2QEXF

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qexF00
5G4VC 3CCEF 2CZWA 1VQPF 5FLXM 1VQKF 3G4SF 1YJ9F 3JAMM 3G71F 1K73H 5IT9M 3GYQA 2AIFA 4BW0B 1YJWF 1VQ4F 1M1KH 1Q81H 1YIJF 1M90H 3MCAB 2BO1A 3J81M 3CCQF 3OBYA 1VQ6F 3NK6A 3V7QA 1KC8H 2KTVA 1CN7A 5GINC 1Q86H 1VQ5F 3HAXD 2OZBA 3NVKE 3CPQA 4C4WC 3CC2F 2LBXA 3LWPC 3CMEF 3LWQC 3LFOA 2HVYD 1KD1H 4NUTA 3LWOC 1YITF 3PAFA 2KTUA 1VQ9F 2QA4F 1YJNF 3I55F 3CCLF 5FJ4C 2VGMA 3RA5A 5GANK 1Q82H 3CD6F 1VQ7F 2JNBA 1VQ8F 3HJWC 1KQSF 3O85A 1K9MH 3CCRF 1ZWZA 1VQLF 4X3LA 3LWVC 1W41A 3RA6A 5DCVA 3CMAF 1VQMF 2FC3A 3CCJF 3E20B 1S72F 3WXMB 2VGNA 5EWRA 1VQOF 1W42A 1K8AH 3NVIB 3CG6A 4LCKA 1DT9A 3CPWF 3AGKA 5GIPC 1T0KB 3OBWA 3CC4F 1GO1A 3I56F 1PXWA 1X7OA 2I6DA 1QVGF 3G6EF 3OW2F 1YI2F 1NJIH 1GZ0A 2LBWA 3CCSF 2KG4A 1GO0A 3N4ZA 1W40A 4BY9D 2OTLF 1VQNF 1RLGA 1IPAA 3VI6A 2QEXF 3JCMM 3IR9A 1E7KA 1H7MA 5EO3A 3NMUC 5A2QM 5G4UC 2WALA 1X7PA 3NK7A 3VMFB 3FFMA 3CCVF 3J7AR 3PLAC 3CCMF 2OHWA 4TZZA 1JJ2F 4X3MA 3CCUF 2ALEA 1Q7YH 3ON1A 3SIUA 1XBIA 3CC7F 1QVFF 3N4YA 3J80M 1RA4A 3CXCF 1N8RH 3LWRC 1W2BF 3SIVA 2QI2A 5GIOC 1X52A 5GAPK 1YHQF 2OTJF 3E1YA 1SDSA 1NMUB 1CK2A 1W3EX 3V7EA
chains in the Genus database with same CATH superfamily
1KNKA 5FLXM 4O4IA 3M4SA 2ZVZA 4LNUA 1K73H 3HKBB 4M8IA 3N2GA 2AIFA 3QTYA 3F6MA 5J2UB 4BW0B 1M1KH 3UT5B 2BTOA 4O2AB 5LOVA 3P10A 2GZLA 1FNJA 4YJ3B 3P4EA 3NK6A 3V7QA 3JALA 2EWCA 3HAXD 4HNAB 4RHAA 2VAPA 5HP7A 2HX0A 3LWPC 3K14A 2N48A 2CSLA 3LFOA 3UT5A 3MQWA 3LWQC 3LWOC 2R6R1 4TUYA 2ZVYA 3C8LA 3QUWA 5KMGB 3VCZA 4YJ3A 1VK3A 3I55F 2VGMA 3RA5A 3VOBA 2Z1EA 3LDTA 1IV2A 4IHJA 1VQ8F 3O85A 3S0WA 2ZODA 5JVDA 5ITZB 1VQLF 5DCVA 1ODEA 1W41A 3ZP7A 2FC3A 2RB9A 1KNJA 3WGNA 3E20B 4I50A 5KMGA 3HKDA 4KWEA 5CA1A 1S72F 3IEQA 2VGNA 1H48A 5JCOC 1TVKB 1RLUA 1U40A 1PF5A 2PHNA 3KHNA 5HXUA 2VAWA 5JVDB 5ITZA 4TV9A 3CG6A 4LCKA 1QD9A 4O4JA 1IV3A 1DT9A 3HWUA 4FFBB 4I50B 2LBTA 3CC4F 1T0KB 3I56F 3FPIA 3ESJA 1W59A 1TVKA 1GZ0A 2CWJA 3BYQA 2V9YA 4NWOB 3F0FA 2VXYA 5AVMA 3WJPA 2HP0B 4BY9D 3HKCA 4IIJA 4C8GA 3NMUC 