1W3EX

Ribosomal l30e of thermococcus celer, p59a mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIAVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of Proline Residues in Thermostability of T. Celer L30E Protein
rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w3eX00
3O85A 1K9MH 3LWQC 2QI2A 2AIFA 3N4ZA 1VQOF 1YJNF 1Q7YH 3NK7A 1QVFF 1GO0A 1VQ8F 3RA5A 3HJWC 5G4UC 5IT9M 1X7PA 2OTLF 5GANK 3CXCF 2QA4F 3V7QA 2FC3A 4X3LA 5GINC 1CN7A 1RA4A 3VI6A 1DT9A 1M1KH 3CCUF 3NK6A 1CK2A 3LWVC 1YIJF 3PAFA 4C4WC 1Q81H 1XBIA 1VQ6F 1VQMF 3CCLF 1YJ9F 1VQPF 2JNBA 3CG6A 3OBYA 1K8AH 2LBXA 2VGNA 3G71F 3CCJF 1Q82H 2OZBA 3FFMA 2QEXF 1GO1A 3ON1A 3CCRF 1W42A 5DCVA 1PXWA 2ALEA 3CD6F 5G4VC 3LFOA 1QVGF 3E20B 1SDSA 1S72F 1VQKF 3J80M 5EWRA 5GIPC 5A2QM 1X52A 3LWRC 1VQ4F 2VGMA 1N8RH 3J81M 1RLGA 1W3EX 3CC7F 1W2BF 3V7EA 2LBWA 4LCKA 1VQNF 2OTJF 3I56F 1KQSF 5GIOC 1VQLF 1NMUB 1Q86H 1JJ2F 3GYQA 1ZWZA 1IPAA 1H7MA 3CC4F 3G4SF 3CCMF 5FLXM 5FJ4C 3HAXD 2HVYD 3J7AR 3CPWF 3SIVA 1NJIH 1X7OA 5GAPK 4NUTA 3AGKA 3OBWA 3CCVF 1YHQF 4X3MA 2KG4A 3VMFB 3RA6A 3OW2F 1K73H 1VQ5F 3I55F 2WALA 1YI2F 3CMEF 2I6DA 3NVKE 1M90H 1T0KB 1YITF 3CCQF 4BY9D 1W40A 1KD1H 1E7KA 3NVIB 3LWPC 4BW0B 3WXMB 3CCEF 1YJWF 3NMUC 3SIUA 2BO1A 3G6EF 1VQ7F 3CCSF 1W41A 3LWOC 1VQ9F 3JAMM 3CC2F 3PLAC 3CPQA 1KC8H 3MCAB 4TZZA 2OHWA 1GZ0A 3JCMM 3IR9A 3N4YA 5EO3A 3CMAF 2KTUA 2CZWA 2KTVA 3E1YA
chains in the Genus database with same CATH superfamily
3HKBB 3WGNA 5EAZA 3WGMA 3N4ZA 3HKEA 3LYBA 4X1IA 4RQOA 1QVFF 3HKBA 3MDOA 4NWOB 4O2BB 1KNKA 4O2AA 3S0HA 3WGLA 2OTLF 4C81A 1IV2A 3D01A 2HS3A 1SA0B 2K1SA 3D54A 1DBFA 4O4LB 5LP6B 1RA4A 5KX5A 5HY1A 1R1MA 3RYIA 1CK2A 3LWVC 2ZAUA 1XBIA 1Q81H 1VQ6F 1W5AA 2UYKA 5MN4A 1RQ2A 4C82A 4IHJB 1VH8A 1Q82H 2QEXF 1GO1A 1IV4A 3N2GB 5EB1B 5LYJA 3ON1A 3CCRF 1W55A 5GONB 1PXWA 2G9IA 3CD6F 4ERHA 1PF5A 2OTMA 2CSLA 5EB0A 1QVGF 3R0PA 5LOVA 5LXTA 1SZQA 4I4TB 3HKCA 1VQKF 5IJ0A 3JAKB 3RYHB 5A2QM 2HP0B 5FNVB 2H8CA 2LBWA 3F0DA 1KNJA 4O4JB 1TUBA 1VQNF 4ZK7A 3JASA 4E6EA 3U0OA 4BT2A 1Q86H 2ZVYA 2Z1FA 1JJ2F 3GYQA 4U39A 4O4IA 4BT3A 