2QEXF

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qexF00
4BW0B 1YI2F 3HAXD 1RA4A 3CCVF 1W3EX 2BO1A 4NUTA 1VQOF 5GIOC 3WXMB 2WALA 3J80M 3NMUC 3G6EF 3CCQF 3CC2F 4C4WC 5GAPK 2KTVA 3LFOA 5GIPC 3SIVA 5DCVA 1VQMF 3HJWC 3CPQA 5G4UC 3LWQC 3O85A 3VMFB 1H7MA 1QVGF 3CCMF 5GANK 3NVKE 3I56F 1M1KH 2QEXF 1YJ9F 2HVYD 2OTJF 3LWRC 2LBWA 1YIJF 2OTLF 3LWVC 1M90H 3JCMM 2LBXA 3N4ZA 3OW2F 5IT9M 1W40A 2OHWA 1KC8H 1X52A 3PAFA 1GO0A 3I55F 2AIFA 1SDSA 1Q82H 2VGMA 1VQ7F 5G4VC 3CC4F 4LCKA 3CD6F 4TZZA 1VQ4F 1IPAA 5FLXM 1VQPF 1CK2A 1KQSF 5A2QM 3OBYA 3MCAB 1VQLF 3JAMM 1Q81H 3CG6A 3RA5A 3E20B 1VQKF 4BY9D 3V7EA 1XBIA 3CMAF 1YHQF 1W2BF 3CMEF 4X3LA 5GINC 1DT9A 2KG4A 1RLGA 1N8RH 2FC3A 1YJWF 2KTUA 3CCUF 3CC7F 3V7QA 3CCEF 3LWOC 1NJIH 3LWPC 1NMUB 1JJ2F 3CCLF 1CN7A 1VQ6F 1GO1A 1PXWA 4X3MA 3FFMA 3VI6A 1K8AH 1VQNF 2QI2A 3CCRF 1Q86H 3G71F 1X7PA 2CZWA 1W42A 1K73H 3J81M 3E1YA 1YITF 2QA4F 1ZWZA 1GZ0A 1S72F 1VQ9F 3ON1A 5EO3A 5FJ4C 1K9MH 3G4SF 3RA6A 3CCSF 1E7KA 1YJNF 2I6DA 3CCJF 5EWRA 1VQ8F 1W41A 3GYQA 2JNBA 3J7AR 3PLAC 2OZBA 3N4YA 1QVFF 1T0KB 1Q7YH 1VQ5F 3SIUA 3NK7A 3CPWF 3NK6A 3CXCF 3NVIB 2VGNA 3OBWA 3IR9A 3AGKA 1KD1H 2ALEA 1X7OA
chains in the Genus database with same CATH superfamily
2YXZA 4EI7A 3HAXD 4X1KA 1NQ3A 3C9SA 3S0YA 3P10A 5C8YA 4TUYB 2BTQB 1W59A 3GHZA 5EIBC 3CCQF 3VTIC 5BMVA 3LFOA 4G4VA 3K14A 1SA0B 3HJWC 3CPQA 3VOBA 2RHHA 1QVGF 3KJJA 2EWCA 4FFBB 1CLIA 2QEXF 2HS0A 2W8BC 1YJ9F 4C8EA 1TUBB 5HY2A 4FFBA 3QUWA 2ZOVA 2LBWA 1W5FA 1U3PA 3ZO8A 3LWVC 2BTUA 2OTLF 4YJ3B 2VAMA 3N4ZA 4O2AA 1W40A 1GO0A 3PAFA 2VGMA 3JAWB 2VAWA 3R0PA 1RLUA 3C9TA 3CC4F 5KX5A 4TZZA 4IIJB 4EI9A 5LP6C 3JASA 5HP8A 3HKBB 3C9RA 4BT4A 4IIJA 5CB4B 4F6RB 3JARA 3MCAB 1VQLF 3S02A 5HY1A 1J7HA 5KMGB 4F6RA 2L26A 1XBIA 1U3LA 1W2BF 3C9UA 2R751 3T80A 4BVTA 2FC3A 2ZVYA 3VOAA 2CSLA 4IHJB 1U43A 1OFUA 3CC7F 3V4DA 1TVKA 3UT5A 1Z5WA 3P0ZA 3LWPC 3ELCA 4O4JB 1JJ2F 3N2KA 2PHNA 4B5CA 4BT3A 3CCLF 1VQ6F 2H6LA 4EB6B 1GO1A 3WPWA 1W581 2G9IA 1K8AH 4EB6A 1IV2A 2HS3A 3HKEA 1JFFB 3G71F 2KGWA 1XV2A 3WGNA 1QAHA 3F6MA 2QA4F 