1W3EX

Ribosomal l30e of thermococcus celer, p59a mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIAVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Role of Proline Residues in Thermostability of T. Celer L30E Protein
rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w3eX00
1K8AH 1VQ6F 1IPAA 1YJ9F 2QI2A 1GO1A 3CCUF 1H7MA 5GIOC 3CPWF 1K73H 1NMUB 1M1KH 3J80M 3G71F 3RA5A 3CMAF 3JCMM 3VI6A 3SIUA 1VQ7F 2VGMA 4X3MA 1QVGF 3FFMA 2AIFA 5FLXM 3PLAC 1DT9A 3MCAB 3SIVA 3V7EA 4NUTA 2QEXF 3OW2F 3J81M 5GAPK 2KTUA 5G4UC 1YITF 2FC3A 5GINC 1YHQF 1W3EX 3HAXD 5GANK 3CCQF 3CPQA 1VQ8F 3LWVC 1N8RH 3CMEF 1PXWA 2HVYD 3CD6F 1GO0A 2BO1A 1VQKF 1VQ4F 4BY9D 3JAMM 1VQ9F 3NMUC 5G4VC 5DCVA 3G6EF 3CXCF 1KC8H 3CC2F 3RA6A 1Q82H 1W41A 5A2QM 1CK2A 2VGNA 1Q86H 2CZWA 5EO3A 2QA4F 1W42A 2KG4A 1VQ5F 1X52A 3NK7A 4X3LA 2LBWA 3LWPC 1T0KB 3WXMB 1GZ0A 3CCLF 3CC4F 4TZZA 3CCEF 1NJIH 5GIPC 1E7KA 1CN7A 3CCSF 3CG6A 4LCKA 1K9MH 5FJ4C 2KTVA 3AGKA 2OTJF 3LFOA 4BW0B 3I56F 1X7PA 2JNBA 5EWRA 2ALEA 3V7QA 2OHWA 3CCRF 1VQNF 3NVIB 3I55F 3O85A 3LWQC 1YJNF 1YI2F 3J7AR 1VQPF 1KD1H 2OZBA 2I6DA 3HJWC 1XBIA 1YIJF 1Q7YH 4C4WC 3OBYA 3E1YA 1VQOF 1ZWZA 1VQLF 1X7OA 3OBWA 1QVFF 3NVKE 3GYQA 3NK6A 1S72F 1KQSF 1SDSA 3G4SF 1Q81H 5IT9M 3LWOC 3N4ZA 3ON1A 3CC7F 3N4YA 3PAFA 3LWRC 3CCMF 1W2BF 3CCVF 1VQMF 1JJ2F 2WALA 1M90H 1YJWF 1RA4A 3CCJF 2LBXA 2OTLF 1RLGA 3E20B 1W40A 3IR9A 3VMFB
chains in the Genus database with same CATH superfamily
4BT4A 3C9SA 5C8YA 3HKBB 1H7MA 4ZI7A 3CPWF 3N2KA 1K73H 1M1KH 3P0ZA 1UFYA 5J2TA 4U3JB 4ZOLA 2LBTA 1R1MA 3K12A 3E22A 3FBAA 5HP7A 3JARA 5HXZA 5HP8A 2YYEA 5FLXM 2VAPA 5MN4A 5JH7B 2ZF8A 1QAHA 2HP3A 4IHJB 5IYZB 4TUYB 1YITF 1SZQA 2FC3A 2Z1EA 5GINC 3HAXD 3CCQF 1VQ8F 4DRXA 1JN1A 2HVYD 1Z5WA 4B5CA 2BO1A 4G4VA 2B33A 2ZOVA 3JAMM 1VQ9F 1XV2A 1IV1A 3RA6A 5HY0A 3RYFB 2IG8A 2IAFA 2BTOA 1W5BA 1YGYA 1J7HA 4U3JA 5BMVB 2L26A 2CHSA 4I50B 3NK7A 2UYNB 1T0KB 4BT5A 2CW4A 5JH7A 3CCLF 1GZ0A 4TZZA 5JQGB 1NJIH 5EZYB 4PWTA 5JCOC 2V9YA 3WPWA 5IYZA 4TUYA 4BT3A 3VYUC 4YJ2B 2OTJF 3LFOA 3V3TA 5GONA 1X7PA 3KE1A 2ALEA 3CCRF 1TVKB 