3G4SF 4B46A 2UYJA 4X20A 4BT7A 1JD1A 5EZYB 3VYSC 3VOBA 4U3JA 3ZO8A 1X7OA 3AGKA 3CCVF 2IG8A 3OW2F 3WJQA 2RHOA 3IEWA 4G4XA 5MN6A 3I55F 3MQWA 5J2UA 5IYZA 2I6DA 3TD4A 3NVKE 2UYNA 1FNKA 5IJ0B 1W5EA 5LOVB 2Z1EA 5LXTB 3RYCA 3CCQF 3NVIB 1T0AA 2IQQA 4ZOLB 4TUYA 3IKFA 4I55A 4M8IA 3CCSF 5MN5A 2HX0A 3VO8A 3JAMM 3WJPA 3PLAC 3CPQA 3V4DA 3MCAB 4KWEA 4FFBA 2OHWA 3JASB 3IKEA 2W8BC 3N4YA 3CMAF 5EO3A 5LA6B 2RHHA 2CZWA 3JATB 5HXZA 2PMPA 3LMEA 3O85A 4HNAB 4BT4A 5KMGB 4O4LA 4ZI7A 2CVLA 5LA6A 1YJNF 2EWCA 1YGYA 4B45A 4ZOLA 2YXZA 3HKCB 3WGJA 4TV8B 2DT4A 5JH7A 1NQ3A 3V7QA 5GINC 1CN7A 4DRXB 2YYEA 3NK6A 3QTYA 1YIJF 1CLIA 3B6NA 3CCLF 2HQSC 3HWUA 3ZP7A 3IEQA 2OZBA 2HP3A 3UT5B 3CB2A 4X1YB 2ALEA 3TD3A 3HTNA 5G4VC 3JALA 3LFOA 3WGKA 3JAKA 3RYHA 1COMA 5EWRA 3J80M 3K12A 4I50B 2Q1YA 3JVHA 1N8RH 3J81M 5IYZB 3C9UA 2RHJA 1W2BF 3V7EA 3E22B 5JH7B 1GX1A 1W581 4O2BA 2LBTA 5C8YA 4BVQA 2HS4A 3FD5A 2OTJF 1U40A 1H47A 2FGYA 1KQSF 3JAWB 1NMUB 3M84A 2LCAA 4YJ3A 1FFXA 2BTOA 3CCMF 4O4IB 2MQEA 5FLXM 2BTUA 1VHAA 4EB6A 3S03A 3HAXD 3J7AR 3JAWA 4ZHVA 3CPWF 2B33A 5EYPA 4IIJA 4NUTA 1Z5VA 2ZVZA 1YI2F 5LP6A 1W5FA 5FNVA 4R40B 4WBNB 5JCOA 1M90H 3MBMA 5HP8A 5JVDA 1KD1H 4BW0B 4O2AB 1YJWF 3ESJA 4LNUB 3SIUA 2V9YA 3G6EF 2F9ZC 1RLUA 3HKDA 4X1KB 3Q8HA 5JCOC 4G4VA 3JALB 3N2GA 1KC8H 3RE3A 4TZZA 5HY0A 3F6MA 5EIBC 5CA0B 2H8EA 3VOAA 3LWQC 2UZHA 4HNAA 3KHNA 2QI2A 1TVKB 4ZHYB 1RQ7A 1XHOA 1FSZA 1VQOF 1U3LA 5BMVB 4O4HB 1Q7YH 1XV2A 1VQ8F 1JFFA 3RA5A 1ODEA 5IT9M 1X7PA 2AIZP 3CXCF 1VK3A 3OONA 2QA4F 1TUBB 2Z1TA 4TV8A 2FC3A 2ZF8A 2ZOVA 4YJ3B 4TV9A 2RHLA 4I4TA 3F0GA 3N2KB 3RYFA 4G88A 4B62A 1VQMF 3M4SA 3JARB 2JNBA 5EIBD 1K8AH 5GONA 2LBXA 2VGNA 2CWJA 3TD5A 1UFYA 3ZP4A 3G71F 5EZYA 5KMGA 3FFMA 3V3TA 1Q8RA 3S02A 2PHNA 4ZI7B 3P10A 3P4EA 2VAMA 2VAWA 3S06A 2AMTA 3F0EA 1SDSA 3S0WA 4IIJB 4ZHQB 1S72F 3DDNA 2VXYA 5AVMA 3C9SA 3EORA 5GIPC 2GVIA 2R751 1X52A 4O4HA 3LWRC 1RLGA 2Z1UA 2L26A 3VIUA 1JFFB 2RB9A 3CC7F 1W5BA 1QAHA 2VAPA 3D00A 3ERNA 4BT6A 3KIZA 5HXUA 5J2UB 3E22A 3ZOPA 1SA0A 3C9TA 3DC2A 4DXDA 5J2TA 4TV9B 3KE1A 1FNJA 3CYPB 3N2KA 3S0YA 3WPWA 3JARA 5J2TB 