2QEXF

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qexF00
1ZWZA 1GO1A 3N4YA 3CCUF 1KD1H 3CMAF 3SIVA 1QVGF 1M1KH 2OTLF 1T0KB 3I55F 2JNBA 3AGKA 1Q81H 5GINC 2LBWA 2KG4A 1DT9A 1M90H 3CCVF 3LWQC 1H7MA 1W2BF 3LWRC 3CCRF 3WXMB 1YITF 1KC8H 3CCJF 1K8AH 2OTJF 5G4UC 1VQLF 3CC2F 1YJWF 1YI2F 1VQPF 4X3LA 1YJ9F 1KQSF 3VMFB 1W40A 5A2QM 1K9MH 3CD6F 3LWOC 3V7QA 1E7KA 3CCEF 1VQMF 5IT9M 3JAMM 1X7PA 3V7EA 3G71F 1W41A 3OBWA 1N8RH 3GYQA 3VI6A 3RA5A 3CC7F 2CZWA 3CCLF 4BW0B 1NMUB 3CXCF 3CCMF 3OW2F 1Q82H 5G4VC 5FJ4C 2VGMA 3I56F 1QVFF 1YHQF 1X52A 1VQ6F 3NVIB 5EO3A 2QA4F 3SIUA 3JCMM 2QI2A 2FC3A 5GIOC 4NUTA 1W3EX 2VGNA 1GZ0A 1XBIA 3J80M 3O85A 1Q86H 5EWRA 1NJIH 3FFMA 2I6DA 2AIFA 3OBYA 3NK6A 1VQ4F 3NMUC 1VQKF 1CK2A 1RLGA 3LWVC 2QEXF 3J7AR 4X3MA 3E1YA 5GANK 1W42A 1IPAA 1VQ8F 3G4SF 3E20B 3RA6A 3LFOA 1VQOF 1K73H 2WALA 5GAPK 3NK7A 1S72F 3CCQF 3ON1A 3PAFA 5DCVA 4C4WC 1RA4A 1X7OA 3J81M 5GIPC 1SDSA 1JJ2F 4LCKA 1VQ9F 2KTUA 3CCSF 1YJNF 3CG6A 2OZBA 3IR9A 3CPQA 3LWPC 1CN7A 3NVKE 3CC4F 2HVYD 3N4ZA 3CMEF 1VQ5F 4TZZA 3HAXD 3PLAC 2ALEA 3CPWF 1Q7YH 1VQNF 2BO1A 4BY9D 1GO0A 2KTVA 2LBXA 2OHWA 3MCAB 3G6EF 1VQ7F 5FLXM 1YIJF 1PXWA 3HJWC
chains in the Genus database with same CATH superfamily
1XV2A 4U3JA 1KNJA 1ZWZA 3N4YA 2GVIA 3KE1A 3C8LA 3KHNA 4YJ3A 2H6LA 3WPWA 4WBNB 1QVGF 3DDNA 2OTMA 5KX5A 5GINC 3CYPB 2LBWA 4BT6A 3CCVF 1IV3A 4O4JA 5JH7A 3VIUA 3WXMB 5LYJB 1YITF 3CC2F 1VQPF 4TV9B 4X3LA 1KQSF 1W40A 1U40A 3MCQA 3V7QA 3S0WA 3FPIA 3MDOA 1X7PA 1RQ2A 1X25A 1FNKA 5AVMA 1N8RH 3GYQA 2RHHA 2UYNA 3LDTA 2V9YA 5GONA 5G4VC 4O4LB 3WPXA 5FJ4C 4BVSA 1QVFF 1X52A 3I3FA 4KWEA 2QA4F 3K14A 1XRGA 4RHAA 3RE3A 5HXZA 1W3EX 3JAWA 5HY4A 3RYHA 5MN5A 4ZHVA 3RYFA 2YYEA 4O2BB 4FFBB 2LCAA 4WBNA 5EIBD 2W8BC 4EB6B 3HWUA 2YXZA 5IJ0A 3ERNA 1VQKF 4U3JB 1RLGA 3LWVC 3IMPA 3J7AR 4EI7A 1QD9A 4B46A 3S0YA 2BTOA 1W42A 1IPAA 1W55A 3D01A 4B45A 3E20B 3WGKA 4IIJA 3RA6A 3P4EA 1S72F 4F6RB 1TUBB 3F0FA 3PAFA 4PWTA 4G4ZA 3J81M 4IHJB 5GIPC 1SDSA 4O4IA 4LCKA 3IEQA 4X1YB 3LYBA 4I55B 4X1IA 3MQWA 3VOAA 5CB4A 2OZBA 3IR9A 3CPQA 