2UZHA 5G4UC 4FFBA 3CYQA 2IQQA 3FFMA 3S0YA 5HY1A 1W5EA 3CCMF 3J7AR 3PLAC 3M1XA 2ZOVA 4X3MA 3CCUF 3ON1A 1XHOA 2HP0A 3S02A 3HKCB 1FFXA 1JN1A 3B6NA 1XRGA 4B5CA 4G4YA 1RA4A 3ZOPA 1W2BF 3SIVA 2HS0A 1T0AA 5GIOC 1X52A 1RQ7A 4BT2A 3HKEB 2MQEA 3E1YA 5BMVB 4I55B 1CK2A 4O4LB 5HXZA 5HY4A 4B46A 2CZWA 1W57A 3G4SF 4TUYB 4BT7A 3JAMM 3G71F 5IT9M 3GYQA 3HKEA 1W5BA 3VYTC 5BMVA 1YJWF 4I55A 3FD6A 3E22B 3HTNA 3RYCA 4O4LA 2BO1A 4O4HB 4ZHWA 1KC8H 4XCQA 1VQVA 3ELCA 4DRXB 1TUBB 2OZBA 3CPQA 3CC2F 2LBXA 3CMEF 3RYCB 1YITF 2KTUA 3ERNA 2CW4A 1R1MA 1U3PA 3JAWA 2QA4F 1OFUA 3QHDA 3U0OA 2P6YA 3WPXA 4DRXA 3K12A 3CD6F 3RYHB 1SZQA 4B45A 1KQSF 4C8EA 4X3LA 3RA6A 4ERHA 3KJKA 4PWTA 4X1IA 5EWRA 4C81A 1W42A 4X20B 2F9ZC 1NQ3A 3CPWF 1FFXB 3OBWA 3S06A 1GO1A 2VAMA 3C9RA 1X7OA 1W581 4X1IB 4B62A 5IJ0A 5JH7A 1NJIH 2FGYA 3WJQA 3WGKA 1GX1A 2Z01A 4X20A 1IPAA 1H7MA 2ZF8A 3IMPA 1YQNA 4G88A 3D00A 4ZHYB 1X7PA 1FSZA 2YYEA 3JASA 2GVIA 3F0DA 5IJ0B 3CCVF 3WGJA 3RE3A 4TZZA 1JJ2F 1OAPA 2ALEA 1CLIA 4I4TB 3MBMA 4EB6A 3SIUA 3CC7F 2QTPA 2HQSC 2BTQB 2UYNB 3J80M 3P0ZA 3E22A 3JASB 2R751 3K0TA 4O4HA 1IV1A 3M84A 4ZHVA 5FNVB 4I4TA 4EB6B 3TD4A 2AMTA 5LYJA 1TUBA 3JARA 2Q1XA 1W3EX 5G4VC 1VQPF 5CB4A 3VYSC 1YJ9F 3JAWB 3RYIA 1RQ2A 4BT3A 3WGLA 4WBNA 1YGYA 5FNVA 1VQ4F 4E6EA 5LP6A 1Q81H 1YIJF 3JARB 3RYHA 2YXZA 3I7TA 1M90H 3MCAB 3IKEA 1VHAA 3JATA 3N2KA 5HY2A 3MDOA 4R40B 3CCQF 5CB4B 2IAFA 2KTVA 1CN7A 5EIBD 3WPWA 1VQ5F 4EI8A 1JY8A 3GHZA 4WBNB 4U39A 3FBAA 2RHJA 3FD5A 4NUTA 3D01A 2IG8A 1VQ9F 3JATB 2UYJA 3ZP4A 2PMPA 3RYFB 3CCLF 5FJ4C 5JCOA 5CA0B 2AIZP 1COMA 4ZOLA 1VQ7F 5JH7B 2Z1TA 1SA0B 4BT4A 1K9MH 2H8CA 3MCQA 1UFYA 4BVTA 3CMAF 3T80A 3TD3A 1VQMF 2NMUA 2HP3A 3Q8HA 4TV8B 5EIBC 5JQGA 1JD1A 4EI9A 1K8AH 1SA0A 5IJ9A 2HRUA 1UI9A 4DXDA 2DT4A 3F0GA 2I6DA 2UYNA 3G6EF 5LA6B 2Z1FA 2LBWA 3LYBA 3CCSF 1Q8RA 3VYUC 3N4ZA 3L7QA 2HS3A 2LCAA 3R0PA 2QEXF 3JCMM 1FNKA 3IR9A 4F6RA 1Z5WA 5LYJB 2WALA 3NK7A 2HS4A 3VOAA 3VO8A 1DBFA 5LA6A 3KJJA 2OHWA 2UYKA 3RYIB 1XBIA 3LMEA 5J2TA 1QVFF 3CYPB 5HWEA 4O2BA 1W5FA 3CXCF 2RHOA 5LP6B 3C9SA 