1W57A 2GZLA 1JFFA 2HX0A 3ERNA 1GZ0A 1VQ9F 1UFYA 5IYZB 3F0GA 1K9MH 5LOVA 4O4LA 2I6DA 3GYQA 3N2GA 2GVIA 4WBNA 3N4YA 4I4TA 2OZBA 2FGYA 5EYPA 4M8IA 3I7TA 5GONB 5JQGB 3NVIB 4U3JA 5HY4A 2OTMA 1RQ7A 3RYIA 4TV8B 1YI2F 2HP0A 1RA4A 3CCVF 4LNUA 1R1MA 1W3EX 2ZAUA 4NUTA 3MCQA 1VQOF 2HRYA 4HNAA 3WGJA 4NWOB 3J80M 1FNJA 3JATB 3KE1A 3P4EA 5GAPK 2KTVA 3RYCB 4RHAA 3JATA 2Z1TA 3VMFB 3RYCA 5GANK 4ZOLA 3D54A 2NMUA 4U39A 3OONA 5LA6B 3MBMA 3ZOPA 1KNJA 2F9ZC 4X1KB 3TD4A 2HVYD 3FD5A 5HP7A 2N48A 1IV1A 5C8YB 1IV3A 1FSZA 4O4HA 4E6EA 2OHWA 1KC8H 1X52A 5BMVB 1VH8A 5CA1B 2VAPA 1SDSA 3WJPA 3IMPA 2K1SA 3F0DA 2MQEA 5CA1A 5G4VC 3ESJA 1FFXB 1XRGA 2P6YA 3DDNA 3ZP7A 3GTZA 4ZHWA 1JD1A 5EAZA 1FFXA 5FLXM 1KQSF 3OBYA 3WGMA 5JH7A 3JAMM 1Z5VA 1Q81H 3V7EA 3RA5A 4O2AB 1H47A 3CMAF 4X3LA 4ZHVA 5GINC 1U40A 3M84A 5CA0A 1N8RH 3M4SA 2PMPA 1ODEA 1YJWF 1DBFA 1YQNA 1W5EA 5KX5B 1VK3A 1SZQA 2Q1XA 3JASB 1NMUB 4X1YA 3HWUA 2ZF8A 3S03A 3JARB 3VI6A 2H8CA 4C82A 2UYJA 5EZYA 1Q86H 2IQQA 2AIZP 1K73H 4ZHQA 3E1YA 2H8EA 1H48A 1S72F 3ON1A 2ZVZA 5FJ4C 5LP6A 5FNVA 3RYFA 2R6R1 3FD6A 1E7KA 1GX1A 2B33A 1TVKB 3CCJF 3UT5B 1VQ8F 4I50A 3J7AR 2JNBA 3N2KB 3PLAC 1QVFF 1T0KB 3VIUA 1JY8A 3S0HA 4ZI7A 4YJ2B 3AGKA 2ALEA 3HKEB 3B6NA 4YJ2A 4BW0B 4ERHA 3KIZA 2Z1EA 3HKCA 2BO1A 3VYSC 5GIOC 1VQVA 5LOVB 4O4LB 5J2TB 2Z1UA 3RYHA 3G6EF 3N2GB 3CC2F 4WBNB 4I4TB 5J2TA 5GIPC 3SIVA 5EYPB 3D00A 1VQMF 2HRUA 3I3FA 4BVQA 3LWQC 3TD5A 3NVKE 1YGYA 3HKDA 3I56F 4C81A 4U3JB 4B62A 3RYIB 1M1KH 4DXDA 2HP0B 4LNUB 2UYPA 4BT6A 3BYQA 4BT5A 1YIJF 4HNAB 3DC2A 4X20B 1M90H 3K2XA 2LBXA 2RHJA 5IT9M 3ZP4A 1W55A 4X20A 3I55F 2AIFA 3S06A 3V3TA 3HTNA 5EIBD 1VQ7F 2UYKA 3S0WA 4O2BA 4LCKA 4ZOLB 3CD6F 2IG8A 2DT4A 2LBTA 3WGLA 4X1IA 3D01A 5LYJB 1IPAA 1CK2A 4ZK7A 3U0OA 5A2QM 1VHAA 5LYJA 5IJ9A 3CG6A 4PWTA 1RQ2A 4O4HB 3CYQA 1ONIA 3JVHA 3K0TA 3RE3A 4BT7A 3CMEF 3L7QA 1DT9A 1RLGA 3C8LA 2AMTA 5ITZA 3EORA 3CCUF 5B8FA 3MQWA 3FBAA 1T0AA 4ZHYB 2HQSC 1CN7A 2VXYA 1PXWA 3E22A 4G88A 3FFMA 5LXTB 5HXZA 1COMA 5JH7B 4DRXB 2QI2A 4I55A 5LXTA 1X7PA 4DRXA 2CZWA 1W42A 3JALB 3J81M 1YITF 