3T80A 1IPAA 2CHSA 4BT5A 3QHDA 2Z01A 1XRGA 4BVSA 1W57A 4LNUA 3QUWA 1NJIH 3JATA 5GAPK 3RYIB 4X3MA 2KG4A 1Z5WA 2GLZA 3WJRA 1K73H 2BTQB 3K2XA 4C8EA 4XCQA 4RHAA 5LP6C 2DYYA 1U3PA 1X25A 4ZHQA 4BY9D 1W40A 4EI9A 5HP7A 3LWPC 4BVTA 3WXMB 4C8GA 5IJ9A 2HP0A 2HS0A 3C9RA 2BO1A 1VQ7F 3BYQA 3LWOC 1VQ9F 4X1KA 1GZ0A 4DRXA 4I55B 3IR9A 2CHTA 2KTUA 3FD6A 5JVDB 1YQNA 3KJJA 1K9MH 2AIFA 3HKEB 3LDTA 4I50A 3NK7A 3VYUC 1GO0A 4X20B 3HJWC 5G4UC 1FFXB 3VCZA 4ZHWA 3L7QA 1VQVA 1OAPA 5GANK 3IMPA 5CA0A 2ZODA 4YJ2B 4X3LA 1TVKA 3F0FA 3VI6A 1DT9A 1M1KH 5CA1A 5KX5B 3CCUF 2HRYA 3VYTC 4C4WC 3PAFA 2P6YA 1H48A 4NQ3A 3RYCB 4EI7A 1YJ9F 1VQPF 3OBYA 3CG6A 2R6R1 5HWEA 3CCJF 1JN1A 5C8YB 4C8IA 4EI8A 5JQGB 2IAFA 3KJKA 1W42A 3K14A 3ELCA 5DCVA 3RYFB 2CW4A 3FBAA 1W59A 4WBNA 3E20B 5HY2A 4U3JB 3UT5A 1UI9A 2KGWA 5CA1B 4EB6B 1VQ4F 2VGMA 4F6RB 5ITZA 5EYPB 1W3EX 4PWTA 4G4YA 5BMVA 4BVRA 4LCKA 4O4JA 4YJ2A 5CB4A 3MCQA 3GTZA 2N48A 5HY4A 3I7TA 3VTIC 3I56F 5GIOC 3K0TA 1VQLF 3P0ZA 4FFBB 1ZWZA 4X1IB 1H7MA 3CC4F 3FPIA 1JY8A 1U43A 1ONIA 5FJ4C 2HVYD 2Q1XA 1J7HA 1IV3A 2I6RA 4TUYB 1IV1A 2UYPA 3SIVA 3WPXA 1YHQF 5JQGA 3OBWA 3CYQA 3VMFB 3RA6A 1VQ5F 2WALA 4X1YA 5CB4B 2QTPA 3CMEF 4G4ZA 2GZLA 5LYJB 1T0KB 1YITF 1QU9A 2NMUA 3I3FA 5B8FA 5IJ9B 1E7KA 4F6RA 5ITZB 3CCEF 3M1XA 3NMUC 4G4WA 1W41A 4IHJA 3CC2F 3C8LA 4B5CA 1OFUA 2UYNB 3GHZA 3JCMM 2H6LA 2HRUA 2KTVA 3HKDB 1QD9A 3E1YA
chains in the Genus database with same CATH topology
3O85A 1K9MH 3LWQC 2QI2A 2AIFA 3N4ZA 1VQOF 1YJNF 1Q7YH 3NK7A 1QVFF 1GO0A 1VQ8F 3RA5A 3HJWC 5G4UC 5IT9M 1X7PA 2OTLF 5GANK 3CXCF 2QA4F 3V7QA 2FC3A 4X3LA 5GINC 1CN7A 1RA4A 3VI6A 5HY1A 1DT9A 1M1KH 3CCUF 3NK6A 1CK2A 3LWVC 1YIJF 3PAFA 4C4WC 1Q81H 1XBIA 1VQ6F 4NQ3A 1VQMF 4EI7A 3CCLF 1YJ9F 1VQPF 2JNBA 3CG6A 3OBYA 1K8AH 2LBXA 2VGNA 5HWEA 3G71F 3CCJF 1Q82H 2OZBA 3FFMA 3V3TA 1GO1A 2QEXF 4EI8A 3ON1A 3CCRF 1W42A 5DCVA 1PXWA 2ALEA 3CD6F 5G4VC 3LFOA 1QVGF 3E20B 1SDSA 5HY2A 1S72F 1VQKF 3J80M 5EWRA 5GIPC 5A2QM 1X52A 3LWRC 1VQ4F 2VGMA 1N8RH 3J81M 1RLGA 1W3EX 3CC7F 1W2BF 3V7EA 2LBWA 3D00A 4BVRA 4LCKA 5HXUA 1VQNF 4BVQA 5HY4A 2OTJF 