2HVYD 5JQGA 2HS3A 3HAXD 4F6RA 5J2UB 1DBFA 2GLZA 3E22A 2BO1A 3FD5A 4BY9D 3UT5A 1VQVA 4G4WA 2KTVA 5HY2A 1TVKB 2LBXA 2OHWA 3M1XA 1SA0B 4ZOLB 3OONA 1VQ7F 1YIJF 1PXWA 2BTQB 2NMUA 5JQGB 2UYPA 3HJWC 5GONB 1GO1A 5EYPB 3M4SA 3S03A 4R40B 3CMAF 1M1KH 1T0KB 3F6MA 1R1MA 4O4JB 5LYJA 5JH7B 3AGKA 4ZHWA 2KG4A 1ONIA 1IV2A 4G88A 3LWQC 3HKCB 5G4UC 2OTJF 5J2TA 3CCJF 1VQLF 3ZO8A 1VH8A 1YJ9F 3N2GB 3CB2A 5EB0A 1FNJA 3GHZA 2UYKA 3HKBB 3JAMM 3K2XA 1W5BA 1FSZA 2IQQA 4BT7A 3OBWA 3HKDA 1JFFA 2VAWA 3VTIC 3RA5A 4BVQA 3CC7F 2CZWA 1NMUB 4LNUB 2KGWA 3WGLA 2UYNB 1Q82H 1VK3A 2ZAUA 5HWEA 2VGMA 4TUYA 3ELCA 3VO8A 3S02A 1VQ6F 4G4VA 4HNAA 5EO3A 5BMVA 5C8YA 2CSLA 3SIUA 3M84A 3FD6A 1PF5A 3F0EA 4EI8A 4I55A 4X1IB 2PMPA 2QTPA 2ZODA 3JARB 5B8FA 3O85A 2R6R1 3JALA 3JASA 2HS4A 3EORA 4TUYB 5FNVB 5EWRA 1RQ7A 1NJIH 3RYIB 5ITZA 5MN6A 3JAKB 3L7QA 3NK6A 1GX1A 3QUWA 3ZOPA 1UFYA 2QEXF 1SZQA 3HKBA 4X3MA 4O4HB 2BTUA 1JY8A 3Q8HA 1VQ8F 3G4SF 1XHOA 1U3LA 1VQOF 3LFOA 3JATA 2WALA 3NK7A 3GTZA 5DCVA 4BT5A 1FFXA 2L26A 5HP8A 2AIZP 1X7OA 5CA0B 1OAPA 3K0TA 5LOVA 2HQSC 2KTUA 3CCSF 2Q1YA 3F0GA 4ZI7A 4C8EA 3NVKE 3CC4F 1JFFB 4YJ2B 3N4ZA 1VQ5F 3PLAC 2ALEA 5LP6B 4YJ2A 5EZYA 3FBAA 2AMTA 4X20B 5HY1A 3E22B 3N2GA 1W5FA 3G6EF 4G4XA 5FLXM 5CA1A 4X1KA 2UZHA 5LP6C 3JATB 2N48A 5LXTA 1KD1H 2Z1TA 3C9UA 4EI9A 5IJ9B 5HY0A 3VYTC 4DRXB 2ZVYA 3RYCA 1VHAA 1M90H 5KX5B 4ZHQA 1KC8H 1K8AH 1H48A 1SA0A 1YJWF 2HP3A 4ERHA 5KMGB 3D00A 3RYIA 5ITZB 3LWOC 1E7KA 1VQMF 5IT9M 4B5CA 3V7EA 3RYCB 2VAPA 1W41A 3BYQA 4I50A 3VI6A 1QAHA 5HP7A 2GZLA 2RB9A 3CCLF 3C9SA 4BW0B 2HP0A 4X1YA 3OW2F 3WGMA 3I56F 1FFXB 1UI9A 3VYUC 2HS0A 3NVIB 5JCOA 4C8IA 3JCMM 4RQOA 3IKEA 3KJJA 2FC3A 2HP0B 4NUTA 2VGNA 4BT3A 1GZ0A 5KMGA 3J80M 3C9TA 1YQNA 3HKEB 3I7TA 3VOBA 3N2KB 2UYJA 5LOVB 2I6DA 1J7HA 4NWOB 1Q8RA 2CHSA 4NQ3A 1VQ4F 3NMUC 1IV1A 1CK2A 5HXUA 2B33A 3F0DA 4FFBA 4HNAB 3JASB 3DC2A 5IYZA 3QHDA 5IJ9A 1W5AA 4U39A 4TV9A 1NQ3A 3B6NA 3P0ZA 3RYHB 3VCZA 4C82A 2Z1FA 4O4HA 5LA6A 4X20A 2EWCA 2LBTA 3TD3A 5CB4B 3CYQA 1JN1A 2F9ZC 4I4TA 3CCQF 4X1KB 3ON1A 5EB1B 3KIZA 4C4WC 3U0OA 