5JVDB 5KX5B 2LCAA 4FFBB 1XRGA 3RYFA 3HJWC 1W5FA 3CYQA 4C4WC 3N2GB 5B8FA 5BMVA 4O4IA 1KNKA 5AVMA 3JVHA 3OONA 1VQOF 1ZWZA 4I50A 3F0DA 3Q8HA 3FD5A 3VYSC 4F6RB 1QVFF 2RHJA 1Q8RA 5EZYA 3G4SF 1Q81H 4O4JB 5IT9M 4EI9A 4YJ2A 4O4HB 1JJ2F 1RA4A 2R751 4EB6B 4G4XA 4HNAB 2DT4A 5LOVB 3VIUA 3N2KB 1IV3A 1TVKA 3IR9A 3QTYA 5CA1B 5KX5A 3L7QA 4O2AB 3S02A 5J2TB 1K8AH 1VQ6F 1IPAA 3JARB 3WPXA 2QI2A 5CB4A 2HQSC 2N48A 5GIOC 3HWUA 3C9TA 3VO8A 4BVRA 3IKEA 1QD9A 3C9RA 3N2GA 3SIUA 1VQ7F 2VGMA 4X3MA 1QVGF 4X1IB 1H47A 2AIFA 1W59A 4F6RA 2HS3A 3FD6A 3MCAB 3SIVA 3K2XA 3J81M 5GAPK 1FNJA 3C9UA 1YHQF 5HY4A 2H8EA 4EI8A 3ZP7A 4EB6A 4HNAA 5LOVA 3CMEF 1GO0A 1RLUA 4RQOA 2CHTA 5CA1A 4BY9D 4O2AA 5EB1B 5G4VC 2GLZA 3G6EF 3KJKA 3WJQA 2PMPA 2Q1YA 3JASB 1Q82H 2UYKA 3F0EA 4U39A 4RHAA 4C81A 1FNKA 3WGJA 1Q86H 4YJ3A 2CZWA 4ZHQB 3I7TA 1VQ5F 4X1IA 2UYPA 2LBWA 1H48A 3WXMB 5ITZB 2Z01A 5GONB 3QHDA 5KMGB 4LCKA 2BTQB 4C8IA 3KHNA 3AGKA 4G88A 5LXTB 1OFUA 3I56F 3JATB 3JAWA 2RHLA 4I55B 3S0YA 3V7QA 2HX0A 2OHWA 4I4TB 2ZAUA 3I55F 2H6LA 1TUBB 1YJNF 4DXDA 1YI2F 1VK3A 3J7AR 1KD1H 4O4IB 2OZBA 2AIZP 3RE3A 1U40A 3JASA 5CA0B 1XHOA 2UYJA 2ZVZA 3S03A 5LYJB 1XBIA 2Z1UA 1YIJF 1Q7YH 4TV9A 3E1YA 4ZHQA 2HS4A 2P6YA 1VQLF 1VHAA 2CWJA 3KJJA 3OBWA 5ITZA 3K14A 1S72F 2G9IA 4IIJA 2R6R1 3R0PA 5KMGA 3ON1A 5J2UA 5LXTA 2FGYA 1M90H 3JATA 3CCJF 3TD4A 2GZLA 4I55A 4ZHYB 5CB4B 4ERHA 3LYBA 4I4TA 3P4EA 1TUBA 1NQ3A 2RHOA 4LNUB 3VOBA 1GO1A 1JFFA 2HRUA 1NMUB 3DC2A 5CA0A 1JD1A 5LYJA 2QTPA 5FNVB 3VI6A 1W581 3FFMA 3TD3A 1DT9A 1U43A 3ZP4A 3WGNA 3JALA 1VH8A 3OW2F 5GANK 3UT5B 2W8BC 1N8RH 5LP6B 1PXWA 3EORA 1UI9A 1VQ4F 3IKFA 3QUWA 3P10A 5DCVA 1YQNA 4YJ3B 4LNUA 5MN6A 1VQVA 1W41A 3DDNA 1CK2A 3HKDA 2I6RA 3WGLA 3RYIA 2Q1XA 2VGNA 5FNVA 3T80A 2QA4F 1X52A 4G4WA 4X3LA 4C8GA 3LWPC 3CCEF 1IV2A 1RQ7A 1E7KA 4ZK7A 3U0OA 4BT2A 1CN7A 3JAWB 3C8LA 4BT7A 3CCSF 3HTNA 3CG6A 1K9MH 3LMEA 3V4DA 4C8EA 2KTVA 2UZHA 4BW0B 3M1XA 3F6MA 3UT5A 4WBNB 2JNBA 4KWEA 5EWRA 5LP6A 2ZODA 3D00A 1IV4A 2VAMA 3O85A 2EWCA 3LWQC 3K0TA 2VXYA 1OAPA 1CLIA 1JY8A 4TV9B 2Z1FA 3WGMA 2HS0A 5EIBD 3HKCB 2BTUA 2I6DA 