3I56F 2FGYA 1KQSF 5GIOC 1VQLF 1NMUB 1Q86H 1JJ2F 3GYQA 1ZWZA 1IPAA 1H7MA 3CC4F 3G4SF 3CCMF 5FLXM 5FJ4C 3HAXD 2HVYD 4BVSA 3J7AR 3CPWF 3SIVA 1NJIH 1X7OA 4NUTA 3AGKA 5GAPK 3OBWA 3CCVF 1YHQF 4X3MA 2KG4A 2GLZA 3RA6A 3VMFB 3OW2F 1K73H 1VQ5F 3I55F 2WALA 1YI2F 4XCQA 3CMEF 2I6DA 3NVKE 1M90H 1T0KB 1YITF 3CCQF 4BY9D 1W40A 4EI9A 1KD1H 1E7KA 3LWPC 3NVIB 4BW0B 3WXMB 4BVTA 3CCEF 1YJWF 3NMUC 3SIUA 2BO1A 3G6EF 2F9ZC 1VQ7F 3CCSF 1W41A 3LWOC 1VQ9F 3JAMM 3CC2F 3PLAC 3CPQA 1KC8H 3MCAB 4TZZA 2OHWA 1GZ0A 5HY0A 3JCMM 3IR9A 3N4YA 5EO3A 3CMAF 2KTUA 2CZWA 5HXZA 2KTVA 3E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O85 A;  1K9M H;  3LWQ C;  2QI2 A;  2AIF A;  3N4Z A;  1VQO F;  1YJN F;  1Q7Y H;  3NK7 A;  1QVF F;  1GO0 A;  1VQ8 F;  3RA5 A;  3HJW C;  5G4U C;  5IT9 M;  1X7P A;  2OTL F;  5GAN K;  3CXC F;  2QA4 F;  3V7Q A;  2FC3 A;  4X3L A;  5GIN C;  1CN7 A;  1RA4 A;  3VI6 A;  1DT9 A;  1M1K H;  3CCU F;  3NK6 A;  1CK2 A;  3LWV C;  1YIJ F;  3PAF A;  4C4W C;  1Q81 H;  1XBI A;  1VQ6 F;  1VQM F;  3CCL F;  1YJ9 F;  1VQP F;  2JNB A;  3CG6 A;  3OBY A;  1K8A H;  2LBX A;  2VGN A;  3G71 F;  3CCJ F;  1Q82 H;  2OZB A;  3FFM A;  2QEX F;  1GO1 A;  3ON1 A;  3CCR F;  1W42 A;  5DCV A;  1PXW A;  2ALE A;  3CD6 F;  5G4V C;  3LFO A;  1QVG F;  3E20 B;  1SDS A;  1S72 F;  1VQK F;  3J80 M;  5EWR A;  5GIP C;  5A2Q M;  1X52 A;  3LWR C;  1VQ4 F;  2VGM A;  1N8R H;  3J81 M;  1RLG A;  1W3E X;  3CC7 F;  1W2B F;  3V7E A;  2LBW A;  4LCK A;  1VQN F;  2OTJ F;  3I56 F;  1KQS F;  5GIO C;  1VQL F;  1NMU B;  1Q86 H;  1JJ2 F;  3GYQ A;  1ZWZ A;  1IPA A;  1H7M A;  3CC4 F;  3G4S F;  3CCM F;  5FLX M;  5FJ4 C;  3HAX D;  2HVY D;  3J7A R;  3CPW F;  3SIV A;  1NJI H;  1X7O A;  5GAP K;  4NUT A;  3AGK A;  3OBW A;  3CCV F;  1YHQ F;  4X3M A;  2KG4 A;  3VMF B;  3RA6 A;  3OW2 F;  1K73 H;  1VQ5 F;  3I55 F;  2WAL A;  1YI2 F;  3CME F;  2I6D A;  3NVK E;  1M90 H;  1T0K B;  1YIT F;  3CCQ F;  4BY9 D;  1W40 A;  1KD1 H;  1E7K A;  3NVI B;  3LWP C;  4BW0 B;  3WXM B;  3CCE F;  1YJW F;  3NMU C;  3SIU A;  2BO1 A;  3G6E F;  1VQ7 F;  3CCS F;  1W41 A;  3LWO C;  1VQ9 F;  3JAM M;  3CC2 F;  3PLA C;  3CPQ A;  1KC8 H;  3MCA B;  4TZZ A;  2OHW A;  1GZ0 A;  3JCM M;  3IR9 A;  3N4Y A;  5EO3 A;  3CMA F;  2KTU A;  2CZW A;  2KTV A;  3E1Y A; 