2K1SA 1IV4A 1JD1A 4YJ3B 2R751 2Z01A 4IIJB 1VQ9F 1YJNF 3TD5A 3CG6A 3LWPC 1CN7A 3HKEA 5J2TB 3HKDB 1YGYA 5LP6A 3CMEF 3JARA 3T80A 3ZP7A 2MQEA 5IJ0B 1VQNF 1U3PA 2HRUA 1RLUA 2I6RA 1H47A 4TV8A 3WJQA 4E6EA 3D54A 1OFUA 4I50B 1TUBA 2PHNA 3C9RA 3LMEA 2ZF8A 3HTNA 3MBMA 1W59A 3CCUF 2Q1XA 1CLIA 3SIVA 1TVKA 2OTLF 3UT5B 1QU9A 4BT2A 1Z5WA 3I55F 2JNBA 4ZHQB 1W581 3N2KA 2P6YA 1Q81H 3QTYA 3TD4A 4BVRA 1DT9A 3ESJA 1COMA 2IG8A 4C8GA 4ZK7A 1W2BF 1H7MA 3LWRC 3CCRF 4O2AB 1YI2F 5MN4A 3VMFB 5A2QM 1K9MH 3CD6F 4M8IA 3JAKA 5IYZB 3CCEF 4B62A 2ZOVA 4O2BA 2DT4A 3P10A 3G71F 2RHLA 4TV8B 1ODEA 3CXCF 3CCMF 4C81A 2VAMA 3JVHA 2FGYA 5BMVB 1YHQF 2HX0A 1W5EA 4ZOLA 2QI2A 4LNUA 5GIOC 4XCQA 1Z5VA 1XBIA 3ZP4A 2DYYA 5J2UA 1KNKA 3HKCA 2CW4A 4I4TB 3V3TA 2H8EA 5JCOC 1Q86H 4ZI7B 3JALB 4DRXA 2CHTA 3S0HA 2CVLA 3FFMA 3IEWA 5LA6B 5CA0A 2AIFA 3JAWB 3OBYA 3WGNA 1U43A 5EYPA 5JVDB 1W57A 3VYSC 5C8YB 4DXDA 2HRYA 2Z1EA 2Z1UA 3E1YA 5GANK 4O4LA 5EIBC 1K73H 2RHOA 5GAPK 5FNVA 3V4DA 3IKFA 2CWJA 4BT4A 1RA4A 2IAFA 3R0PA 3S06A 4EB6A 5LXTB 2G9IA 3WJRA 4IHJA 5CA1B 4BVTA 4TZZA 3RYFB 2VXYA 3CPWF 1Q7YH 3WGJA 4ZHYB 5JVDA 2ZVZA 3K12A 3WJPA 4O4IB 1T0AA 1GO0A 4G4YA 5EZYB 4O2AA 3MCAB 1JJ2F 5EAZA 2RHJA 2H8CA 3KJKA
chains in the Genus database with same CATH topology
1ZWZA 1GO1A 3N4YA 3CCUF 1KD1H 4EI9A 3CMAF 3SIVA 1QVGF 1M1KH 2OTLF 1T0KB 5HY0A 3I55F 2JNBA 3AGKA 1Q81H 5GINC 2LBWA 2KG4A 4BVRA 1DT9A 1M90H 3CCVF 3LWQC 1H7MA 1W2BF 3LWRC 3CCRF 3WXMB 1YITF 1KC8H 3CCJF 1K8AH 2OTJF 5G4UC 1VQLF 3CC2F 1YJWF 1YI2F 1VQPF 4X3LA 1YJ9F 1KQSF 3VMFB 5A2QM 1W40A 1K9MH 3CD6F 3D00A 3LWOC 3V7QA 1E7KA 3CCEF 1VQMF 5IT9M 3JAMM 1X7PA 3V7EA 3G71F 1W41A 3OBWA 1N8RH 3GYQA 3VI6A 3RA5A 4BVQA 3CC7F 2CZWA 3CCLF 4BW0B 1NMUB 3CXCF 3CCMF 3OW2F 1Q82H 5G4VC 2FGYA 5FJ4C 5HWEA 2VGMA 4BVSA 3I56F 1YHQF 1X52A 1QVFF 1VQ6F 3NVIB 5EO3A 2QA4F 3SIUA 3JCMM 2QI2A 4EI8A 2FC3A 4NUTA 5HXZA 1W3EX 2VGNA 1GZ0A 4XCQA 5HY4A 5GIOC 1XBIA 3J80M 3O85A 3V3TA 1Q86H 5EWRA 1NJIH 3FFMA 2I6DA 2AIFA 3OBYA 3NK6A 4NQ3A 1VQ4F 3NMUC 1VQKF 1CK2A 1RLGA 5HXUA 3LWVC 2QEXF 3J7AR 