1W3EX

Ribosomal l30e of thermococcus celer, p59a mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIAVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of Proline Residues in Thermostability of T. Celer L30E Protein
rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w3eX00
3GYQA 3ON1A 2VGMA 3LFOA 3NK6A 4X3MA 3RA6A 3LWRC 3HJWC 3CC7F 1VQ5F 2BO1A 1KQSF 1YJNF 3I55F 5G4UC 1QVFF 3RA5A 2VGNA 1YHQF 3WXMB 3CG6A 1IPAA 3LWOC 2JNBA 1N8RH 1JJ2F 3CCVF 1W42A 5GAPK 1KD1H 1VQ6F 1M1KH 1KC8H 5GIPC 1GZ0A 3CPQA 3E20B 1VQLF 3SIVA 1X7PA 3PAFA 3NVKE 1RA4A 2I6DA 3N4YA 3O85A 5GANK 3CCMF 1YITF 3OW2F 3HAXD 2HVYD 3NVIB 1YIJF 1ZWZA 4TZZA 1H7MA 5G4VC 1K9MH 2ALEA 1VQ4F 3IR9A 2QEXF 5GIOC 3FFMA 3VMFB 1DT9A 1S72F 3J7AR 3CXCF 1VQ7F 1VQMF 3AGKA 5IT9M 1SDSA 5EO3A 1YJ9F 3CCRF 1PXWA 2LBWA 5EWRA 1K8AH 1W40A 3CMAF 1Q7YH 3G6EF 2AIFA 4C4WC 2WALA 1RLGA 1K73H 1VQ8F 1VQ9F 3JAMM 1E7KA 3CCJF 3NK7A 3CCSF 3JCMM 3G71F 3CCEF 1YI2F 1VQOF 2KTVA 2FC3A 2LBXA 3LWQC 3CPWF 2OHWA 1T0KB 1CN7A 5DCVA 3CMEF 1NJIH 3G4SF 4NUTA 1M90H 3LWVC 1QVGF 1YJWF 1W3EX 1VQNF 1GO1A 3J81M 3CD6F 2OZBA 3CC4F 5FLXM 1XBIA 3V7EA 3SIUA 3OBWA 3NMUC 1X52A 3CCUF 1GO0A 3PLAC 3OBYA 1Q81H 1CK2A 4LCKA 2QI2A 5A2QM 3MCAB 4BW0B 1W2BF 1X7OA 1NMUB 1Q86H 5GINC 2OTLF 4BY9D 5FJ4C 3VI6A 4X3LA 2KTUA 3J80M 3CCLF 1Q82H 2QA4F 3V7QA 2OTJF 3N4ZA 3I56F 3E1YA 1VQKF 3CC2F 3CCQF 3LWPC 2CZWA 1VQPF 2KG4A 1W41A
chains in the Genus database with same CATH superfamily
1JFFB 1T0AA 2NMUA 4R40B 4TUYB 5KX5A 5JQGA 5EYPA 2UYJA 3P4EA 3L7QA 4X1IA 2HP3A 4TV8B 2UYNB 3M4SA 1QVFF 3JAKA 4ERHA 2EWCA 3WXMB 3JAKB 3D00A 1IPAA 4I50B 1N8RH 3E22A 2R751 4IIJA 5CB4B 1NQ3A 3LYBA 2CWJA 5C8YA 4YJ3B 3FBAA 5GIPC 1XRGA 5JH7A 1QU9A 4BT4A 1X7PA 4B62A 1JN1A 2P6YA 5EIBD 4O2AB 2FGYA 3HWUA 1Z5VA 4O2AA 4ZHWA 5ITZA 3CCMF 1YITF 4X1YA 4X1YB 1VK3A 1K9MH 2CW4A 3MBMA 2QEXF 1W57A 3N2GB 3J7AR 3RE3A 3S02A 4IIJB 1VQ7F 3I7TA 4X1KB 2Z1TA 4BT6A 3CCRF 2ZVZA 1VQVA 3FD5A 1PXWA 5AVMA 5EWRA 3CMAF 3ERNA 5LA6A 1VH8A 3G6EF 4C4WC 3KIZA 2GLZA 3CCJF 3NK7A 1JFFA 3JCMM 2DT4A 3G71F 4FFBA 1VQOF 4U3JA 1IV1A 2LBXA 4LNUA 