1RQ2A 4G4ZA 4ZHWA 2F9ZC 1ONIA 3ERNA 1COMA 3ESJA 3OBYA 3CB2A 4IIJB 3F0GA 3S0WA 5EAZA 5LA6B 1X7OA 5J2UB 5IJ0B 3GYQA 3NK6A 3S0HA 1KQSF 1SDSA 2CSLA 4O4LB 3N4ZA 3CC7F 3PAFA 1W55A 3LWRC 3CCMF 3CCVF 1W2BF 1VQMF 4C82A 4BVTA 3D54A 4WBNA 3VOAA 2HP0A 1JFFB 3GHZA 3CD6F 2HRYA 3FPIA 4X1KB 1W5EA 1YJ9F 3KIZA 3CCUF 2AMTA 4BVSA 1X25A 3HKCA 2K1SA 2ZVYA 3J80M 3WGKA 3G71F 5HY1A 3HKBA 3RA5A 3I3FA 3JCMM 3CMAF 3JALB 4NWOB 3RYHB 2RHHA 3MBMA 3M84A 3PLAC 5LA6A 5IJ0A 4B45A 4BVQA 3V7EA 4TV8B 4NUTA 2QEXF 1FFXB 4O4LA 2KTUA 3BYQA 3IMPA 5HXUA 5G4UC 4X20B 4BT6A 2PHNA 3IEQA 1W3EX 2OTMA 4B62A 2CVLA 3CPQA 3IEWA 4IHJA 3LWVC 1T0AA 3JAKB 2Z1TA 1SA0B 4B46A 1VQKF 5LP6C 1PF5A 3NMUC 3HKDB 4X1KA 3RYIB 3CXCF 3M4SA 5EYPB 3CC2F 4EI7A 1KC8H 1KNJA 2H8CA 2MQEA 5A2QM 3VTIC 5EO3A 3RYHA 1W42A 4O2BB 2KG4A 2NMUA 2IQQA 4M8IA 4ZHVA 3CC4F 3MQWA 3ZOPA 2VAWA 5GIPC 4TV8A 3GTZA 4X1YB 5EIBC 3HKEB 1FFXA 2UYNA 3B6NA 5FJ4C 4NQ3A 4X20A 5IJ9B 5JQGA 4E6EA 1Z5VA 1W5AA 3JAKA 1SA0A 3RYCB 1VQNF 3NVIB 3ELCA 1U3PA 5C8YB 5EYPA 1VQPF 4G4YA 1FSZA 4ZI7B 3CYPB 4R40B 2YXZA 3D01A 3S06A 5JVDA 4ZOLB 5HY2A 3E22B 3LDTA 4FFBA 5EB0A 2GVIA 4O2BA 3MCQA 3ZO8A 1GX1A 3WJRA 1W57A 3NVKE 5JCOA 5MN5A 1DBFA 4X1YA 5HWEA 3HKEA 2RB9A 3MDOA 3TD5A 3LWOC 2HP0B 1U3LA 3N4YA 5IJ9A 2WALA 1YJWF 1QU9A 3WJPA 4DRXB 3VYTC 4O4JA 3F0FA 2LBXA 2OTLF 3VCZA 2DYYA 2KGWA 1ODEA 1RLGA 3RYCA 3E20B 4O4HA 1W40A 4XCQA 3VMFB
chains in the Genus database with same CATH topology
1K8AH 1VQ6F 1IPAA 1YJ9F 2QI2A 1GO1A 3CCUF 1H7MA 4BVSA 5GIOC 3CPWF 1K73H 1NMUB 1M1KH 4BVRA 3J80M 3G71F 5HY1A 3RA5A 3CMAF 3JCMM 5HXZA 3VI6A 3SIUA 1VQ7F 2VGMA 4X3MA 1QVGF 3FFMA 2AIFA 5FLXM 3PLAC 1DT9A 3MCAB 4BVQA 3SIVA 3V7EA 4NUTA 2QEXF 3OW2F 3J81M 5GAPK 2KTUA 5HXUA 5G4UC 1YITF 2FC3A 5GINC 3IR9A 1YHQF 1W3EX 3HAXD 5HY4A 5GANK 3CCQF 3CPQA 4EI8A 1VQ8F 3LWVC 1N8RH 3CMEF 1PXWA 2HVYD 3CD6F 1GO0A 2BO1A 1VQKF 1VQ4F 4BY9D 3JAMM 1VQ9F 3NMUC 5G4VC 5DCVA 2GLZA 3G6EF 3CXCF 1KC8H 3CC2F 4EI7A 3RA6A 5HY0A 1Q82H 1W41A 5A2QM 1CK2A 2VGNA 1Q86H 2CZWA 5EO3A 2QA4F 1W42A 2KG4A 1VQ5F 1X52A 3NK7A 4X3LA 2LBWA 3LWPC 1T0KB 3WXMB 1GZ0A 3CCLF 