4EI7A 4X3MA 3E1YA 5GANK 1W42A 1IPAA 1VQ8F 3G4SF 3E20B 3RA6A 3LFOA 1VQOF 1K73H 2F9ZC 2WALA 5GAPK 3NK7A 1S72F 3CCQF 3ON1A 3PAFA 5DCVA 4C4WC 1RA4A 1X7OA 3J81M 5GIPC 1SDSA 1JJ2F 4LCKA 1VQ9F 2KTUA 3CCSF 1YJNF 3CG6A 2OZBA 3IR9A 3CPQA 3LWPC 1CN7A 3NVKE 3CC4F 2HVYD 3N4ZA 3CMEF 1VQ5F 4BVTA 4TZZA 3HAXD 2ALEA 3PLAC 3CPWF 2GLZA 1Q7YH 1VQNF 2BO1A 4BY9D 5HY1A 1GO0A 2KTVA 5HY2A 2LBXA 2OHWA 3MCAB 3G6EF 1VQ7F 5FLXM 1YIJF 1PXWA 3HJWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWZ A;  1GO1 A;  3N4Y A;  3CCU F;  1KD1 H;  3CMA F;  3SIV A;  1QVG F;  1M1K H;  2OTL F;  1T0K B;  3I55 F;  2JNB A;  3AGK A;  1Q81 H;  5GIN C;  2LBW A;  2KG4 A;  1DT9 A;  1M90 H;  3CCV F;  3LWQ C;  1H7M A;  1W2B F;  3LWR C;  3CCR F;  3WXM B;  1YIT F;  1KC8 H;  3CCJ F;  1K8A H;  2OTJ F;  5G4U C;  1VQL F;  3CC2 F;  1YJW F;  1YI2 F;  1VQP F;  4X3L A;  1YJ9 F;  1KQS F;  3VMF B;  1W40 A;  5A2Q M;  1K9M H;  3CD6 F;  3LWO C;  3V7Q A;  1E7K A;  3CCE F;  1VQM F;  5IT9 M;  3JAM M;  1X7P A;  3V7E A;  3G71 F;  1W41 A;  3OBW A;  1N8R H;  3GYQ A;  3VI6 A;  3RA5 A;  3CC7 F;  2CZW A;  3CCL F;  4BW0 B;  1NMU B;  3CXC F;  3CCM F;  3OW2 F;  1Q82 H;  5G4V C;  5FJ4 C;  2VGM A;  3I56 F;  1QVF F;  1YHQ F;  1X52 A;  1VQ6 F;  3NVI B;  5EO3 A;  2QA4 F;  3SIU A;  3JCM M;  2QI2 A;  2FC3 A;  5GIO C;  4NUT A;  1W3E X;  2VGN A;  1GZ0 A;  1XBI A;  3J80 M;  3O85 A;  1Q86 H;  5EWR A;  1NJI H;  3FFM A;  2I6D A;  2AIF A;  3OBY A;  3NK6 A;  1VQ4 F;  3NMU C;  1VQK F;  1CK2 A;  1RLG A;  3LWV C;  2QEX F;  3J7A R;  4X3M A;  3E1Y A;  5GAN K;  1W42 A;  1IPA A;  1VQ8 F;  3G4S F;  3E20 B;  3RA6 A;  3LFO A;  1VQO F;  1K73 H;  2WAL A;  5GAP K;  3NK7 A;  1S72 F;  3CCQ F;  3ON1 A;  3PAF A;  5DCV A;  4C4W C;  1RA4 A;  1X7O A;  3J81 M;  5GIP C;  1SDS A;  1JJ2 F;  4LCK A;  1VQ9 F;  2KTU A;  3CCS F;  1YJN F;  3CG6 A;  2OZB A;  3IR9 A;  3CPQ A;  3LWP C;  1CN7 A;  3NVK E;  3CC4 F;  2HVY D;  3N4Z A;  3CME F;  1VQ5 F;  4TZZ A;  3HAX D;  3PLA C;  2ALE A;  3CPW F;  1Q7Y H;  1VQN F;  2BO1 A;  4BY9 D;  1GO0 A;  2KTV A;  2LBX A;  2OHW A;  3MCA B;  3G6E F;  1VQ7 F;  5FLX M;  1YIJ F;  1PXW A;  3HJW C; 