2OTMA 3N2KB 2QI2A 5GAPK 3ZO8A 3GTZA 5EAZA 4C8IA 2Z1UA 2Q1YA 1NMUB 5IYZB 4BVQA 5B8FA 3V7EA 3CCEF 1VQKF 3WGMA 4X1KA 3K2XA 5GONB 5EB1B 1U3LA 4G4VA 3C9UA 3RYFA 5MN4A 1H47A 4NQ3A 3I3FA 5CA0A 4ZI7A 4ZOLB 4BVSA 5C8YA 3J81M 4BVRA 1J7HA 3OBYA 1VQ6F 1XV2A 2RHLA 4X1YB 5GONA 3IKFA 2KGWA 5HY0A 5GINC 2RHHA 1Q86H 3NVKE 2CVLA 1Z5VA 3C9TA 3KE1A 4C4WC 4TV8A 2HVYD 5JQGB 4O4IB 1KD1H 3PAFA 4LNUB 1JFFB 2H6LA 3HKBA 4G4WA 4G4XA 5C8YB 5IJ9B 4RQOA 3N2GB 1YJNF 3S03A 3VIUA 5GANK 4YJ2A 2CHSA 1Q82H 3OONA 4O2AA 1W5AA 2JNBA 2UYPA 3HJWC 3CCRF 1ZWZA 3LWVC 2K1SA 3DDNA 2HRYA 3DC2A 1JFFA 4EI7A 3JALB 3CCJF 3EORA 5EB0A 4HNAA 3WXMB 4F6RB 2W8BC 2L26A 4YJ2B 4U3JA 5EYPB 2I6RA 1VQOF 3NVIB 4BT5A 3JAKA 3CB2A 5LXTA 1ONIA 3F0EA 3AGKA 5J2TB 5GIPC 5KX5A 1PXWA 1QVGF 4IHJB 4O2BB 3OW2F 1YI2F 5EZYA 2ZAUA 4U3JB 1U43A 2KG4A 2G9IA 5EYPA 1IV4A 3V4DA 1GO0A 1W40A 1VQNF 2OTLF 5HP8A 4ZHQB 3V3TA 1RLGA 2H8EA 3HKDB 3VI6A 3JAKB 5CA1B 1E7KA 5EO3A 5LXTB 5A2QM 5IYZA 2CHTA 5KX5B 3VMFB 2B33A 3WJRA 4X1KB 4TV9B 4ZK7A 5EZYB 3D54A 1QAHA 1Q7YH 4O4JB 1VH8A 5LP6C 4ZHQA 4BT6A 3TD5A 4G4ZA 3N4YA 3VTIC 5MN6A 3KIZA 4ZI7B 1N8RH 3IEWA 1X25A 3LWRC 1QU9A 3JVHA 2GLZA 1YHQF 4IIJB 5MN5A 2OTJF 4X1YA 3S0HA 5J2UA 1SDSA 2BTUA 4C82A 2DYYA 5LOVB 1W55A
chains in the Genus database with same CATH topology
5G4VC 3CCEF 2CZWA 1VQPF 5FLXM 1VQKF 3G4SF 1YJ9F 3JAMM 3G71F 1K73H 5IT9M 3GYQA 2AIFA 4BW0B 1YJWF 1VQ4F 1M1KH 4NQ3A 1Q81H 1YIJF 1M90H 4BVSA 3MCAB 2BO1A 3J81M 5HY2A 3CCQF 4BVRA 3OBYA 1VQ6F 3NK6A 3V7QA 1KC8H 2KTVA 1CN7A 5HY0A 5GINC 1Q86H 4XCQA 1VQ5F 2OZBA 3HAXD 3NVKE 4EI8A 3CPQA 4C4WC 3CC2F 2LBXA 3LWPC 3CMEF 3LWQC 3LFOA 2HVYD 1KD1H 4NUTA 3LWOC 1YITF 3PAFA 2KTUA 1VQ9F 2QA4F 1YJNF 3I55F 3CCLF 5FJ4C 2VGMA 3RA5A 5GANK 1Q82H 3CD6F 1VQ7F 2JNBA 1VQ8F 3HJWC 1KQSF 3O85A 1K9MH 3CCRF 4BVTA 1ZWZA 1VQLF 4X3LA 3RA6A 1W41A 3LWVC 5DCVA 3CMAF 1VQMF 2FC3A 4EI7A 3CCJF 3E20B 1S72F 3WXMB 2VGNA 5EWRA 4EI9A 1VQOF 1W42A 1K8AH 3NVIB 5HXUA 2F9ZC 3CG6A 4LCKA 1DT9A 3CPWF 3AGKA 5GIPC 1T0KB 3OBWA 3CC4F 1GO1A 3I56F 1PXWA 1X7OA 2I6DA 1QVGF 3G6EF 