B;  1VQP F;  3VOA A;  2UYP A;  2VAM A;  3PAF A;  1KD1 H;  3CCR F;  4ZOL A;  1KQS F;  2CWJ A;  3QTY A;  3MCQ A;  2ZVZ A;  5G4U C;  1U3P A;  1W58 1;  3M84 A;  4G4Z A;  1W40 A;  5B8F A;  2LBW A;  4TZZ A;  3K12 A;  3ZP4 A;  3RYH A;  1H47 A;  2BTO A;  3NK6 A;  5JCO C;  5HY4 A;  3JAL A;  1VQ8 F;  3HJW C;  4BVQ A;  4I4T B;  4I50 B;  3JAK A;  3UT5 B;  3JCM M;  3NVI B;  4FFB B;  1RLU A;  4YJ2 A;  1N8R H;  3CCU F;  3KIZ A;  1QU9 A;  2PMP A;  1U3L A;  5C8Y A;  1PXW A;  2N48 A;  4TUY A;  1JY8 A;  3JAR B; 
#chains in the Genus database with same CATH homology
 1SDS A;  2QI2 A;  1YHQ F;  2VGN A;  2OZB A;  1W3E X;  3OBY A;  3I56 F;  3CCJ F;  3CD6 F;  3V7Q A;  3LWR C;  2OTL F;  2GLZ A;  1K73 H;  2FC3 A;  3O85 A;  3HAX D;  1GO1 A;  3VI6 A;  3VMF B;  5A2Q M;  1VQL F;  3CCV F;  1W42 A;  2I6D A;  1W41 A;  3E20 B;  3ON1 A;  2HVY D;  5G4V C;  1DT9 A;  2OHW A;  4X3L A;  3GYQ A;  4BW0 B;  5HXZ A;  1K9M H;  2KTV A;  5IT9 M;  2QEX F;  4NUT A;  1YJN F;  1RA4 A;  5HY0 A;  5EO3 A;  3CPQ A;  5FLX M;  5FJ4 C;  5DCV A;  4NQ3 A;  4BVT A;  1VQN F;  1VQ7 F;  1YIT F;  3J7A R;  1Q7Y H;  3D00 A;  1KC8 H;  4EI9 A;  2VGM A;  1GZ0 A;  1S72 F;  2OTJ F;  3J81 M;  3WXM B;  1Q86 H;  3G6E F;  3LWP C;  1NMU B;  5HY2 A;  3LFO A;  2AIF A;  3FFM A;  1VQ9 F;  1RLG A;  3CXC F;  3CME F;  3NVK E;  1VQ6 F;  5EWR A;  1Q82 H;  1CK2 A;  3E1Y A;  3V7E A;  1VQK F;  3JAM M;  1X52 A;  3OBW A;  3V3T A;  1VQ5 F;  1YI2 F;  2KTU A;  5GIO C;  1XBI A;  3G71 F;  3IR9 A;  3PLA C;  1VQO F;  1GO0 A;  3RA5 A;  5HWE A;  3CCM F;  3N4Z A;  2WAL A;  4BVR A;  3CCE F;  5GAN K;  3CC2 F;  3CPW F;  3N4Y A;  5HY1 A;  3RA6 A;  1YJW F;  1NJI H;  3CCL F;  1QVF F;  1Q81 H;  1QVG F;  4C4W C;  1K8A H;  3NMU C;  3SIV A;  3CG6 A;  1VQP F;  2LBX A;  4X3M A;  3J80 M;  1VQM F;  2BO1 A;  3PAF A;  4XCQ A;  1KD1 H;  3CCR F;  1M90 H;  4EI7 A;  1KQS F;  1YJ9 F;  2QA4 F;  5HXU A;  3G4S F;  3CCQ F;  5G4U C;  4BVS A;  3LWQ C;  3OW2 F;  3AGK A;  1W40 A;  2LBW A;  1X7O A;  3I55 F;  4TZZ A;  1E7K A;  3LWO C;  1VQ4 F;  1W2B F;  3NK6 A;  1H7M A;  3HJW C;  5HY4 A;  1VQ8 F;  1JJ2 F;  1X7P A;  3CMA F;  2FGY A;  4BVQ A;  1ZWZ A;  5GIN C;  3LWV C;  4BY9 D;  1M1K H;  1T0K B;  3CCS F;  5GAP K;  5GIP C;  2JNB A;  3JCM M;  3NVI B;  2F9Z C;  3MCA B;  2KG4 A;  1CN7 A;  4EI8 A;  2ALE A;  1N8R H;  3CCU F;  1IPA A;  1YIJ F;  1PXW A;  4LCK A;  2CZW A;  3CC7 F;  3CC4 F;  3NK7 A;  3SIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...