3CC4F 4TZZA 3CCEF 1NJIH 5GIPC 1E7KA 1CN7A 3CCSF 3CG6A 4LCKA 1K9MH 5FJ4C 2KTVA 3AGKA 4NQ3A 3LFOA 2OTJF 4BW0B 3I56F 3V3TA 1X7PA 2JNBA 5EWRA 2ALEA 3V7QA 2OHWA 3D00A 3CCRF 1VQNF 3NVIB 3I55F 3O85A 3LWQC 1YJNF 1YI2F 3J7AR 1VQPF 1KD1H 2OZBA 2I6DA 3HJWC 5HY2A 1XBIA 2F9ZC 1YIJF 1Q7YH 4C4WC 3OBYA 3E1YA 1VQOF 1ZWZA 1VQLF 1X7OA 3OBWA 1QVFF 3NVKE 3GYQA 3NK6A 1S72F 1KQSF 1SDSA 3G4SF 1Q81H 5HWEA 5IT9M 3LWOC 3N4ZA 4EI9A 3ON1A 3CC7F 3N4YA 3PAFA 3LWRC 3CCMF 1W2BF 3CCVF 2FGYA 1VQMF 1JJ2F 2WALA 1M90H 1YJWF 4BVTA 1RA4A 3CCJF 2LBXA 2OTLF 1RLGA 3E20B 1W40A 4XCQA 3VMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A H;  1VQ6 F;  1IPA A;  1YJ9 F;  2QI2 A;  1GO1 A;  3CCU F;  1H7M A;  5GIO C;  3CPW F;  1K73 H;  1NMU B;  1M1K H;  3J80 M;  3G71 F;  3RA5 A;  3CMA F;  3JCM M;  3VI6 A;  3SIU A;  1VQ7 F;  2VGM A;  4X3M A;  1QVG F;  3FFM A;  2AIF A;  5FLX M;  3PLA C;  1DT9 A;  3MCA B;  3SIV A;  3V7E A;  4NUT A;  2QEX F;  3OW2 F;  3J81 M;  5GAP K;  2KTU A;  5G4U C;  1YIT F;  2FC3 A;  5GIN C;  1YHQ F;  1W3E X;  3HAX D;  5GAN K;  3CCQ F;  3CPQ A;  1VQ8 F;  3LWV C;  1N8R H;  3CME F;  1PXW A;  2HVY D;  3CD6 F;  1GO0 A;  2BO1 A;  1VQK F;  1VQ4 F;  4BY9 D;  3JAM M;  1VQ9 F;  3NMU C;  5G4V C;  5DCV A;  3G6E F;  3CXC F;  1KC8 H;  3CC2 F;  3RA6 A;  1Q82 H;  1W41 A;  5A2Q M;  1CK2 A;  2VGN A;  1Q86 H;  2CZW A;  5EO3 A;  2QA4 F;  1W42 A;  2KG4 A;  1VQ5 F;  1X52 A;  3NK7 A;  4X3L A;  2LBW A;  3LWP C;  1T0K B;  3WXM B;  1GZ0 A;  3CCL F;  3CC4 F;  4TZZ A;  3CCE F;  1NJI H;  5GIP C;  1E7K A;  1CN7 A;  3CCS F;  3CG6 A;  4LCK A;  1K9M H;  5FJ4 C;  2KTV A;  3AGK A;  2OTJ F;  3LFO A;  4BW0 B;  3I56 F;  1X7P A;  2JNB A;  5EWR A;  2ALE A;  3V7Q A;  2OHW A;  3CCR F;  1VQN F;  3NVI B;  3I55 F;  3O85 A;  3LWQ C;  1YJN F;  1YI2 F;  3J7A R;  1VQP F;  1KD1 H;  2OZB A;  2I6D A;  3HJW C;  1XBI A;  1YIJ F;  1Q7Y H;  4C4W C;  3OBY A;  3E1Y A;  1VQO F;  1ZWZ A;  1VQL F;  1X7O A;  3OBW A;  1QVF F;  3NVK E;  3GYQ A;  3NK6 A;  1S72 F;  1KQS F;  1SDS A;  3G4S F;  1Q81 H;  5IT9 M;  3LWO C;  3N4Z A;  3ON1 A;  3CC7 F;  3N4Y A;  3PAF A;  3LWR C;  3CCM F;  1W2B F;  3CCV F;  1VQM F;  1JJ2 F;  2WAL A;  1M90 H;  1YJW F;  1RA4 A;  3CCJ F;  2LBX A;  2OTL F;  1RLG A;  3E20 B;  1W40 A;  3IR9 A;  3VMF B; 