5EB1B 5CA0B 3JALA 2DYYA 5EO3A 3G4SF 4TUYA 2RHLA 3RA6A 3CCSF 3CB2A 5EWRA 1W41A 4X1YB 2CHSA 4KWEA 1FNKA 5IJ0B 1Q7YH 1SA0A 3SIUA 3NK7A 3CPWF 5IJ0A 5HXUA 2CHTA 3OBWA 3IR9A 2ZODA 1KD1H 5EZYB 4C8IA 1IV4A 3F0EA 1X7OA 4ZHQB 3QTYA 4BVRA 1TUBA 3QHDA 3WGKA 5LP6B 5FNVB 3RYFB 5JCOC 3IEQA 3WXMB 2UZHA 2WALA 3NMUC 4YJ3A 4NQ3A 5MN5A 4I50B 4C4WC 3TD3A 5MN6A 2CW4A 3KJKA 5DCVA 1W5AA 5G4UC 5JVDB 3JAWA 2YYEA 3O85A 4ZI7B 3LYBA 1H7MA 3CCMF 5JVDA 3MDOA 5JCOA 4G4YA 3HKBA 4B45A 1Q8RA 2UYNB 1OAPA 1XHOA 4EI8A 3HKCB 5CB4A 2OTJF 3LWRC 4TV9B 2UYNA 5KMGA 3VYUC 3JCMM 3WPXA 2Q1YA 3RYHB 4TV9A 3OW2F 2HP3A 3KHNA 4G4ZA 1X25A 1Q82H 2V9YA 3WJQA 3WJRA 4O4IB 4IHJA 3HKDB 5EB0A 1QD9A 4O4IA 1VQ4F 4O4JA 4XCQA 2QTPA 1VQPF 1PF5A 2CWJA 3IKFA 3E20B 1VQKF 4BY9D 1YHQF 2CVLA 4C8GA 2KG4A 3F0FA 2RHOA 2KTUA 5IYZA 4O2BB 3V7QA 3CCEF 1KNKA 3VO8A 3LWOC 3VYTC 1NJIH 2LCAA 5HWEA 2GLZA 4X1IB 3LMEA 3CYPB 5HY0A 4X3MA 1UI9A 3IKEA 3FPIA 5IJ9B 1VQNF 5GONA 5JQGA 3CCRF 4BVSA 2IAFA 3K12A 4B46A 4TV8A 3M1XA 2Z1FA 3JAKB 1ZWZA 5AVMA 2Z01A 5ITZB 3JAKA 3LDTA 4G4XA 4R40B 1YJNF 1QU9A 1JN1A 2HS4A 3VCZA 3E22B 1VQ5F 1W5BA 5J2UB 2BTOA 4RQOA 2I6RA 3NK6A 3Q8HA 3CXCF 2VGNA 4I55B 2RB9A 4G4WA 5J2UA 4BT2A 5MN4A 5LA6A 3IEWA
chains in the Genus database with same CATH topology
4BW0B 4EI7A 1YI2F 3HAXD 4BVRA 1RA4A 3CCVF 1W3EX 2BO1A 4NUTA 1VQOF 5GIOC 3WXMB 2WALA 3J80M 3NMUC 4NQ3A 3G6EF 3CCQF 3CC2F 4C4WC 5GAPK 2KTVA 3LFOA 5GIPC 3SIVA 5DCVA 3D00A 1VQMF 3HJWC 3CPQA 5G4UC 3LWQC 4BVQA 3O85A 3VMFB 1H7MA 1QVGF 3CCMF 5GANK 3NVKE 3I56F 1M1KH 2QEXF 1YJ9F 2F9ZC 4EI8A 5HY2A 2HVYD 2OTJF 3LWRC 2LBWA 1YIJF 2OTLF 3LWVC 1M90H 3JCMM 2LBXA 3N4ZA 3OW2F 5IT9M 1W40A 2OHWA 1KC8H 1X52A 3PAFA 1GO0A 3I55F 2AIFA 1SDSA 1Q82H 3V3TA 2VGMA 1VQ7F 5G4VC 3CC4F 4LCKA 3CD6F 4TZZA 4EI9A 1VQ4F 4XCQA 1IPAA 5FLXM 1VQPF 1CK2A 1KQSF 5A2QM 3OBYA 3MCAB 1VQLF 5HY1A 3JAMM 1Q81H 3CG6A 3RA5A 3E20B 1VQKF 4BY9D 3V7EA 1XBIA 3CMAF 1YHQF 1W2BF 3CMEF 4X3LA 5GINC 1DT9A 2KG4A 1RLGA 4BVTA 1N8RH 2FC3A 1YJWF 2KTUA 3CCUF 3CC7F 3V7QA 3CCEF 3LWOC 1NJIH 3LWPC 5HWEA 2GLZA 1NMUB 1JJ2F 