2HQSC 4O4IB 5DCVA 3ESJA 4I4TA 4F6RA 3JALB 3P0ZA 5J2TB 3HKBA 5HP8A 4WBNA 2MQEA 5B8FA 3LWVC 1QVGF 1QAHA 2DYYA 2VAWA 1XBIA 5LP6B 2GVIA 3VOAA 4YJ3A 3V3TA 5HXUA 1X52A 2ZF8A 5IJ9B 1Q81H 1CK2A 5IJ0B 4LCKA 1W2BF 1NMUB 2AMTA 3HKCB 5LXTB 3IMPA 3R0PA 5FJ4C 4BVQA 3F0GA 1SA0A 3ELCA 3J80M 3WJRA 4WBNB 1YGYA 4XCQA 3JALA 5LP6C 4C81A 3VYUC 3WGJA 3DDNA 1U3PA 2ZOVA 4G4WA 2HRUA 4C8EA 5LOVB 3LWPC 4TV9A 1RLUA 2AIZP 1VQPF 5IYZA 1W41A 3GYQA 2IQQA 2VGMA 3LFOA 4YJ2A 2RHLA 3GHZA 3RYFA 4BVTA 5MN4A 1KQSF 1H47A 1YHQF 3FPIA 3F6MA 4G4YA 1FSZA 4ZHVA 1VQ6F 2HS4A 1KC8H 3CPQA 3RYIA 3SIVA 1XHOA 2BTUA 5HY0A 1UI9A 3ZP7A 3NVKE 3JAWB 3WGKA 3JAWA 4TV8A 5LYJA 1RA4A 2I6DA 3N4YA 3NVIB 3HAXD 1H48A 4RHAA 5GONB 1YIJF 1H7MA 5G4VC 2ALEA 3DC2A 3KE1A 1TVKB 4C8GA 5KMGA 3JATB 1S72F 5J2TA 4KWEA 2KGWA 3E22B 1VQMF 1SA0B 3AGKA 1W5AA 3RYIB 5JH7B 2VXYA 5CA1A 3RYCB 2HX0A 1K8AH 1W40A 3T80A 3VCZA 3WGLA 4PWTA 3Q8HA 4EB6A 1RQ2A 2H6LA 2K1SA 1OAPA 1K73H 2GZLA 4ZHQB 3LMEA 2IAFA 3CB2A 1YI2F 2KTVA 2FC3A 4LNUB 2H8EA 1VHAA 5GONA 2OHWA 3CPWF 1CN7A 4I50A 3S0WA 3K14A 3F0FA 5EZYA 4X1KA 3CMEF 4O4IA 2B33A 1IV2A 1NJIH 4BT7A 3G4SF 1R1MA 5CB4A 3VYTC 1SZQA 1GO1A 3FD6A 1W581 3VO8A 3V7EA 3SIUA 5LP6A 3CCUF 1GO0A 3S0HA 5CA0B 2BTOA 2QI2A 3B6NA 1X7OA 2HP0B 2HRYA 3HKCA 2Q1XA 5GINC 3VOBA 1TUBA 3VI6A 4X3LA 4BVSA 1J7HA 1Q8RA 3C9RA 3JARA 3JARB 4C8IA 3M84A 2QA4F 4HNAA 3D54A 2Z01A 3CCQF 4ZK7A 3ZOPA 1U40A 5JQGB 4G4XA 2CHSA 2ZAUA 5J2UB 3RA6A 4B46A 4BVRA 3CC7F 2ZODA 1YJNF 3I55F 3V4DA 3N2GA 2N48A 3WJQA 3CG6A 3N2KB 2V9YA 4I55B 1JJ2F 3CCVF 4NQ3A 1KD1H 2Z1UA 5BMVB 3TD4A 4EI8A 2Z1EA 5HY1A 4TV9B 4O4HB 4ZHYB 3E20B 1VQLF 2VAMA 3F0DA 3PAFA 2YYEA 3VTIC 5FNVA 3MQWA 2PMPA 1FNKA 5GANK 3HKEA 2HVYD 2RHHA 3HKEB 2IG8A 4O2BA 5LXTA 4X20B 3VMFB 1DT9A 3CYPB 1TUBB 4C82A 1W5FA 5IT9M 1FNJA 4ZOLA 5EO3A 4IHJA 3QUWA 3EORA 2AIFA 4ZHQA 2WALA 3WPXA 1GX1A 1RLGA 3WGMA 1VQ9F 1IV4A 3U0OA 3IKFA 5JCOA 2H8CA 1CLIA 4U3JB 5IYZB 3UT5B 5JCOC 3WPWA 3D01A 3C9UA 4X1IB 5JVDB 5JVDA 3LWQC 3IEQA 4FFBB 3CYQA 1T0KB 2ZVYA 4NWOB 1U43A 3IKEA 4B45A 5HY2A 1UFYA 3KHNA 5HP7A 5BMVA 3LDTA 1YJWF 3J81M 3CD6F 3CC4F 