#chains in the Genus database with same CATH topology
 1XV2 A;  4U3J A;  1KNJ A;  1ZWZ A;  3N4Y A;  2GVI A;  3KE1 A;  3C8L A;  3KHN A;  4YJ3 A;  2H6L A;  3WPW A;  4WBN B;  1QVG F;  3DDN A;  2OTM A;  5KX5 A;  5GIN C;  3CYP B;  2LBW A;  4BT6 A;  3CCV F;  1IV3 A;  4O4J A;  5JH7 A;  3VIU A;  3WXM B;  5LYJ B;  1YIT F;  3CC2 F;  1VQP F;  4TV9 B;  4X3L A;  1KQS F;  1W40 A;  1U40 A;  3MCQ A;  3V7Q A;  3S0W A;  3FPI A;  3MDO A;  1X7P A;  1RQ2 A;  1X25 A;  1FNK A;  5AVM A;  1N8R H;  3GYQ A;  2RHH A;  2UYN A;  3LDT A;  2V9Y A;  5GON A;  5G4V C;  4O4L B;  3WPX A;  5FJ4 C;  4BVS A;  1QVF F;  1X52 A;  3I3F A;  4KWE A;  2QA4 F;  3K14 A;  1XRG A;  4RHA A;  3RE3 A;  5HXZ A;  1W3E X;  3JAW A;  5HY4 A;  3RYH A;  5MN5 A;  4ZHV A;  3RYF A;  2YYE A;  4O2B B;  4FFB B;  2LCA A;  4WBN A;  5EIB D;  2W8B C;  4EB6 B;  3HWU A;  2YXZ A;  5IJ0 A;  3ERN A;  1VQK F;  4U3J B;  1RLG A;  3LWV C;  3IMP A;  3J7A R;  4EI7 A;  1QD9 A;  4B46 A;  3S0Y A;  2BTO A;  1W42 A;  1IPA A;  1W55 A;  3D01 A;  4B45 A;  3E20 B;  3WGK A;  4IIJ A;  3RA6 A;  3P4E A;  1S72 F;  4F6R B;  1TUB B;  3F0F A;  3PAF A;  4PWT A;  4G4Z A;  3J81 M;  4IHJ B;  5GIP C;  1SDS A;  4O4I A;  4LCK A;  3IEQ A;  4X1Y B;  3LYB A;  4I55 B;  4X1I A;  3MQW A;  3VOA A;  5CB4 A;  2OZB A;  3IR9 A;  3CPQ A;  2HVY D;  5JQG A;  2HS3 A;  3HAX D;  4F6R A;  5J2U B;  1DBF A;  2GLZ A;  3E22 A;  2BO1 A;  3FD5 A;  4BY9 D;  3UT5 A;  1VQV A;  4G4W A;  2KTV A;  5HY2 A;  1TVK B;  2LBX A;  2OHW A;  3M1X A;  1SA0 B;  4ZOL B;  3OON A;  1VQ7 F;  1YIJ F;  1PXW A;  2BTQ B;  2NMU A;  5JQG B;  2UYP A;  3HJW C;  5GON B;  1GO1 A;  5EYP B;  3M4S A;  3S03 A;  4R40 B;  3CMA F;  1M1K H;  1T0K B;  3F6M A;  1R1M A;  4O4J B;  5LYJ A;  5JH7 B;  3AGK A;  4ZHW A;  2KG4 A;  1ONI A;  1IV2 A;  4G88 A;  3LWQ C;  3HKC B;  5G4U C;  2OTJ F;  5J2T A;  3CCJ F;  1VQL F;  3ZO8 A;  1VH8 A;  1YJ9 F;  3N2G B;  3CB2 A;  5EB0 A;  1FNJ A;  3GHZ A;  2UYK A;  3HKB B;  3JAM M;  3K2X A;  1W5B