3CCLF 1CN7A 1VQ6F 1GO1A 1PXWA 5HY0A 4X3MA 3FFMA 3VI6A 5HXZA 1K8AH 1VQNF 2QI2A 3CCRF 4BVSA 1Q86H 3G71F 1X7PA 2CZWA 1W42A 1K73H 3J81M 3E1YA 1YITF 2QA4F 1ZWZA 1GZ0A 1S72F 1VQ9F 3ON1A 5EO3A 5FJ4C 1K9MH 3G4SF 3RA6A 3CCSF 1E7KA 1YJNF 2I6DA 3CCJF 5EWRA 1VQ8F 1W41A 3GYQA 2JNBA 3J7AR 3PLAC 2OZBA 3N4YA 1QVFF 2FGYA 1T0KB 1Q7YH 1VQ5F 3SIUA 3NK7A 3CPWF 5HXUA 3NK6A 3CXCF 3NVIB 2VGNA 3OBWA 3IR9A 3AGKA 1KD1H 2ALEA 5HY4A 1X7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW0 B;  1YI2 F;  3HAX D;  1RA4 A;  3CCV F;  1W3E X;  2BO1 A;  4NUT A;  1VQO F;  5GIO C;  3WXM B;  2WAL A;  3J80 M;  3NMU C;  3G6E F;  3CCQ F;  3CC2 F;  4C4W C;  5GAP K;  2KTV A;  3LFO A;  5GIP C;  3SIV A;  5DCV A;  1VQM F;  3HJW C;  3CPQ A;  5G4U C;  3LWQ C;  3O85 A;  3VMF B;  1H7M A;  1QVG F;  3CCM F;  5GAN K;  3NVK E;  3I56 F;  1M1K H;  2QEX F;  1YJ9 F;  2HVY D;  2OTJ F;  3LWR C;  2LBW A;  1YIJ F;  2OTL F;  3LWV C;  1M90 H;  3JCM M;  2LBX A;  3N4Z A;  3OW2 F;  5IT9 M;  1W40 A;  2OHW A;  1KC8 H;  1X52 A;  3PAF A;  1GO0 A;  3I55 F;  2AIF A;  1SDS A;  1Q82 H;  2VGM A;  1VQ7 F;  5G4V C;  3CC4 F;  4LCK A;  3CD6 F;  4TZZ A;  1VQ4 F;  1IPA A;  5FLX M;  1VQP F;  1CK2 A;  1KQS F;  5A2Q M;  3OBY A;  3MCA B;  1VQL F;  3JAM M;  1Q81 H;  3CG6 A;  3RA5 A;  3E20 B;  1VQK F;  4BY9 D;  3V7E A;  1XBI A;  3CMA F;  1YHQ F;  1W2B F;  3CME F;  4X3L A;  5GIN C;  1DT9 A;  2KG4 A;  1RLG A;  1N8R H;  2FC3 A;  1YJW F;  2KTU A;  3CCU F;  3CC7 F;  3V7Q A;  3CCE F;  3LWO C;  1NJI H;  3LWP C;  1NMU B;  1JJ2 F;  3CCL F;  1CN7 A;  1VQ6 F;  1GO1 A;  1PXW A;  4X3M A;  3FFM A;  3VI6 A;  1K8A H;  1VQN F;  2QI2 A;  3CCR F;  1Q86 H;  3G71 F;  1X7P A;  2CZW A;  1W42 A;  1K73 H;  3J81 M;  3E1Y A;  1YIT F;  2QA4 F;  1ZWZ A;  1GZ0 A;  1S72 F;  1VQ9 F;  3ON1 A;  5EO3 A;  5FJ4 C;  1K9M H;  3G4S F;  3RA6 A;  3CCS F;  1E7K A;  1YJN F;  2I6D A;  3CCJ F;  5EWR A;  1VQ8 F;  1W41 A;  3GYQ A;  2JNB A;  3J7A R;  3PLA C;  2OZB A;  3N4Y A;  1QVF F;  1T0K B;  1Q7Y H;  1VQ5 F;  3SIU A;  3NK7 A;  3CPW F;  3NK6 A;  3CXC F;  3NVI B;  2VGN A;  3OBW A;  3IR9 A;  3AGK A;  1KD1 H;  2ALE A;  1X7O A; 