1COMA 2Q1YA 3OBWA 3QHDA 1KNJA 3P10A 2CSLA 4BT2A 5CA0A 4B5CA 3S0YA 3MCAB 1PF5A 2R6R1 4TUYA 3UT5A 5KX5B 3S03A 1Q86H 3HKDB 1W59A 4O2BB 3HKDA 5FNVB 3QTYA 2LBTA 1TVKA 5KMGB 2KTUA 4HNAB 2UYNA 1Q82H 3V7QA 4ZI7A 3N4ZA 3VYSC 3VIUA 5HY4A 1FFXB 3I56F 1U3LA 3F0EA 1VQKF 4IHJB 2RB9A 1JD1A 3BYQA 3WJPA 4ZOLB 2L26A 3IEWA 1YQNA 2RHJA 4EB6B 2CZWA 5MN6A 3RYFB 4BT3A 3ON1A 3NK6A 4X3MA 3K12A 3LWRC 3HJWC 4M8IA 1VQ5F 2BO1A 3ZO8A 5IJ0A 5ITZB 3S06A 5G4UC 2RHOA 3JATA 3RA5A 2VGNA 3JASA 3RYHA 1XV2A 4F6RB 5EZYB 1FFXA 1JY8A 2JNBA 2UZHA 3LWOC 3HTNA 1W42A 2G9IA 5GAPK 4O4JB 3TD3A 4O4HA 3HKBB 1M1KH 5CA1B 2PHNA 1GZ0A 4BT5A 2OTMA 1X25A 5EIBC 1IV3A 3MCQA 1Z5WA 4O4LB 3I3FA 3OONA 4O4LA 4G88A 3O85A 3OW2F 1QD9A 4U39A 3KJKA 1ZWZA 4EI9A 4TZZA 1VQ4F 3IR9A 5GIOC 3FFMA 4DRXB 4X20A 4DRXA 3CXCF 2W8BC 4I4TB 1SDSA 4O4JA 2I6RA 1YJ9F 2LBWA 1KNKA 5C8YB 2F9ZC 5IJ9A 1Q7YH 3C8LA 3K2XA 3KJJA 5EYPB 4E6EA 5HWEA 3C9SA 4G4ZA 1VQ8F 1W5BA 5LYJB 3JAMM 1E7KA 2Z1FA 3CCSF 1W55A 3JVHA 3WGNA 3CCEF 5HXZA 2CVLA 2YXZA 4RQOA 5EB1B 3C9TA 2UYPA 3N2KA 4I55A 1RQ7A 1OFUA 4NUTA 1M90H 3RYCA 1W3EX 1VQNF 2UYKA 2OZBA 5FLXM 5J2UA 3NMUC 3TD5A 2LCAA 5EB0A 3PLAC 3OBYA 1ONIA 3M1XA 3MDOA 5A2QM 4BW0B 4YJ2B 2BTQB 2OTLF 3JASB 3RYHB 4BY9D 2HP0A 4ZI7B 3CCLF 4G4VA 2OTJF 2HS0A 1W5EA 2CHTA 3E1YA 1ODEA 1DBFA 3K0TA 3GTZA 3CC2F 2QTPA 5EAZA 3ZP4A 5MN5A 5LOVA 4EI7A 2HS3A 2VAPA 5LA6B 4DXDA 2KG4A
chains in the Genus database with same CATH topology
3GYQA 3ON1A 2VGMA 3LFOA 3NK6A 4X3MA 3RA6A 4BVRA 3LWRC 3HJWC 4BVTA 3CC7F 1VQ5F 2BO1A 1KQSF 1YJNF 3I55F 5G4UC 1QVFF 3RA5A 2VGNA 1YHQF 3WXMB 3CG6A 3D00A 1IPAA 3LWOC 2JNBA 1N8RH 1JJ2F 3CCVF 1W42A 5GAPK 4NQ3A 1KD1H 1VQ6F 1M1KH 4EI8A 5HY1A 1KC8H 5GIPC 1GZ0A 3CPQA 3E20B 1VQLF 3SIVA 1X7PA 5HY0A 3PAFA 3NVKE 2FGYA 1RA4A 2I6DA 3N4YA 3O85A 5GANK 3CCMF 1YITF 3OW2F 3HAXD 2HVYD 3NVIB 1YIJF 1ZWZA 4EI9A 1H7MA 4TZZA 5G4VC 1K9MH 2ALEA 1VQ4F 3IR9A 2QEXF 5GIOC 3FFMA 3VMFB 1DT9A 1S72F 3J7AR 3CXCF 1VQ7F 1VQMF 3AGKA 5IT9M 1SDSA 5EO3A 1YJ9F 3CCRF 1PXWA 2LBWA 5EWRA 1K8AH 1W40A 2F9ZC 3CMAF 1Q7YH 3G6EF 2AIFA 4C4WC 2WALA 1RLGA 1K73H 5HWEA 