#chains in the Genus database with same CATH topology
 3HKB B;  3WGN A;  5EAZ A;  3WGM A;  3N4Z A;  3HKE A;  3LYB A;  4X1I A;  4RQO A;  1QVF F;  3HKB A;  3MDO A;  4NWO B;  4O2B B;  1KNK A;  4O2A A;  3S0H A;  3WGL A;  2OTL F;  4C81 A;  1IV2 A;  3D01 A;  2HS3 A;  1SA0 B;  2K1S A;  3D54 A;  1DBF A;  4O4L B;  5LP6 B;  1RA4 A;  5KX5 A;  5HY1 A;  1R1M A;  3RYI A;  1CK2 A;  3LWV C;  2ZAU A;  1XBI A;  1Q81 H;  1VQ6 F;  1W5A A;  2UYK A;  5MN4 A;  1RQ2 A;  4C82 A;  4IHJ B;  1VH8 A;  1Q82 H;  2QEX F;  1GO1 A;  1IV4 A;  3N2G B;  5EB1 B;  5LYJ A;  3ON1 A;  3CCR F;  1W55 A;  5GON B;  1PXW A;  2G9I A;  3CD6 F;  4ERH A;  1PF5 A;  2OTM A;  2CSL A;  5EB0 A;  1QVG F;  3R0P A;  5LOV A;  5LXT A;  1SZQ A;  4I4T B;  3HKC A;  1VQK F;  5IJ0 A;  3JAK B;  3RYH B;  5A2Q M;  2HP0 B;  5FNV B;  2H8C A;  2LBW A;  3F0D A;  1KNJ A;  4O4J B;  1TUB A;  1VQN F;  4ZK7 A;  3JAS A;  4E6E A;  3U0O A;  4BT2 A;  1Q86 H;  2ZVY A;  2Z1F A;  1JJ2 F;  3GYQ A;  4U39 A;  4O4I A;  4BT3 A;  3G4S F;  4B46 A;  2UYJ A;  4X20 A;  4BT7 A;  1JD1 A;  5EZY B;  3VYS C;  3VOB A;  4U3J A;  3ZO8 A;  1X7O A;  3AGK A;  3CCV F;  2IG8 A;  3OW2 F;  3WJQ A;  2RHO A;  3IEW A;  4G4X A;  5MN6 A;  3I55 F;  3MQW A;  5J2U A;  5IYZ A;  2I6D A;  3TD4 A;  3NVK E;  2UYN A;  1FNK A;  5IJ0 B;  1W5E A;  5LOV B;  2Z1E A;  5LXT B;  3RYC A;  3CCQ F;  3NVI B;  1T0A A;  2IQQ A;  4ZOL B;  4TUY A;  3IKF A;  4I55 A;  4M8I A;  3CCS F;  5MN5 A;  2HX0 A;  3VO8 A;  3JAM M;  3WJP A;  3PLA C;  3CPQ A;  3V4D A;  3MCA B;  4KWE A;  4FFB A;  2OHW A;  3JAS B;  3IKE A;  2W8B C;  3N4Y A;  3CMA F;  5EO3 A;  5LA6 B;  2RHH A;  2CZW A;  3JAT B;  5HXZ A;  2PMP A;  3LME A;  3O85 A;  4HNA B;  4BT4 A;  5KMG B;  4O4L A;  4ZI7 A;  2CVL A;  5LA6 A;  1YJN F;  2EWC A;  1YGY A;  4B45 A;  4ZOL A;  2YXZ A;  3HKC B;  3WGJ A;  4TV8 B;  2DT4 A;  5JH7 A;  1NQ3 A;  3V7Q A;  5GIN C;  1CN7 A;  4DRX B;  