#chains in the Genus database with same CATH topology
 4BT4 A;  3C9S A;  5C8Y A;  3HKB B;  1H7M A;  4ZI7 A;  3CPW F;  3N2K A;  1K73 H;  1M1K H;  3P0Z A;  1UFY A;  5J2T A;  4U3J B;  4ZOL A;  2LBT A;  1R1M A;  3K12 A;  3E22 A;  3FBA A;  5HP7 A;  3JAR A;  5HXZ A;  5HP8 A;  2YYE A;  5FLX M;  2VAP A;  5MN4 A;  5JH7 B;  2ZF8 A;  1QAH A;  2HP3 A;  4IHJ B;  5IYZ B;  4TUY B;  1YIT F;  1SZQ A;  2FC3 A;  2Z1E A;  5GIN C;  3HAX D;  3CCQ F;  1VQ8 F;  4DRX A;  1JN1 A;  2HVY D;  1Z5W A;  4B5C A;  2BO1 A;  4G4V A;  2B33 A;  2ZOV A;  3JAM M;  1VQ9 F;  1XV2 A;  1IV1 A;  3RA6 A;  5HY0 A;  3RYF B;  2IG8 A;  2IAF A;  2BTO A;  1W5B A;  1YGY A;  1J7H A;  4U3J A;  5BMV B;  2L26 A;  2CHS A;  4I50 B;  3NK7 A;  2UYN B;  1T0K B;  4BT5 A;  2CW4 A;  5JH7 A;  3CCL F;  1GZ0 A;  4TZZ A;  5JQG B;  1NJI H;  5EZY B;  4PWT A;  5JCO C;  2V9Y A;  3WPW A;  5IYZ A;  4TUY A;  4BT3 A;  3VYU C;  4YJ2 B;  2OTJ F;  3LFO A;  3V3T A;  5GON A;  1X7P A;  3KE1 A;  2ALE A;  3CCR F;  1TVK B;  5JVD B;  5KX5 B;  2LCA A;  4FFB B;  1XRG A;  3RYF A;  3HJW C;  1W5F A;  3CYQ A;  4C4W C;  3N2G B;  5B8F A;  5BMV A;  4O4I A;  1KNK A;  5AVM A;  3JVH A;  3OON A;  1VQO F;  1ZWZ A;  4I50 A;  3F0D A;  3Q8H A;  3FD5 A;  3VYS C;  4F6R B;  1QVF F;  2RHJ A;  1Q8R A;  5EZY A;  3G4S F;  1Q81 H;  4O4J B;  5IT9 M;  4EI9 A;  4YJ2 A;  4O4H B;  1JJ2 F;  1RA4 A;  2R75 1;  4EB6 B;  4G4X A;  4HNA B;  2DT4 A;  5LOV B;  3VIU A;  3N2K B;  1IV3 A;  1TVK A;  3IR9 A;  3QTY A;  5CA1 B;  5KX5 A;  3L7Q A;  4O2A B;  3S02 A;  5J2T B;  1K8A H;  1VQ6 F;  1IPA A;  3JAR B;  3WPX A;  2QI2 A;  5CB4 A;  2HQS C;  2N48 A;  5GIO C;  3HWU A;  3C9T A;  3VO8 A;  4BVR A;  3IKE A;  1QD9 A;  3C9R A;  3N2G A;  3SIU A;  1VQ7 F;  2VGM A;  4X3M A;  1QVG F;  4X1I B;  1H47 A;  2AIF A;  1W59 A;  4F6R A;  2HS3 A;  3FD6 A;  3MCA B;  3SIV A;  3K2X A;  3J81 M;  5GAP K;  1FNJ A;  3C9U A;  1YHQ F;  