3OW2F 1YI2F 1NJIH 1GZ0A 2LBWA 2FGYA 3CCSF 2KG4A 1GO0A 3N4ZA 1W40A 4BY9D 2OTLF 1VQNF 3V3TA 1RLGA 1IPAA 3VI6A 2QEXF 3JCMM 3IR9A 1E7KA 1H7MA 5EO3A 3NMUC 5A2QM 5G4UC 3D00A 2WALA 1X7PA 3NK7A 3VMFB 3FFMA 3CCVF 5HY1A 3J7AR 3CCMF 3PLAC 2OHWA 4TZZA 1JJ2F 4X3MA 3CCUF 2ALEA 1Q7YH 3ON1A 3SIUA 1XBIA 3CC7F 1QVFF 5HWEA 3N4YA 3J80M 1RA4A 3CXCF 1N8RH 3LWRC 1W2BF 2GLZA 3SIVA 2QI2A 5GIOC 1X52A 5GAPK 1YHQF 2OTJF 3E1YA 1SDSA 1NMUB 4BVQA 1CK2A 1W3EX 5HXZA 3V7EA 5HY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4V C;  3CCE F;  2CZW A;  1VQP F;  5FLX M;  1VQK F;  3G4S F;  1YJ9 F;  3JAM M;  3G71 F;  1K73 H;  5IT9 M;  3GYQ A;  2AIF A;  4BW0 B;  1YJW F;  1VQ4 F;  1M1K H;  1Q81 H;  1YIJ F;  1M90 H;  3MCA B;  2BO1 A;  3J81 M;  3CCQ F;  3OBY A;  1VQ6 F;  3NK6 A;  3V7Q A;  1KC8 H;  2KTV A;  1CN7 A;  5GIN C;  1Q86 H;  1VQ5 F;  3HAX D;  2OZB A;  3NVK E;  3CPQ A;  4C4W C;  3CC2 F;  2LBX A;  3LWP C;  3CME F;  3LWQ C;  3LFO A;  2HVY D;  1KD1 H;  4NUT A;  3LWO C;  1YIT F;  3PAF A;  2KTU A;  1VQ9 F;  2QA4 F;  1YJN F;  3I55 F;  3CCL F;  5FJ4 C;  2VGM A;  3RA5 A;  5GAN K;  1Q82 H;  3CD6 F;  1VQ7 F;  2JNB A;  1VQ8 F;  3HJW C;  1KQS F;  3O85 A;  1K9M H;  3CCR F;  1ZWZ A;  1VQL F;  4X3L A;  3LWV C;  1W41 A;  3RA6 A;  5DCV A;  3CMA F;  1VQM F;  2FC3 A;  3CCJ F;  3E20 B;  1S72 F;  3WXM B;  2VGN A;  5EWR A;  1VQO F;  1W42 A;  1K8A H;  3NVI B;  3CG6 A;  4LCK A;  1DT9 A;  3CPW F;  3AGK A;  5GIP C;  1T0K B;  3OBW A;  3CC4 F;  1GO1 A;  3I56 F;  1PXW A;  1X7O A;  2I6D A;  1QVG F;  3G6E F;  3OW2 F;  1YI2 F;  1NJI H;  1GZ0 A;  2LBW A;  3CCS F;  2KG4 A;  1GO0 A;  3N4Z A;  1W40 A;  4BY9 D;  2OTL F;  1VQN F;  1RLG A;  1IPA A;  3VI6 A;  2QEX F;  3JCM M;  3IR9 A;  1E7K A;  1H7M A;  5EO3 A;  3NMU C;  5A2Q M;  5G4U C;  2WAL A;  1X7P A;  3NK7 A;  3VMF B;  3FFM A;  3CCV F;  3J7A R;  3PLA C;  3CCM F;  2OHW A;  4TZZ A;  1JJ2 F;  4X3M A;  3CCU F;  2ALE A;  1Q7Y H;  3ON1 A;  3SIU A;  1XBI A;  3CC7 F;  1QVF F;  3N4Y A;  3J80 M;  1RA4 A;  3CXC F;  1N8R H;  3LWR C;  1W2B F;  3SIV A;  2QI2 A;  5GIO C;  1X52 A;  5GAP K;  1YHQ F;  2OTJ F;  3E1Y A;  1SDS A;  1NMU B;  1CK2 A;  1W3E X;  3V7E A; 