1VQ8F 1VQ9F 2GLZA 3JAMM 1E7KA 3CCJF 3NK7A 3CCSF 3JCMM 3G71F 3CCEF 5HXZA 1YI2F 1VQOF 2KTVA 2FC3A 2LBXA 3LWQC 3CPWF 2OHWA 1T0KB 1CN7A 5DCVA 3CMEF 5HY2A 1NJIH 3G4SF 4NUTA 1M90H 3LWVC 1QVGF 1YJWF 1W3EX 1VQNF 1GO1A 3J81M 3CD6F 2OZBA 3CC4F 5FLXM 1XBIA 3V7EA 3SIUA 3OBWA 3V3TA 5HXUA 3NMUC 1X52A 3CCUF 1GO0A 3PLAC 3OBYA 1Q81H 1CK2A 4LCKA 2QI2A 5A2QM 3MCAB 4BW0B 1W2BF 1X7OA 1NMUB 1Q86H 5GINC 2OTLF 4BY9D 5FJ4C 3VI6A 4X3LA 4BVSA 4BVQA 2KTUA 3J80M 3CCLF 1Q82H 2QA4F 3V7QA 2OTJF 4XCQA 3N4ZA 5HY4A 3I56F 3E1YA 1VQKF 3CC2F 3CCQF 3LWPC 2CZWA 4EI7A 1VQPF 2KG4A 1W41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYQ A;  3ON1 A;  2VGM A;  3LFO A;  3NK6 A;  4X3M A;  3RA6 A;  3LWR C;  3HJW C;  3CC7 F;  1VQ5 F;  2BO1 A;  1KQS F;  1YJN F;  3I55 F;  5G4U C;  1QVF F;  3RA5 A;  2VGN A;  1YHQ F;  3WXM B;  3CG6 A;  1IPA A;  3LWO C;  2JNB A;  1N8R H;  1JJ2 F;  3CCV F;  1W42 A;  5GAP K;  1KD1 H;  1VQ6 F;  1M1K H;  1KC8 H;  5GIP C;  1GZ0 A;  3CPQ A;  3E20 B;  1VQL F;  3SIV A;  1X7P A;  3PAF A;  3NVK E;  1RA4 A;  2I6D A;  3N4Y A;  3O85 A;  5GAN K;  3CCM F;  1YIT F;  3OW2 F;  3HAX D;  2HVY D;  3NVI B;  1YIJ F;  1ZWZ A;  4TZZ A;  1H7M A;  5G4V C;  1K9M H;  2ALE A;  1VQ4 F;  3IR9 A;  2QEX F;  5GIO C;  3FFM A;  3VMF B;  1DT9 A;  1S72 F;  3J7A R;  3CXC F;  1VQ7 F;  1VQM F;  3AGK A;  5IT9 M;  1SDS A;  5EO3 A;  1YJ9 F;  3CCR F;  1PXW A;  2LBW A;  5EWR A;  1K8A H;  1W40 A;  3CMA F;  1Q7Y H;  3G6E F;  2AIF A;  4C4W C;  2WAL A;  1RLG A;  1K73 H;  1VQ8 F;  1VQ9 F;  3JAM M;  1E7K A;  3CCJ F;  3NK7 A;  3CCS F;  3JCM M;  3G71 F;  3CCE F;  1YI2 F;  1VQO F;  2KTV A;  2FC3 A;  2LBX A;  3LWQ C;  3CPW F;  2OHW A;  1T0K B;  1CN7 A;  5DCV A;  3CME F;  1NJI H;  3G4S F;  4NUT A;  1M90 H;  3LWV C;  1QVG F;  1YJW F;  1W3E X;  1VQN F;  1GO1 A;  3J81 M;  3CD6 F;  2OZB A;  3CC4 F;  5FLX M;  1XBI A;  3V7E A;  3SIU A;  3OBW A;  3NMU C;  1X52 A;  3CCU F;  1GO0 A;  3PLA C;  3OBY A;  1Q81 H;  1CK2 A;  4LCK A;  2QI2 A;  5A2Q M;  3MCA B;  4BW0 B;  1W2B F;  1X7O A;  1NMU B;  1Q86 H;  5GIN C;  2OTL F;  4BY9 D;  5FJ4 C;  3VI6 A;  4X3L A;  2KTU A;  3J80 M;  3CCL F;  1Q82 H;  2QA4 F;  3V7Q A;  2OTJ F;  3N4Z A;  3I56 F;  3E1Y A;  1VQK F;  3CC2 F;  3CCQ F;  3LWP C;  2CZW A;  1VQP F;  2KG4 A;  1W41 A; 