5HY4 A;  2H8E A;  4EI8 A;  3ZP7 A;  4EB6 A;  4HNA A;  5LOV A;  3CME F;  1GO0 A;  1RLU A;  4RQO A;  2CHT A;  5CA1 A;  4BY9 D;  4O2A A;  5EB1 B;  5G4V C;  2GLZ A;  3G6E F;  3KJK A;  3WJQ A;  2PMP A;  2Q1Y A;  3JAS B;  1Q82 H;  2UYK A;  3F0E A;  4U39 A;  4RHA A;  4C81 A;  1FNK A;  3WGJ A;  1Q86 H;  4YJ3 A;  2CZW A;  4ZHQ B;  3I7T A;  1VQ5 F;  4X1I A;  2UYP A;  2LBW A;  1H48 A;  3WXM B;  5ITZ B;  2Z01 A;  5GON B;  3QHD A;  5KMG B;  4LCK A;  2BTQ B;  4C8I A;  3KHN A;  3AGK A;  4G88 A;  5LXT B;  1OFU A;  3I56 F;  3JAT B;  3JAW A;  2RHL A;  4I55 B;  3S0Y A;  3V7Q A;  2HX0 A;  2OHW A;  4I4T B;  2ZAU A;  3I55 F;  2H6L A;  1TUB B;  1YJN F;  4DXD A;  1YI2 F;  1VK3 A;  3J7A R;  1KD1 H;  4O4I B;  2OZB A;  2AIZ P;  3RE3 A;  1U40 A;  3JAS A;  5CA0 B;  1XHO A;  2UYJ A;  2ZVZ A;  3S03 A;  5LYJ B;  1XBI A;  2Z1U A;  1YIJ F;  1Q7Y H;  4TV9 A;  3E1Y A;  4ZHQ A;  2HS4 A;  2P6Y A;  1VQL F;  1VHA A;  2CWJ A;  3KJJ A;  3OBW A;  5ITZ A;  3K14 A;  1S72 F;  2G9I A;  4IIJ A;  2R6R 1;  3R0P A;  5KMG A;  3ON1 A;  5J2U A;  5LXT A;  2FGY A;  1M90 H;  3JAT A;  3CCJ F;  3TD4 A;  2GZL A;  4I55 A;  4ZHY B;  5CB4 B;  4ERH A;  3LYB A;  4I4T A;  3P4E A;  1TUB A;  1NQ3 A;  2RHO A;  4LNU B;  3VOB A;  1GO1 A;  1JFF A;  2HRU A;  1NMU B;  3DC2 A;  5CA0 A;  1JD1 A;  5LYJ A;  2QTP A;  5FNV B;  3VI6 A;  1W58 1;  3FFM A;  3TD3 A;  1DT9 A;  1U43 A;  3ZP4 A;  3WGN A;  3JAL A;  1VH8 A;  3OW2 F;  5GAN K;  3UT5 B;  2W8B C;  1N8R H;  5LP6 B;  1PXW A;  3EOR A;  1UI9 A;  1VQ4 F;  3IKF A;  3QUW A;  3P10 A;  5DCV A;  1YQN A;  4YJ3 B;  4LNU A;  5MN6 A;  1VQV A;  1W41 A;  3DDN A;  1CK2 A;  3HKD A;  2I6R A;  3WGL A;  3RYI A;  2Q1X A;  2VGN A;  5FNV A;  3T80 A;  2QA4 F;  1X52 A;  4G4W A;  4X3L A;  4C8G A;  3LWP C;  3CCE F;  1IV2 A;  1RQ7 A;  1E7K A;  4ZK7 A;  3U0O A;  4BT2 A;  1CN7 A;  3JAW B;  3C8L A;  4BT7 A;  3CCS F;  3HTN A;  3CG6 A;  1K9M H;  3LME A;  3V4D A;  4C8E A;  2KTV A;  2UZH A;  4BW0 B;  3M1X A;  3F6M A;  3UT5 A;  4WBN B;  2JNB A;  4KWE A;  5EWR A;  5LP6 A;  2ZOD A;  3D00 A;  1IV4 A;  2VAM A;  3O85 A;  