#chains in the Genus database with same CATH topology
 1KNK A;  5FLX M;  4O4I A;  3M4S A;  2ZVZ A;  4LNU A;  1K73 H;  3HKB B;  4M8I A;  3N2G A;  2AIF A;  3QTY A;  3F6M A;  5J2U B;  4BW0 B;  1M1K H;  3UT5 B;  2BTO A;  4O2A B;  5LOV A;  3P10 A;  2GZL A;  1FNJ A;  4YJ3 B;  3P4E A;  3NK6 A;  3V7Q A;  3JAL A;  2EWC A;  3HAX D;  4HNA B;  4RHA A;  2VAP A;  5HP7 A;  2HX0 A;  3LWP C;  3K14 A;  2N48 A;  2CSL A;  3LFO A;  3UT5 A;  3MQW A;  3LWQ C;  3LWO C;  2R6R 1;  4TUY A;  2ZVY A;  3C8L A;  3QUW A;  5KMG B;  3VCZ A;  4YJ3 A;  1VK3 A;  3I55 F;  2VGM A;  3RA5 A;  3VOB A;  2Z1E A;  3LDT A;  1IV2 A;  4IHJ A;  1VQ8 F;  3O85 A;  3S0W A;  2ZOD A;  5JVD A;  5ITZ B;  1VQL F;  5DCV A;  1ODE A;  1W41 A;  3ZP7 A;  2FC3 A;  2RB9 A;  1KNJ A;  3WGN A;  3E20 B;  4I50 A;  5KMG A;  3HKD A;  4KWE A;  5CA1 A;  1S72 F;  3IEQ A;  2VGN A;  1H48 A;  5JCO C;  1TVK B;  1RLU A;  1U40 A;  1PF5 A;  2PHN A;  3KHN A;  5HXU A;  2VAW A;  5JVD B;  5ITZ A;  4TV9 A;  3CG6 A;  4LCK A;  1QD9 A;  4O4J A;  1IV3 A;  1DT9 A;  3HWU A;  4FFB B;  4I50 B;  2LBT A;  3CC4 F;  1T0K B;  3I56 F;  3FPI A;  3ESJ A;  1W59 A;  1TVK A;  1GZ0 A;  2CWJ A;  3BYQ A;  2V9Y A;  4NWO B;  3F0F A;  2VXY A;  5AVM A;  3WJP A;  2HP0 B;  4BY9 D;  3HKC A;  4IIJ A;  4C8G A;  3NMU C;  2UZH A;  5G4U C;  4FFB A;  3CYQ A;  2IQQ A;  3FFM A;  3S0Y A;  5HY1 A;  1W5E A;  3CCM F;  3J7A R;  3PLA C;  3M1X A;  2ZOV A;  4X3M A;  3CCU F;  3ON1 A;  1XHO A;  2HP0 A;  3S02 A;  3HKC B;  1FFX A;  1JN1 A;  3B6N A;  1XRG A;  4B5C A;  4G4Y A;  1RA4 A;  3ZOP A;  1W2B F;  3SIV A;  2HS0 A;  1T0A A;  5GIO C;  1X52 A;  1RQ7 A;  4BT2 A;  3HKE B;  2MQE A;  3E1Y A;  5BMV B;  4I55 B;  1CK2 A;  4O4L B;  5HXZ A;  5HY4 A;  4B46 A;  2CZW A;  1W57 A;  3G4S F;  4TUY B;  4BT7 A;  3JAM M;  3G71 F;  5IT9 M;  3GYQ A;  3HKE A;  1W5B A;  3VYT C;  5BMV A;  1YJW F;  4I55 A;  3FD6 A;  3E22 B;  3HTN A;  3RYC A;  4O4L A;  2BO1 A;  