2YYE A;  3NK6 A;  3QTY A;  1YIJ F;  1CLI A;  3B6N A;  3CCL F;  2HQS C;  3HWU A;  3ZP7 A;  3IEQ A;  2OZB A;  2HP3 A;  3UT5 B;  3CB2 A;  4X1Y B;  2ALE A;  3TD3 A;  3HTN A;  5G4V C;  3JAL A;  3LFO A;  3WGK A;  3JAK A;  3RYH A;  1COM A;  5EWR A;  3J80 M;  3K12 A;  4I50 B;  2Q1Y A;  3JVH A;  1N8R H;  3J81 M;  5IYZ B;  3C9U A;  2RHJ A;  1W2B F;  3V7E A;  3E22 B;  5JH7 B;  1GX1 A;  1W58 1;  4O2B A;  2LBT A;  5C8Y A;  4BVQ A;  2HS4 A;  3FD5 A;  2OTJ F;  1U40 A;  1H47 A;  2FGY A;  1KQS F;  3JAW B;  1NMU B;  3M84 A;  2LCA A;  4YJ3 A;  1FFX A;  2BTO A;  3CCM F;  4O4I B;  2MQE A;  5FLX M;  2BTU A;  1VHA A;  4EB6 A;  3S03 A;  3HAX D;  3J7A R;  3JAW A;  4ZHV A;  3CPW F;  2B33 A;  5EYP A;  4IIJ A;  4NUT A;  1Z5V A;  2ZVZ A;  1YI2 F;  5LP6 A;  1W5F A;  5FNV A;  4R40 B;  4WBN B;  5JCO A;  1M90 H;  3MBM A;  5HP8 A;  5JVD A;  1KD1 H;  4BW0 B;  4O2A B;  1YJW F;  3ESJ A;  4LNU B;  3SIU A;  2V9Y A;  3G6E F;  2F9Z C;  1RLU A;  3HKD A;  4X1K B;  3Q8H A;  5JCO C;  4G4V A;  3JAL B;  3N2G A;  1KC8 H;  3RE3 A;  4TZZ A;  5HY0 A;  3F6M A;  5EIB C;  5CA0 B;  2H8E A;  3VOA A;  3LWQ C;  2UZH A;  4HNA A;  3KHN A;  2QI2 A;  1TVK B;  4ZHY B;  1RQ7 A;  1XHO A;  1FSZ A;  1VQO F;  1U3L A;  5BMV B;  4O4H B;  1Q7Y H;  1XV2 A;  1VQ8 F;  1JFF A;  3RA5 A;  1ODE A;  5IT9 M;  1X7P A;  2AIZ P;  3CXC F;  1VK3 A;  3OON A;  2QA4 F;  1TUB B;  2Z1T A;  4TV8 A;  2FC3 A;  2ZF8 A;  2ZOV A;  4YJ3 B;  4TV9 A;  2RHL A;  4I4T A;  3F0G A;  3N2K B;  3RYF A;  4G88 A;  4B62 A;  1VQM F;  3M4S A;  3JAR B;  2JNB A;  5EIB D;  1K8A H;  5GON A;  2LBX A;  2VGN A;  2CWJ A;  3TD5 A;  1UFY A;  3ZP4 A;  3G71 F;  5EZY A;  5KMG A;  3FFM A;  3V3T A;  1Q8R A;  3S02 A;  2PHN A;  4ZI7 B;  3P10 A;  3P4E A;  2VAM A;  2VAW A;  3S06 A;  2AMT A;  3F0E A;  1SDS A;  3S0W A;  4IIJ B;  4ZHQ B;  1S72 F;  3DDN A;  2VXY A;  5AVM A;  3C9S A;  3EOR A;  5GIP C;  2GVI A;  2R75 1;  1X52 A;  4O4H A;  3LWR C;  1RLG A;  2Z1U A;  2L26 A;  3VIU A;  1JFF B;  2RB9 A;  3CC7 F;  1W5B A;  1QAH A;  2VAP A;  3D00 A;  3ERN A;  4BT6 A;  3KIZ A;  5HXU A;  5J2U B;  