2EWC A;  3LWQ C;  3K0T A;  2VXY A;  1OAP A;  1CLI A;  1JY8 A;  4TV9 B;  2Z1F A;  3WGM A;  2HS0 A;  5EIB D;  3HKC B;  2BTU A;  2I6D A;  1RQ2 A;  4G4Z A;  4ZHW A;  2F9Z C;  1ONI A;  3ERN A;  1COM A;  3ESJ A;  3OBY A;  3CB2 A;  4IIJ B;  3F0G A;  3S0W A;  5EAZ A;  5LA6 B;  1X7O A;  5J2U B;  5IJ0 B;  3GYQ A;  3NK6 A;  3S0H A;  1KQS F;  1SDS A;  2CSL A;  4O4L B;  3N4Z A;  3CC7 F;  3PAF A;  1W55 A;  3LWR C;  3CCM F;  3CCV F;  1W2B F;  1VQM F;  4C82 A;  4BVT A;  3D54 A;  4WBN A;  3VOA A;  2HP0 A;  1JFF B;  3GHZ A;  3CD6 F;  2HRY A;  3FPI A;  4X1K B;  1W5E A;  1YJ9 F;  3KIZ A;  3CCU F;  2AMT A;  4BVS A;  1X25 A;  3HKC A;  2K1S A;  2ZVY A;  3J80 M;  3WGK A;  3G71 F;  5HY1 A;  3HKB A;  3RA5 A;  3I3F A;  3JCM M;  3CMA F;  3JAL B;  4NWO B;  3RYH B;  2RHH A;  3MBM A;  3M84 A;  3PLA C;  5LA6 A;  5IJ0 A;  4B45 A;  4BVQ A;  3V7E A;  4TV8 B;  4NUT A;  2QEX F;  1FFX B;  4O4L A;  2KTU A;  3BYQ A;  3IMP A;  5HXU A;  5G4U C;  4X20 B;  4BT6 A;  2PHN A;  3IEQ A;  1W3E X;  2OTM A;  4B62 A;  2CVL A;  3CPQ A;  3IEW A;  4IHJ A;  3LWV C;  1T0A A;  3JAK B;  2Z1T A;  1SA0 B;  4B46 A;  1VQK F;  5LP6 C;  1PF5 A;  3NMU C;  3HKD B;  4X1K A;  3RYI B;  3CXC F;  3M4S A;  5EYP B;  3CC2 F;  4EI7 A;  1KC8 H;  1KNJ A;  2H8C A;  2MQE A;  5A2Q M;  3VTI C;  5EO3 A;  3RYH A;  1W42 A;  4O2B B;  2KG4 A;  2NMU A;  2IQQ A;  4M8I A;  4ZHV A;  3CC4 F;  3MQW A;  3ZOP A;  2VAW A;  5GIP C;  4TV8 A;  3GTZ A;  4X1Y B;  5EIB C;  3HKE B;  1FFX A;  2UYN A;  3B6N A;  5FJ4 C;  4NQ3 A;  4X20 A;  5IJ9 B;  5JQG A;  4E6E A;  1Z5V A;  1W5A A;  3JAK A;  1SA0 A;  3RYC B;  1VQN F;  3NVI B;  3ELC A;  1U3P A;  5C8Y B;  5EYP A;  1VQP F;  4G4Y A;  1FSZ A;  4ZI7 B;  3CYP B;  4R40 B;  2YXZ A;  3D01 A;  3S06 A;  5JVD A;  4ZOL B;  5HY2 A;  3E22 B;  3LDT A;  4FFB A;  5EB0 A;  2GVI A;  4O2B A;  3MCQ A;  3ZO8 A;  1GX1 A;  3WJR A;  1W57 A;  3NVK E;  5JCO A;  5MN5 A;  1DBF A;  4X1Y A;  5HWE A;  3HKE A;  2RB9 A;  3MDO A;  3TD5 A;  3LWO C;  2HP0 B;  1U3L A;  3N4Y A;  5IJ9 A;  2WAL A;  1YJW F;  1QU9 A;  3WJP A;  4DRX B;  3VYT C;  4O4J A;  3F0F A;  2LBX A;  2OTL F;  3VCZ A;  2DYY A;  2KGW A;  1ODE A;  1RLG A;  3RYC A;  3E20 B;  4O4H A;  1W40 A;  4XCQ A;  3VMF B; 