A;  1FSZ A;  2IQQ A;  4BT7 A;  3OBW A;  3HKD A;  1JFF A;  2VAW A;  3VTI C;  3RA5 A;  4BVQ A;  3CC7 F;  2CZW A;  1NMU B;  4LNU B;  2KGW A;  3WGL A;  2UYN B;  1Q82 H;  1VK3 A;  2ZAU A;  5HWE A;  2VGM A;  4TUY A;  3ELC A;  3VO8 A;  3S02 A;  1VQ6 F;  4G4V A;  4HNA A;  5EO3 A;  5BMV A;  5C8Y A;  2CSL A;  3SIU A;  3M84 A;  3FD6 A;  1PF5 A;  3F0E A;  4EI8 A;  4I55 A;  4X1I B;  2PMP A;  2QTP A;  2ZOD A;  3JAR B;  5B8F A;  3O85 A;  2R6R 1;  3JAL A;  3JAS A;  2HS4 A;  3EOR A;  4TUY B;  5FNV B;  5EWR A;  1RQ7 A;  1NJI H;  3RYI B;  5ITZ A;  5MN6 A;  3JAK B;  3L7Q A;  3NK6 A;  1GX1 A;  3QUW A;  3ZOP A;  1UFY A;  2QEX F;  1SZQ A;  3HKB A;  4X3M A;  4O4H B;  2BTU A;  1JY8 A;  3Q8H A;  1VQ8 F;  3G4S F;  1XHO A;  1U3L A;  1VQO F;  3LFO A;  3JAT A;  2WAL A;  3NK7 A;  3GTZ A;  5DCV A;  4BT5 A;  1FFX A;  2L26 A;  5HP8 A;  2AIZ P;  1X7O A;  5CA0 B;  1OAP A;  3K0T A;  5LOV A;  2HQS C;  2KTU A;  3CCS F;  2Q1Y A;  3F0G A;  4ZI7 A;  4C8E A;  3NVK E;  3CC4 F;  1JFF B;  4YJ2 B;  3N4Z A;  1VQ5 F;  3PLA C;  2ALE A;  5LP6 B;  4YJ2 A;  5EZY A;  3FBA A;  2AMT A;  4X20 B;  5HY1 A;  3E22 B;  3N2G A;  1W5F A;  3G6E F;  4G4X A;  5FLX M;  5CA1 A;  4X1K A;  2UZH A;  5LP6 C;  3JAT B;  2N48 A;  5LXT A;  1KD1 H;  2Z1T A;  3C9U A;  4EI9 A;  5IJ9 B;  5HY0 A;  3VYT C;  4DRX B;  2ZVY A;  3RYC A;  1VHA A;  1M90 H;  5KX5 B;  4ZHQ A;  1KC8 H;  1K8A H;  1H48 A;  1SA0 A;  1YJW F;  2HP3 A;  4ERH A;  5KMG B;  3D00 A;  3RYI A;  5ITZ B;  3LWO C;  1E7K A;  1VQM F;  5IT9 M;  4B5C A;  3V7E A;  3RYC B;  2VAP A;  1W41 A;  3BYQ A;  4I50 A;  3VI6 A;  1QAH A;  5HP7 A;  2GZL A;  2RB9 A;  3CCL F;  3C9S A;  4BW0 B;  2HP0 A;  4X1Y A;  3OW2 F;  3WGM A;  3I56 F;  1FFX B;  1UI9 A;  3VYU C;  2HS0 A;  3NVI B;  5JCO A;  4C8I A;  3JCM M;  4RQO A;  3IKE A;  3KJJ A;  2FC3 A;  2HP0 B;  4NUT A;  2VGN A;  4BT3 A;  1GZ0 A;  5KMG A;  3J80 M;  3C9T A;  1YQN A;  3HKE B;  3I7T A;  3VOB A;  3N2K B;  2UYJ A;  5LOV B;  2I6D A;  1J7H A;  4NWO B;  1Q8R A;  2CHS A;  4NQ3 A;  1VQ4 F;  3NMU C;  1IV1 A;  1CK2 A;  