#chains in the Genus database with same CATH topology
 1JFF B;  1T0A A;  2NMU A;  4R40 B;  4TUY B;  5KX5 A;  5JQG A;  5EYP A;  2UYJ A;  3P4E A;  3L7Q A;  4X1I A;  2HP3 A;  4TV8 B;  2UYN B;  3M4S A;  1QVF F;  3JAK A;  4ERH A;  2EWC A;  3WXM B;  3JAK B;  3D00 A;  1IPA A;  4I50 B;  1N8R H;  3E22 A;  2R75 1;  4IIJ A;  5CB4 B;  1NQ3 A;  3LYB A;  2CWJ A;  5C8Y A;  4YJ3 B;  3FBA A;  5GIP C;  1XRG A;  5JH7 A;  1QU9 A;  4BT4 A;  1X7P A;  4B62 A;  1JN1 A;  2P6Y A;  5EIB D;  4O2A B;  2FGY A;  3HWU A;  1Z5V A;  4O2A A;  4ZHW A;  5ITZ A;  3CCM F;  1YIT F;  4X1Y A;  4X1Y B;  1VK3 A;  1K9M H;  2CW4 A;  3MBM A;  2QEX F;  1W57 A;  3N2G B;  3J7A R;  3RE3 A;  3S02 A;  4IIJ B;  1VQ7 F;  3I7T A;  4X1K B;  2Z1T A;  4BT6 A;  3CCR F;  2ZVZ A;  1VQV A;  3FD5 A;  1PXW A;  5AVM A;  5EWR A;  3CMA F;  3ERN A;  5LA6 A;  1VH8 A;  3G6E F;  4C4W C;  3KIZ A;  2GLZ A;  3CCJ F;  3NK7 A;  1JFF A;  3JCM M;  2DT4 A;  3G71 F;  4FFB A;  1VQO F;  4U3J A;  1IV1 A;  2LBX A;  4LNU A;  2HQS C;  4O4I B;  5DCV A;  3ESJ A;  4I4T A;  4F6R A;  3JAL B;  3P0Z A;  5J2T B;  3HKB A;  5HP8 A;  4WBN A;  2MQE A;  5B8F A;  3LWV C;  1QVG F;  1QAH A;  2DYY A;  2VAW A;  1XBI A;  5LP6 B;  2GVI A;  3VOA A;  4YJ3 A;  3V3T A;  5HXU A;  1X52 A;  2ZF8 A;  5IJ9 B;  1Q81 H;  1CK2 A;  5IJ0 B;  4LCK A;  1W2B F;  1NMU B;  2AMT A;  3HKC B;  5LXT B;  3IMP A;  3R0P A;  5FJ4 C;  4BVQ A;  3F0G A;  1SA0 A;  3ELC A;  3J80 M;  3WJR A;  4WBN B;  1YGY A;  4XCQ A;  3JAL A;  5LP6 C;  4C81 A;  3VYU C;  3WGJ A;  3DDN A;  1U3P A;  2ZOV A;  4G4W A;  2HRU A;  4C8E A;  5LOV B;  3LWP C;  4TV9 A;  1RLU A;  2AIZ P;  1VQP F;  5IYZ A;  1W41 A;  3GYQ A;  2IQQ A;  2VGM A;  3LFO A;  4YJ2 A;  2RHL A;  3GHZ A;  3RYF A;  4BVT A;  5MN4 A;  1KQS F;  1H47 A;  1YHQ F;  3FPI A;  3F6M A;  4G4Y A;  1FSZ A;  4ZHV A;  1VQ6 F;  2HS4 A;  1KC8 H;  3CPQ A;  3RYI A;  3SIV A;  1XHO A;  2BTU A;  