3E22 A;  3ZOP A;  1SA0 A;  3C9T A;  3DC2 A;  4DXD A;  5J2T A;  4TV9 B;  3KE1 A;  1FNJ A;  3CYP B;  3N2K A;  3S0Y A;  3WPW A;  3JAR A;  5J2T B;  3T80 A;  1IPA A;  2CHS A;  4BT5 A;  3QHD A;  2Z01 A;  1XRG A;  4BVS A;  1W57 A;  4LNU A;  3QUW A;  1NJI H;  3JAT A;  5GAP K;  3RYI B;  4X3M A;  2KG4 A;  1Z5W A;  2GLZ A;  3WJR A;  1K73 H;  2BTQ B;  3K2X A;  4C8E A;  4XCQ A;  4RHA A;  5LP6 C;  2DYY A;  1U3P A;  1X25 A;  4ZHQ A;  4BY9 D;  1W40 A;  4EI9 A;  5HP7 A;  3LWP C;  4BVT A;  3WXM B;  4C8G A;  5IJ9 A;  2HP0 A;  2HS0 A;  3C9R A;  2BO1 A;  1VQ7 F;  3BYQ A;  3LWO C;  1VQ9 F;  4X1K A;  1GZ0 A;  4DRX A;  4I55 B;  3IR9 A;  2CHT A;  2KTU A;  3FD6 A;  5JVD B;  1YQN A;  3KJJ A;  1K9M H;  2AIF A;  3HKE B;  3LDT A;  4I50 A;  3NK7 A;  3VYU C;  1GO0 A;  4X20 B;  3HJW C;  5G4U C;  1FFX B;  3VCZ A;  4ZHW A;  3L7Q A;  1VQV A;  1OAP A;  5GAN K;  3IMP A;  5CA0 A;  2ZOD A;  4YJ2 B;  4X3L A;  1TVK A;  3F0F A;  3VI6 A;  1DT9 A;  1M1K H;  5CA1 A;  5KX5 B;  3CCU F;  2HRY A;  3VYT C;  4C4W C;  3PAF A;  2P6Y A;  1H48 A;  4NQ3 A;  3RYC B;  4EI7 A;  1YJ9 F;  1VQP F;  3OBY A;  3CG6 A;  2R6R 1;  5HWE A;  3CCJ F;  1JN1 A;  5C8Y B;  4C8I A;  4EI8 A;  5JQG B;  2IAF A;  3KJK A;  1W42 A;  3K14 A;  3ELC A;  5DCV A;  3RYF B;  2CW4 A;  3FBA A;  1W59 A;  4WBN A;  3E20 B;  5HY2 A;  4U3J B;  3UT5 A;  1UI9 A;  2KGW A;  5CA1 B;  4EB6 B;  1VQ4 F;  2VGM A;  4F6R B;  5ITZ A;  5EYP B;  1W3E X;  4PWT A;  4G4Y A;  5BMV A;  4BVR A;  4LCK A;  4O4J A;  4YJ2 A;  5CB4 A;  3MCQ A;  3GTZ A;  2N48 A;  5HY4 A;  3I7T A;  3VTI C;  3I56 F;  5GIO C;  3K0T A;  1VQL F;  3P0Z A;  4FFB B;  1ZWZ A;  4X1I B;  1H7M A;  3CC4 F;  3FPI A;  1JY8 A;  1U43 A;  1ONI A;  5FJ4 C;  2HVY D;  2Q1X A;  1J7H A;  1IV3 A;  2I6R A;  4TUY B;  1IV1 A;  2UYP A;  3SIV A;  3WPX A;  1YHQ F;  5JQG A;  3OBW A;  3CYQ A;  3VMF B;  3RA6 A;  1VQ5 F;  2WAL A;  4X1Y A;  5CB4 B;  2QTP A;  3CME F;  4G4Z A;  2GZL A;  5LYJ B;  1T0K B;  1YIT F;  1QU9 A;  2NMU A;  3I3F A;  5B8F A;  5IJ9 B;  1E7K A;  4F6R A;  5ITZ B;  3CCE F;  3M1X A;  3NMU C;  4G4W A;  1W41 A;  4IHJ A;  3CC2 F;  3C8L A;  4B5C A;  1OFU A;  2UYN B;  3GHZ A;  3JCM M;  2H6L A;  2HRU A;  2KTV A;  3HKD B;  1QD9 A;  3E1Y A; 