#chains in the Genus database with same CATH homology
 1K8A H;  1VQ6 F;  1IPA A;  1YJ9 F;  2QI2 A;  1GO1 A;  3CCU F;  1H7M A;  4BVS A;  5GIO C;  3CPW F;  1K73 H;  1NMU B;  1M1K H;  4BVR A;  3J80 M;  3G71 F;  5HY1 A;  3RA5 A;  3CMA F;  3JCM M;  5HXZ A;  3VI6 A;  3SIU A;  1VQ7 F;  2VGM A;  4X3M A;  1QVG F;  3FFM A;  2AIF A;  5FLX M;  3PLA C;  1DT9 A;  3MCA B;  4BVQ A;  3SIV A;  3V7E A;  4NUT A;  2QEX F;  3OW2 F;  3J81 M;  5GAP K;  2KTU A;  5HXU A;  5G4U C;  1YIT F;  2FC3 A;  5GIN C;  3IR9 A;  1YHQ F;  1W3E X;  3HAX D;  5HY4 A;  5GAN K;  3CCQ F;  3CPQ A;  4EI8 A;  1VQ8 F;  3LWV C;  1N8R H;  3CME F;  1PXW A;  2HVY D;  3CD6 F;  1GO0 A;  2BO1 A;  1VQK F;  1VQ4 F;  4BY9 D;  3JAM M;  1VQ9 F;  3NMU C;  5G4V C;  5DCV A;  2GLZ A;  3G6E F;  3CXC F;  1KC8 H;  3CC2 F;  4EI7 A;  3RA6 A;  5HY0 A;  1Q82 H;  1W41 A;  5A2Q M;  1CK2 A;  2VGN A;  1Q86 H;  2CZW A;  5EO3 A;  2QA4 F;  1W42 A;  2KG4 A;  1VQ5 F;  1X52 A;  3NK7 A;  4X3L A;  2LBW A;  3LWP C;  1T0K B;  3WXM B;  1GZ0 A;  3CCL F;  3CC4 F;  4TZZ A;  3CCE F;  1NJI H;  5GIP C;  1E7K A;  1CN7 A;  3CCS F;  3CG6 A;  4LCK A;  1K9M H;  5FJ4 C;  2KTV A;  3AGK A;  4NQ3 A;  3LFO A;  2OTJ F;  4BW0 B;  3I56 F;  3V3T A;  1X7P A;  2JNB A;  5EWR A;  2ALE A;  3V7Q A;  2OHW A;  3D00 A;  3CCR F;  1VQN F;  3NVI B;  3I55 F;  3O85 A;  3LWQ C;  1YJN F;  1YI2 F;  3J7A R;  1VQP F;  1KD1 H;  2OZB A;  2I6D A;  3HJW C;  5HY2 A;  1XBI A;  2F9Z C;  1YIJ F;  1Q7Y H;  4C4W C;  3OBY A;  3E1Y A;  1VQO F;  1ZWZ A;  1VQL F;  1X7O A;  3OBW A;  1QVF F;  3NVK E;  3GYQ A;  3NK6 A;  1S72 F;  1KQS F;  1SDS A;  3G4S F;  1Q81 H;  5HWE A;  5IT9 M;  3LWO C;  3N4Z A;  4EI9 A;  3ON1 A;  3CC7 F;  3N4Y A;  3PAF A;  3LWR C;  3CCM F;  1W2B F;  3CCV F;  2FGY A;  1VQM F;  1JJ2 F;  2WAL A;  1M90 H;  1YJW F;  4BVT A;  1RA4 A;  3CCJ F;  2LBX A;  2OTL F;  1RLG A;  3E20 B;  1W40 A;  4XCQ A;  3VMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...