#chains in the Genus database with same CATH topology
 2YXZ A;  4EI7 A;  3HAX D;  4X1K A;  1NQ3 A;  3C9S A;  3S0Y A;  3P10 A;  5C8Y A;  4TUY B;  2BTQ B;  1W59 A;  3GHZ A;  5EIB C;  3CCQ F;  3VTI C;  5BMV A;  3LFO A;  4G4V A;  3K14 A;  1SA0 B;  3HJW C;  3CPQ A;  3VOB A;  2RHH A;  1QVG F;  3KJJ A;  2EWC A;  4FFB B;  1CLI A;  2QEX F;  2HS0 A;  2W8B C;  1YJ9 F;  4C8E A;  1TUB B;  5HY2 A;  4FFB A;  3QUW A;  2ZOV A;  2LBW A;  1W5F A;  1U3P A;  3ZO8 A;  3LWV C;  2BTU A;  2OTL F;  4YJ3 B;  2VAM A;  3N4Z A;  4O2A A;  1W40 A;  1GO0 A;  3PAF A;  2VGM A;  3JAW B;  2VAW A;  3R0P A;  1RLU A;  3C9T A;  3CC4 F;  5KX5 A;  4TZZ A;  4IIJ B;  4EI9 A;  5LP6 C;  3JAS A;  5HP8 A;  3HKB B;  3C9R A;  4BT4 A;  4IIJ A;  5CB4 B;  4F6R B;  3JAR A;  3MCA B;  1VQL F;  3S02 A;  5HY1 A;  1J7H A;  5KMG B;  4F6R A;  2L26 A;  1XBI A;  1U3L A;  1W2B F;  3C9U A;  2R75 1;  3T80 A;  4BVT A;  2FC3 A;  2ZVY A;  3VOA A;  2CSL A;  4IHJ B;  1U43 A;  1OFU A;  3CC7 F;  3V4D A;  1TVK A;  3UT5 A;  1Z5W A;  3P0Z A;  3LWP C;  3ELC A;  4O4J B;  1JJ2 F;  3N2K A;  2PHN A;  4B5C A;  4BT3 A;  3CCL F;  1VQ6 F;  2H6L A;  4EB6 B;  1GO1 A;  3WPW A;  1W58 1;  2G9I A;  1K8A H;  4EB6 A;  1IV2 A;  2HS3 A;  3HKE A;  1JFF B;  3G71 F;  2KGW A;  1XV2 A;  3WGN A;  1QAH A;  3F6M A;  2QA4 F;  1W57 A;  2GZL A;  1JFF A;  2HX0 A;  3ERN A;  1GZ0 A;  1VQ9 F;  1UFY A;  5IYZ B;  3F0G A;  1K9M H;  5LOV A;  4O4L A;  2I6D A;  3GYQ A;  3N2G A;  2GVI A;  4WBN A;  3N4Y A;  4I4T A;  2OZB A;  2FGY A;  5EYP A;  4M8I A;  3I7T A;  5GON B;  5JQG B;  3NVI B;  4U3J A;  5HY4 A;  2OTM A;  1RQ7 A;  3RYI A;  4TV8 B;  1YI2 F;  2HP0 A;  1RA4 A;  3CCV F;  4LNU A;  1R1M A;  1W3E X;  2ZAU A;  4NUT A;  3MCQ A;  1VQO F;  2HRY A;  4HNA A;  3WGJ A;  4NWO B;  3J80 M;  1FNJ A;  3JAT B;  3KE1 A;  3P4E A;  5GAP K;  2KTV A;  3RYC B;  4RHA A;  3JAT A;  2Z1T A;  3VMF B;  3RYC A;  5GAN K;  4ZOL A;  3D54 A;  2NMU A;  4U39 A;  3OON A;  5LA6 B;  3MBM A;  3ZOP A;  1KNJ A;  