#chains in the Genus database with same CATH homology
 3O85 A;  1K9M H;  3LWQ C;  2QI2 A;  2AIF A;  3N4Z A;  1VQO F;  1YJN F;  1Q7Y H;  3NK7 A;  1QVF F;  1GO0 A;  1VQ8 F;  3RA5 A;  3HJW C;  5G4U C;  5IT9 M;  1X7P A;  2OTL F;  5GAN K;  3CXC F;  2QA4 F;  3V7Q A;  2FC3 A;  4X3L A;  5GIN C;  1CN7 A;  1RA4 A;  3VI6 A;  5HY1 A;  1DT9 A;  1M1K H;  3CCU F;  3NK6 A;  1CK2 A;  3LWV C;  1YIJ F;  3PAF A;  4C4W C;  1Q81 H;  1XBI A;  1VQ6 F;  4NQ3 A;  1VQM F;  4EI7 A;  3CCL F;  1YJ9 F;  1VQP F;  2JNB A;  3CG6 A;  3OBY A;  1K8A H;  2LBX A;  2VGN A;  5HWE A;  3G71 F;  3CCJ F;  1Q82 H;  2OZB A;  3FFM A;  3V3T A;  1GO1 A;  2QEX F;  4EI8 A;  3ON1 A;  3CCR F;  1W42 A;  5DCV A;  1PXW A;  2ALE A;  3CD6 F;  5G4V C;  3LFO A;  1QVG F;  3E20 B;  1SDS A;  5HY2 A;  1S72 F;  1VQK F;  3J80 M;  5EWR A;  5GIP C;  5A2Q M;  1X52 A;  3LWR C;  1VQ4 F;  2VGM A;  1N8R H;  3J81 M;  1RLG A;  1W3E X;  3CC7 F;  1W2B F;  3V7E A;  2LBW A;  3D00 A;  4BVR A;  4LCK A;  5HXU A;  1VQN F;  4BVQ A;  5HY4 A;  2OTJ F;  3I56 F;  2FGY A;  1KQS F;  5GIO C;  1VQL F;  1NMU B;  1Q86 H;  1JJ2 F;  3GYQ A;  1ZWZ A;  1IPA A;  1H7M A;  3CC4 F;  3G4S F;  3CCM F;  5FLX M;  5FJ4 C;  3HAX D;  2HVY D;  4BVS A;  3J7A R;  3CPW F;  3SIV A;  1NJI H;  1X7O A;  4NUT A;  3AGK A;  5GAP K;  3OBW A;  3CCV F;  1YHQ F;  4X3M A;  2KG4 A;  2GLZ A;  3RA6 A;  3VMF B;  3OW2 F;  1K73 H;  1VQ5 F;  3I55 F;  2WAL A;  1YI2 F;  4XCQ A;  3CME F;  2I6D A;  3NVK E;  1M90 H;  1T0K B;  1YIT F;  3CCQ F;  4BY9 D;  1W40 A;  4EI9 A;  1KD1 H;  1E7K A;  3LWP C;  3NVI B;  4BW0 B;  3WXM B;  4BVT A;  3CCE F;  1YJW F;  3NMU C;  3SIU A;  2BO1 A;  3G6E F;  2F9Z C;  1VQ7 F;  3CCS F;  1W41 A;  3LWO C;  1VQ9 F;  3JAM M;  3CC2 F;  3PLA C;  3CPQ A;  1KC8 H;  3MCA B;  4TZZ A;  2OHW A;  1GZ0 A;  5HY0 A;  3JCM M;  3IR9 A;  3N4Y A;  5EO3 A;  3CMA F;  2KTU A;  2CZW A;  5HXZ A;  2KTV A;  3E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...