5HY0 A;  1UI9 A;  3ZP7 A;  3NVK E;  3JAW B;  3WGK A;  3JAW A;  4TV8 A;  5LYJ A;  1RA4 A;  2I6D A;  3N4Y A;  3NVI B;  3HAX D;  1H48 A;  4RHA A;  5GON B;  1YIJ F;  1H7M A;  5G4V C;  2ALE A;  3DC2 A;  3KE1 A;  1TVK B;  4C8G A;  5KMG A;  3JAT B;  1S72 F;  5J2T A;  4KWE A;  2KGW A;  3E22 B;  1VQM F;  1SA0 B;  3AGK A;  1W5A A;  3RYI B;  5JH7 B;  2VXY A;  5CA1 A;  3RYC B;  2HX0 A;  1K8A H;  1W40 A;  3T80 A;  3VCZ A;  3WGL A;  4PWT A;  3Q8H A;  4EB6 A;  1RQ2 A;  2H6L A;  2K1S A;  1OAP A;  1K73 H;  2GZL A;  4ZHQ B;  3LME A;  2IAF A;  3CB2 A;  1YI2 F;  2KTV A;  2FC3 A;  4LNU B;  2H8E A;  1VHA A;  5GON A;  2OHW A;  3CPW F;  1CN7 A;  4I50 A;  3S0W A;  3K14 A;  3F0F A;  5EZY A;  4X1K A;  3CME F;  4O4I A;  2B33 A;  1IV2 A;  1NJI H;  4BT7 A;  3G4S F;  1R1M A;  5CB4 A;  3VYT C;  1SZQ A;  1GO1 A;  3FD6 A;  1W58 1;  3VO8 A;  3V7E A;  3SIU A;  5LP6 A;  3CCU F;  1GO0 A;  3S0H A;  5CA0 B;  2BTO A;  2QI2 A;  3B6N A;  1X7O A;  2HP0 B;  2HRY A;  3HKC A;  2Q1X A;  5GIN C;  3VOB A;  1TUB A;  3VI6 A;  4X3L A;  4BVS A;  1J7H A;  1Q8R A;  3C9R A;  3JAR A;  3JAR B;  4C8I A;  3M84 A;  2QA4 F;  4HNA A;  3D54 A;  2Z01 A;  3CCQ F;  4ZK7 A;  3ZOP A;  1U40 A;  5JQG B;  4G4X A;  2CHS A;  2ZAU A;  5J2U B;  3RA6 A;  4B46 A;  4BVR A;  3CC7 F;  2ZOD A;  1YJN F;  3I55 F;  3V4D A;  3N2G A;  2N48 A;  3WJQ A;  3CG6 A;  3N2K B;  2V9Y A;  4I55 B;  1JJ2 F;  3CCV F;  4NQ3 A;  1KD1 H;  2Z1U A;  5BMV B;  3TD4 A;  4EI8 A;  2Z1E A;  5HY1 A;  4TV9 B;  4O4H B;  4ZHY B;  3E20 B;  1VQL F;  2VAM A;  3F0D A;  3PAF A;  2YYE A;  3VTI C;  5FNV A;  3MQW A;  2PMP A;  1FNK A;  5GAN K;  3HKE A;  2HVY D;  2RHH A;  3HKE B;  2IG8 A;  4O2B A;  5LXT A;  4X20 B;  3VMF B;  1DT9 A;  3CYP B;  1TUB B;  4C82 A;  1W5F A;  5IT9 M;  1FNJ A;  4ZOL A;  5EO3 A;  4IHJ A;  3QUW A;  3EOR A;  2AIF A;  4ZHQ A;  2WAL A;  3WPX A;  1GX1 A;  1RLG A;  3WGM A;  1VQ9 F;  1IV4 A;  3U0O A;  3IKF A;  5JCO A;  2H8C A;  1CLI A;  4U3J B;  5IYZ B;  3UT5 B;  5JCO C;  3WPW A;  3D01 A;  3C9U A;  4X1I B;  5JVD B;  5JVD A;  3LWQ C;  3IEQ A;  4FFB B;  3CYQ A;  