2F9Z C;  4X1K B;  3TD4 A;  2HVY D;  3FD5 A;  5HP7 A;  2N48 A;  1IV1 A;  5C8Y B;  1IV3 A;  1FSZ A;  4O4H A;  4E6E A;  2OHW A;  1KC8 H;  1X52 A;  5BMV B;  1VH8 A;  5CA1 B;  2VAP A;  1SDS A;  3WJP A;  3IMP A;  2K1S A;  3F0D A;  2MQE A;  5CA1 A;  5G4V C;  3ESJ A;  1FFX B;  1XRG A;  2P6Y A;  3DDN A;  3ZP7 A;  3GTZ A;  4ZHW A;  1JD1 A;  5EAZ A;  1FFX A;  5FLX M;  1KQS F;  3OBY A;  3WGM A;  5JH7 A;  3JAM M;  1Z5V A;  1Q81 H;  3V7E A;  3RA5 A;  4O2A B;  1H47 A;  3CMA F;  4X3L A;  4ZHV A;  5GIN C;  1U40 A;  3M84 A;  5CA0 A;  1N8R H;  3M4S A;  2PMP A;  1ODE A;  1YJW F;  1DBF A;  1YQN A;  1W5E A;  5KX5 B;  1VK3 A;  1SZQ A;  2Q1X A;  3JAS B;  1NMU B;  4X1Y A;  3HWU A;  2ZF8 A;  3S03 A;  3JAR B;  3VI6 A;  2H8C A;  4C82 A;  2UYJ A;  5EZY A;  1Q86 H;  2IQQ A;  2AIZ P;  1K73 H;  4ZHQ A;  3E1Y A;  2H8E A;  1H48 A;  1S72 F;  3ON1 A;  2ZVZ A;  5FJ4 C;  5LP6 A;  5FNV A;  3RYF A;  2R6R 1;  3FD6 A;  1E7K A;  1GX1 A;  2B33 A;  1TVK B;  3CCJ F;  3UT5 B;  1VQ8 F;  4I50 A;  3J7A R;  2JNB A;  3N2K B;  3PLA C;  1QVF F;  1T0K B;  3VIU A;  1JY8 A;  3S0H A;  4ZI7 A;  4YJ2 B;  3AGK A;  2ALE A;  3HKE B;  3B6N A;  4YJ2 A;  4BW0 B;  4ERH A;  3KIZ A;  2Z1E A;  3HKC A;  2BO1 A;  3VYS C;  5GIO C;  1VQV A;  5LOV B;  4O4L B;  5J2T B;  2Z1U A;  3RYH A;  3G6E F;  3N2G B;  3CC2 F;  4WBN B;  4I4T B;  5J2T A;  5GIP C;  3SIV A;  5EYP B;  3D00 A;  1VQM F;  2HRU A;  3I3F A;  4BVQ A;  3LWQ C;  3TD5 A;  3NVK E;  1YGY A;  3HKD A;  3I56 F;  4C81 A;  4U3J B;  4B62 A;  3RYI B;  1M1K H;  4DXD A;  2HP0 B;  4LNU B;  2UYP A;  4BT6 A;  3BYQ A;  4BT5 A;  1YIJ F;  4HNA B;  3DC2 A;  4X20 B;  1M90 H;  3K2X A;  2LBX A;  2RHJ A;  5IT9 M;  3ZP4 A;  1W55 A;  4X20 A;  3I55 F;  2AIF A;  3S06 A;  3V3T A;  3HTN A;  5EIB D;  1VQ7 F;  2UYK A;  3S0W A;  4O2B A;  4LCK A;  4ZOL B;  3CD6 F;  2IG8 A;  2DT4 A;  2LBT A;  3WGL A;  4X1I A;  3D01 A;  5LYJ B;  1IPA A;  1CK2 A;  4ZK7 A;  3U0O A;  5A2Q M;  1VHA A;  5LYJ A;  5IJ9 A;  3CG6 A;  4PWT A;  1RQ2 A;  4O4H B;  3CYQ A;  1ONI A;  3JVH A;  3K0T A;  3RE3 A;  