5HXU A;  2B33 A;  3F0D A;  4FFB A;  4HNA B;  3JAS B;  3DC2 A;  5IYZ A;  3QHD A;  5IJ9 A;  1W5A A;  4U39 A;  4TV9 A;  1NQ3 A;  3B6N A;  3P0Z A;  3RYH B;  3VCZ A;  4C82 A;  2Z1F A;  4O4H A;  5LA6 A;  4X20 A;  2EWC A;  2LBT A;  3TD3 A;  5CB4 B;  3CYQ A;  1JN1 A;  2F9Z C;  4I4T A;  3CCQ F;  4X1K B;  3ON1 A;  5EB1 B;  3KIZ A;  4C4W C;  3U0O A;  2K1S A;  1IV4 A;  1JD1 A;  4YJ3 B;  2R75 1;  2Z01 A;  4IIJ B;  1VQ9 F;  1YJN F;  3TD5 A;  3CG6 A;  3LWP C;  1CN7 A;  3HKE A;  5J2T B;  3HKD B;  1YGY A;  5LP6 A;  3CME F;  3JAR A;  3T80 A;  3ZP7 A;  2MQE A;  5IJ0 B;  1VQN F;  1U3P A;  2HRU A;  1RLU A;  2I6R A;  1H47 A;  4TV8 A;  3WJQ A;  4E6E A;  3D54 A;  1OFU A;  4I50 B;  1TUB A;  2PHN A;  3C9R A;  3LME A;  2ZF8 A;  3HTN A;  3MBM A;  1W59 A;  3CCU F;  2Q1X A;  1CLI A;  3SIV A;  1TVK A;  2OTL F;  3UT5 B;  1QU9 A;  4BT2 A;  1Z5W A;  3I55 F;  2JNB A;  4ZHQ B;  1W58 1;  3N2K A;  2P6Y A;  1Q81 H;  3QTY A;  3TD4 A;  4BVR A;  1DT9 A;  3ESJ A;  1COM A;  2IG8 A;  4C8G A;  4ZK7 A;  1W2B F;  1H7M A;  3LWR C;  3CCR F;  4O2A B;  1YI2 F;  5MN4 A;  3VMF B;  5A2Q M;  1K9M H;  3CD6 F;  4M8I A;  3JAK A;  5IYZ B;  3CCE F;  4B62 A;  2ZOV A;  4O2B A;  2DT4 A;  3P10 A;  3G71 F;  2RHL A;  4TV8 B;  1ODE A;  3CXC F;  3CCM F;  4C81 A;  2VAM A;  3JVH A;  2FGY A;  5BMV B;  1YHQ F;  2HX0 A;  1W5E A;  4ZOL A;  2QI2 A;  4LNU A;  5GIO C;  4XCQ A;  1Z5V A;  1XBI A;  3ZP4 A;  2DYY A;  5J2U A;  1KNK A;  3HKC A;  2CW4 A;  4I4T B;  3V3T A;  2H8E A;  5JCO C;  1Q86 H;  4ZI7 B;  3JAL B;  4DRX A;  2CHT A;  3S0H A;  2CVL A;  3FFM A;  3IEW A;  5LA6 B;  5CA0 A;  2AIF A;  3JAW B;  3OBY A;  3WGN A;  1U43 A;  5EYP A;  5JVD B;  1W57 A;  3VYS C;  5C8Y B;  4DXD A;  2HRY A;  2Z1E A;  2Z1U A;  3E1Y A;  5GAN K;  4O4L A;  5EIB C;  1K73 H;  2RHO A;  5GAP K;  5FNV A;  3V4D A;  3IKF A;  2CWJ A;  4BT4 A;  1RA4 A;  2IAF A;  3R0P A;  3S06 A;  4EB6 A;  5LXT B;  2G9I A;  3WJR A;  4IHJ A;  5CA1 B;  4BVT A;  4TZZ A;  3RYF B;  2VXY A;  3CPW F;  1Q7Y H;  3WGJ A;  4ZHY B;  5JVD A;  2ZVZ A;  3K12 A;  3WJP A;  