1T0K B;  2ZVY A;  4NWO B;  1U43 A;  3IKE A;  4B45 A;  5HY2 A;  1UFY A;  3KHN A;  5HP7 A;  5BMV A;  3LDT A;  1YJW F;  3J81 M;  3CD6 F;  3CC4 F;  1COM A;  2Q1Y A;  3OBW A;  3QHD A;  1KNJ A;  3P10 A;  2CSL A;  4BT2 A;  5CA0 A;  4B5C A;  3S0Y A;  3MCA B;  1PF5 A;  2R6R 1;  4TUY A;  3UT5 A;  5KX5 B;  3S03 A;  1Q86 H;  3HKD B;  1W59 A;  4O2B B;  3HKD A;  5FNV B;  3QTY A;  2LBT A;  1TVK A;  5KMG B;  2KTU A;  4HNA B;  2UYN A;  1Q82 H;  3V7Q A;  4ZI7 A;  3N4Z A;  3VYS C;  3VIU A;  5HY4 A;  1FFX B;  3I56 F;  1U3L A;  3F0E A;  1VQK F;  4IHJ B;  2RB9 A;  1JD1 A;  3BYQ A;  3WJP A;  4ZOL B;  2L26 A;  3IEW A;  1YQN A;  2RHJ A;  4EB6 B;  2CZW A;  5MN6 A;  3RYF B;  4BT3 A;  3ON1 A;  3NK6 A;  4X3M A;  3K12 A;  3LWR C;  3HJW C;  4M8I A;  1VQ5 F;  2BO1 A;  3ZO8 A;  5IJ0 A;  5ITZ B;  3S06 A;  5G4U C;  2RHO A;  3JAT A;  3RA5 A;  2VGN A;  3JAS A;  3RYH A;  1XV2 A;  4F6R B;  5EZY B;  1FFX A;  1JY8 A;  2JNB A;  2UZH A;  3LWO C;  3HTN A;  1W42 A;  2G9I A;  5GAP K;  4O4J B;  3TD3 A;  4O4H A;  3HKB B;  1M1K H;  5CA1 B;  2PHN A;  1GZ0 A;  4BT5 A;  2OTM A;  1X25 A;  5EIB C;  1IV3 A;  3MCQ A;  1Z5W A;  4O4L B;  3I3F A;  3OON A;  4O4L A;  4G88 A;  3O85 A;  3OW2 F;  1QD9 A;  4U39 A;  3KJK A;  1ZWZ A;  4EI9 A;  4TZZ A;  1VQ4 F;  3IR9 A;  5GIO C;  3FFM A;  4DRX B;  4X20 A;  4DRX A;  3CXC F;  2W8B C;  4I4T B;  1SDS A;  4O4J A;  2I6R A;  1YJ9 F;  2LBW A;  1KNK A;  5C8Y B;  2F9Z C;  5IJ9 A;  1Q7Y H;  3C8L A;  3K2X A;  3KJJ A;  5EYP B;  4E6E A;  5HWE A;  3C9S A;  4G4Z A;  1VQ8 F;  1W5B A;  5LYJ B;  3JAM M;  1E7K A;  2Z1F A;  3CCS F;  1W55 A;  3JVH A;  3WGN A;  3CCE F;  5HXZ A;  2CVL A;  2YXZ A;  4RQO A;  5EB1 B;  3C9T A;  2UYP A;  3N2K A;  4I55 A;  1RQ7 A;  1OFU A;  4NUT A;  1M90 H;  3RYC A;  1W3E X;  1VQN F;  2UYK A;  2OZB A;  5FLX M;  5J2U A;  3NMU C;  3TD5 A;  2LCA A;  5EB0 A;  3PLA C;  3OBY A;  1ONI A;  3M1X A;  3MDO A;  5A2Q M;  4BW0 B;  4YJ2 B;  2BTQ B;  2OTL F;  3JAS B;  3RYH B;  4BY9 D;  2HP0 A;  4ZI7 B;  3CCL F;  4G4V A;  2OTJ F;  2HS0 A;  1W5E A;  2CHT A;  3E1Y A;  1ODE A;  1DBF A;  3K0T A;  3GTZ A;  3CC2 F;  2QTP A;  5EAZ A;  3ZP4 A;  5MN5 A;  5LOV A;  4EI7 A;  2HS3 A;  2VAP A;  5LA6 B;  4DXD A;  2KG4 A; 