4BT7 A;  3CME F;  3L7Q A;  1DT9 A;  1RLG A;  3C8L A;  2AMT A;  5ITZ A;  3EOR A;  3CCU F;  5B8F A;  3MQW A;  3FBA A;  1T0A A;  4ZHY B;  2HQS C;  1CN7 A;  2VXY A;  1PXW A;  3E22 A;  4G88 A;  3FFM A;  5LXT B;  5HXZ A;  1COM A;  5JH7 B;  4DRX B;  2QI2 A;  4I55 A;  5LXT A;  1X7P A;  4DRX A;  2CZW A;  1W42 A;  3JAL B;  3J81 M;  1YIT F;  5EB1 B;  5CA0 B;  3JAL A;  2DYY A;  5EO3 A;  3G4S F;  4TUY A;  2RHL A;  3RA6 A;  3CCS F;  3CB2 A;  5EWR A;  1W41 A;  4X1Y B;  2CHS A;  4KWE A;  1FNK A;  5IJ0 B;  1Q7Y H;  1SA0 A;  3SIU A;  3NK7 A;  3CPW F;  5IJ0 A;  5HXU A;  2CHT A;  3OBW A;  3IR9 A;  2ZOD A;  1KD1 H;  5EZY B;  4C8I A;  1IV4 A;  3F0E A;  1X7O A;  4ZHQ B;  3QTY A;  4BVR A;  1TUB A;  3QHD A;  3WGK A;  5LP6 B;  5FNV B;  3RYF B;  5JCO C;  3IEQ A;  3WXM B;  2UZH A;  2WAL A;  3NMU C;  4YJ3 A;  4NQ3 A;  5MN5 A;  4I50 B;  4C4W C;  3TD3 A;  5MN6 A;  2CW4 A;  3KJK A;  5DCV A;  1W5A A;  5G4U C;  5JVD B;  3JAW A;  2YYE A;  3O85 A;  4ZI7 B;  3LYB A;  1H7M A;  3CCM F;  5JVD A;  3MDO A;  5JCO A;  4G4Y A;  3HKB A;  4B45 A;  1Q8R A;  2UYN B;  1OAP A;  1XHO A;  4EI8 A;  3HKC B;  5CB4 A;  2OTJ F;  3LWR C;  4TV9 B;  2UYN A;  5KMG A;  3VYU C;  3JCM M;  3WPX A;  2Q1Y A;  3RYH B;  4TV9 A;  3OW2 F;  2HP3 A;  3KHN A;  4G4Z A;  1X25 A;  1Q82 H;  2V9Y A;  3WJQ A;  3WJR A;  4O4I B;  4IHJ A;  3HKD B;  5EB0 A;  1QD9 A;  4O4I A;  1VQ4 F;  4O4J A;  4XCQ A;  2QTP A;  1VQP F;  1PF5 A;  2CWJ A;  3IKF A;  3E20 B;  1VQK F;  4BY9 D;  1YHQ F;  2CVL A;  4C8G A;  2KG4 A;  3F0F A;  2RHO A;  2KTU A;  5IYZ A;  4O2B B;  3V7Q A;  3CCE F;  1KNK A;  3VO8 A;  3LWO C;  3VYT C;  1NJI H;  2LCA A;  5HWE A;  2GLZ A;  4X1I B;  3LME A;  3CYP B;  5HY0 A;  4X3M A;  1UI9 A;  3IKE A;  3FPI A;  5IJ9 B;  1VQN F;  5GON A;  5JQG A;  3CCR F;  4BVS A;  2IAF A;  3K12 A;  4B46 A;  4TV8 A;  3M1X A;  2Z1F A;  3JAK B;  1ZWZ A;  5AVM A;  2Z01 A;  5ITZ B;  3JAK A;  3LDT A;  4G4X A;  4R40 B;  1YJN F;  1QU9 A;  1JN1 A;  2HS4 A;  3VCZ A;  3E22 B;  1VQ5 F;  1W5B A;  5J2U B;  2BTO A;  4RQO A;  2I6R A;  3NK6 A;  3Q8H A;  3CXC F;  2VGN A;  4I55 B;  2RB9 A;  4G4W A;  5J2U A;  4BT2 A;  5MN4 A;  5LA6 A;  3IEW A; 