4O4I B;  1T0A A;  1GO0 A;  4G4Y A;  5EZY B;  4O2A A;  3MCA B;  1JJ2 F;  5EAZ A;  2RHJ A;  2H8C A;  3KJK A; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  1GO1 A;  3N4Y A;  3CCU F;  1KD1 H;  4EI9 A;  3CMA F;  3SIV A;  1QVG F;  1M1K H;  2OTL F;  1T0K B;  5HY0 A;  3I55 F;  2JNB A;  3AGK A;  1Q81 H;  5GIN C;  2LBW A;  2KG4 A;  4BVR A;  1DT9 A;  1M90 H;  3CCV F;  3LWQ C;  1H7M A;  1W2B F;  3LWR C;  3CCR F;  3WXM B;  1YIT F;  1KC8 H;  3CCJ F;  1K8A H;  2OTJ F;  5G4U C;  1VQL F;  3CC2 F;  1YJW F;  1YI2 F;  1VQP F;  4X3L A;  1YJ9 F;  1KQS F;  3VMF B;  5A2Q M;  1W40 A;  1K9M H;  3CD6 F;  3D00 A;  3LWO C;  3V7Q A;  1E7K A;  3CCE F;  1VQM F;  5IT9 M;  3JAM M;  1X7P A;  3V7E A;  3G71 F;  1W41 A;  3OBW A;  1N8R H;  3GYQ A;  3VI6 A;  3RA5 A;  4BVQ A;  3CC7 F;  2CZW A;  3CCL F;  4BW0 B;  1NMU B;  3CXC F;  3CCM F;  3OW2 F;  1Q82 H;  5G4V C;  2FGY A;  5FJ4 C;  5HWE A;  2VGM A;  4BVS A;  3I56 F;  1YHQ F;  1X52 A;  1QVF F;  1VQ6 F;  3NVI B;  5EO3 A;  2QA4 F;  3SIU A;  3JCM M;  2QI2 A;  4EI8 A;  2FC3 A;  4NUT A;  5HXZ A;  1W3E X;  2VGN A;  1GZ0 A;  4XCQ A;  5HY4 A;  5GIO C;  1XBI A;  3J80 M;  3O85 A;  3V3T A;  1Q86 H;  5EWR A;  1NJI H;  3FFM A;  2I6D A;  2AIF A;  3OBY A;  3NK6 A;  4NQ3 A;  1VQ4 F;  3NMU C;  1VQK F;  1CK2 A;  1RLG A;  5HXU A;  3LWV C;  2QEX F;  3J7A R;  4EI7 A;  4X3M A;  3E1Y A;  5GAN K;  1W42 A;  1IPA A;  1VQ8 F;  3G4S F;  3E20 B;  3RA6 A;  3LFO A;  1VQO F;  1K73 H;  2F9Z C;  2WAL A;  5GAP K;  3NK7 A;  1S72 F;  3CCQ F;  3ON1 A;  3PAF A;  5DCV A;  4C4W C;  1RA4 A;  1X7O A;  3J81 M;  5GIP C;  1SDS A;  1JJ2 F;  4LCK A;  1VQ9 F;  2KTU A;  3CCS F;  1YJN F;  3CG6 A;  2OZB A;  3IR9 A;  3CPQ A;  3LWP C;  1CN7 A;  3NVK E;  3CC4 F;  2HVY D;  3N4Z A;  3CME F;  1VQ5 F;  4BVT A;  4TZZ A;  3HAX D;  2ALE A;  3PLA C;  3CPW F;  2GLZ A;  1Q7Y H;  1VQN F;  2BO1 A;  4BY9 D;  5HY1 A;  1GO0 A;  2KTV A;  5HY2 A;  2LBX A;  2OHW A;  3MCA B;  3G6E F;  1VQ7 F;  5FLX M;  1YIJ F;  1PXW A;  3HJW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...