#chains in the Genus database with same CATH homology
 3GYQ A;  3ON1 A;  2VGM A;  3LFO A;  3NK6 A;  4X3M A;  3RA6 A;  4BVR A;  3LWR C;  3HJW C;  4BVT A;  3CC7 F;  1VQ5 F;  2BO1 A;  1KQS F;  1YJN F;  3I55 F;  5G4U C;  1QVF F;  3RA5 A;  2VGN A;  1YHQ F;  3WXM B;  3CG6 A;  3D00 A;  1IPA A;  3LWO C;  2JNB A;  1N8R H;  1JJ2 F;  3CCV F;  1W42 A;  5GAP K;  4NQ3 A;  1KD1 H;  1VQ6 F;  1M1K H;  4EI8 A;  5HY1 A;  1KC8 H;  5GIP C;  1GZ0 A;  3CPQ A;  3E20 B;  1VQL F;  3SIV A;  1X7P A;  5HY0 A;  3PAF A;  3NVK E;  2FGY A;  1RA4 A;  2I6D A;  3N4Y A;  3O85 A;  5GAN K;  3CCM F;  1YIT F;  3OW2 F;  3HAX D;  2HVY D;  3NVI B;  1YIJ F;  1ZWZ A;  4EI9 A;  1H7M A;  4TZZ A;  5G4V C;  1K9M H;  2ALE A;  1VQ4 F;  3IR9 A;  2QEX F;  5GIO C;  3FFM A;  3VMF B;  1DT9 A;  1S72 F;  3J7A R;  3CXC F;  1VQ7 F;  1VQM F;  3AGK A;  5IT9 M;  1SDS A;  5EO3 A;  1YJ9 F;  3CCR F;  1PXW A;  2LBW A;  5EWR A;  1K8A H;  1W40 A;  2F9Z C;  3CMA F;  1Q7Y H;  3G6E F;  2AIF A;  4C4W C;  2WAL A;  1RLG A;  1K73 H;  5HWE A;  1VQ8 F;  1VQ9 F;  2GLZ A;  3JAM M;  1E7K A;  3CCJ F;  3NK7 A;  3CCS F;  3JCM M;  3G71 F;  3CCE F;  5HXZ A;  1YI2 F;  1VQO F;  2KTV A;  2FC3 A;  2LBX A;  3LWQ C;  3CPW F;  2OHW A;  1T0K B;  1CN7 A;  5DCV A;  3CME F;  5HY2 A;  1NJI H;  3G4S F;  4NUT A;  1M90 H;  3LWV C;  1QVG F;  1YJW F;  1W3E X;  1VQN F;  1GO1 A;  3J81 M;  3CD6 F;  2OZB A;  3CC4 F;  5FLX M;  1XBI A;  3V7E A;  3SIU A;  3OBW A;  3V3T A;  5HXU A;  3NMU C;  1X52 A;  3CCU F;  1GO0 A;  3PLA C;  3OBY A;  1Q81 H;  1CK2 A;  4LCK A;  2QI2 A;  5A2Q M;  3MCA B;  4BW0 B;  1W2B F;  1X7O A;  1NMU B;  1Q86 H;  5GIN C;  2OTL F;  4BY9 D;  5FJ4 C;  3VI6 A;  4X3L A;  4BVS A;  4BVQ A;  2KTU A;  3J80 M;  3CCL F;  1Q82 H;  2QA4 F;  3V7Q A;  2OTJ F;  4XCQ A;  3N4Z A;  5HY4 A;  3I56 F;  3E1Y A;  1VQK F;  3CC2 F;  3CCQ F;  3LWP C;  2CZW A;  4EI7 A;  1VQP F;  2KG4 A;  1W41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...