#chains in the Genus database with same CATH homology
 4BW0 B;  4EI7 A;  1YI2 F;  3HAX D;  4BVR A;  1RA4 A;  3CCV F;  1W3E X;  2BO1 A;  4NUT A;  1VQO F;  5GIO C;  3WXM B;  2WAL A;  3J80 M;  3NMU C;  4NQ3 A;  3G6E F;  3CCQ F;  3CC2 F;  4C4W C;  5GAP K;  2KTV A;  3LFO A;  5GIP C;  3SIV A;  5DCV A;  3D00 A;  1VQM F;  3HJW C;  3CPQ A;  5G4U C;  3LWQ C;  4BVQ A;  3O85 A;  3VMF B;  1H7M A;  1QVG F;  3CCM F;  5GAN K;  3NVK E;  3I56 F;  1M1K H;  2QEX F;  1YJ9 F;  2F9Z C;  4EI8 A;  5HY2 A;  2HVY D;  2OTJ F;  3LWR C;  2LBW A;  1YIJ F;  2OTL F;  3LWV C;  1M90 H;  3JCM M;  2LBX A;  3N4Z A;  3OW2 F;  5IT9 M;  1W40 A;  2OHW A;  1KC8 H;  1X52 A;  3PAF A;  1GO0 A;  3I55 F;  2AIF A;  1SDS A;  1Q82 H;  3V3T A;  2VGM A;  1VQ7 F;  5G4V C;  3CC4 F;  4LCK A;  3CD6 F;  4TZZ A;  4EI9 A;  1VQ4 F;  4XCQ A;  1IPA A;  5FLX M;  1VQP F;  1CK2 A;  1KQS F;  5A2Q M;  3OBY A;  3MCA B;  1VQL F;  5HY1 A;  3JAM M;  1Q81 H;  3CG6 A;  3RA5 A;  3E20 B;  1VQK F;  4BY9 D;  3V7E A;  1XBI A;  3CMA F;  1YHQ F;  1W2B F;  3CME F;  4X3L A;  5GIN C;  1DT9 A;  2KG4 A;  1RLG A;  4BVT A;  1N8R H;  2FC3 A;  1YJW F;  2KTU A;  3CCU F;  3CC7 F;  3V7Q A;  3CCE F;  3LWO C;  1NJI H;  3LWP C;  5HWE A;  2GLZ A;  1NMU B;  1JJ2 F;  3CCL F;  1CN7 A;  1VQ6 F;  1GO1 A;  1PXW A;  5HY0 A;  4X3M A;  3FFM A;  3VI6 A;  5HXZ A;  1K8A H;  1VQN F;  2QI2 A;  3CCR F;  4BVS A;  1Q86 H;  3G71 F;  1X7P A;  2CZW A;  1W42 A;  1K73 H;  3J81 M;  3E1Y A;  1YIT F;  2QA4 F;  1ZWZ A;  1GZ0 A;  1S72 F;  1VQ9 F;  3ON1 A;  5EO3 A;  5FJ4 C;  1K9M H;  3G4S F;  3RA6 A;  3CCS F;  1E7K A;  1YJN F;  2I6D A;  3CCJ F;  5EWR A;  1VQ8 F;  1W41 A;  3GYQ A;  2JNB A;  3J7A R;  3PLA C;  2OZB A;  3N4Y A;  1QVF F;  2FGY A;  1T0K B;  1Q7Y H;  1VQ5 F;  3SIU A;  3NK7 A;  3CPW F;  5HXU A;  3NK6 A;  3CXC F;  3NVI B;  2VGN A;  3OBW A;  3IR9 A;  3AGK A;  1KD1 H;  2ALE A;  5HY4 A;  1X7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...