4O4H B;  4ZHW A;  1KC8 H;  4XCQ A;  1VQV A;  3ELC A;  4DRX B;  1TUB B;  2OZB A;  3CPQ A;  3CC2 F;  2LBX A;  3CME F;  3RYC B;  1YIT F;  2KTU A;  3ERN A;  2CW4 A;  1R1M A;  1U3P A;  3JAW A;  2QA4 F;  1OFU A;  3QHD A;  3U0O A;  2P6Y A;  3WPX A;  4DRX A;  3K12 A;  3CD6 F;  3RYH B;  1SZQ A;  4B45 A;  1KQS F;  4C8E A;  4X3L A;  3RA6 A;  4ERH A;  3KJK A;  4PWT A;  4X1I A;  5EWR A;  4C81 A;  1W42 A;  4X20 B;  2F9Z C;  1NQ3 A;  3CPW F;  1FFX B;  3OBW A;  3S06 A;  1GO1 A;  2VAM A;  3C9R A;  1X7O A;  1W58 1;  4X1I B;  4B62 A;  5IJ0 A;  5JH7 A;  1NJI H;  2FGY A;  3WJQ A;  3WGK A;  1GX1 A;  2Z01 A;  4X20 A;  1IPA A;  1H7M A;  2ZF8 A;  3IMP A;  1YQN A;  4G88 A;  3D00 A;  4ZHY B;  1X7P A;  1FSZ A;  2YYE A;  3JAS A;  2GVI A;  3F0D A;  5IJ0 B;  3CCV F;  3WGJ A;  3RE3 A;  4TZZ A;  1JJ2 F;  1OAP A;  2ALE A;  1CLI A;  4I4T B;  3MBM A;  4EB6 A;  3SIU A;  3CC7 F;  2QTP A;  2HQS C;  2BTQ B;  2UYN B;  3J80 M;  3P0Z A;  3E22 A;  3JAS B;  2R75 1;  3K0T A;  4O4H A;  1IV1 A;  3M84 A;  4ZHV A;  5FNV B;  4I4T A;  4EB6 B;  3TD4 A;  2AMT A;  5LYJ A;  1TUB A;  3JAR A;  2Q1X A;  1W3E X;  5G4V C;  1VQP F;  5CB4 A;  3VYS C;  1YJ9 F;  3JAW B;  3RYI A;  1RQ2 A;  4BT3 A;  3WGL A;  4WBN A;  1YGY A;  5FNV A;  1VQ4 F;  4E6E A;  5LP6 A;  1Q81 H;  1YIJ F;  3JAR B;  3RYH A;  2YXZ A;  3I7T A;  1M90 H;  3MCA B;  3IKE A;  1VHA A;  3JAT A;  3N2K A;  5HY2 A;  3MDO A;  4R40 B;  3CCQ F;  5CB4 B;  2IAF A;  2KTV A;  1CN7 A;  5EIB D;  3WPW A;  1VQ5 F;  4EI8 A;  1JY8 A;  3GHZ A;  4WBN B;  4U39 A;  3FBA A;  2RHJ A;  3FD5 A;  4NUT A;  3D01 A;  2IG8 A;  1VQ9 F;  3JAT B;  2UYJ A;  3ZP4 A;  2PMP A;  3RYF B;  3CCL F;  5FJ4 C;  5JCO A;  5CA0 B;  2AIZ P;  1COM A;  4ZOL A;  1VQ7 F;  5JH7 B;  2Z1T A;  1SA0 B;  4BT4 A;  1K9M H;  2H8C A;  3MCQ A;  1UFY A;  4BVT A;  3CMA F;  3T80 A;  3TD3 A;  1VQM F;  2NMU A;  2HP3 A;  3Q8H A;  4TV8 B;  5EIB C;  5JQG A;  1JD1 A;  4EI9 A;  1K8A H;  1SA0 A;  5IJ9 A;  2HRU A;  1UI9 A;  4DXD A;  2DT4 A;  3F0G A;  2I6D A;  2UYN A;  3G6E F;  5LA6 B;  2Z1F A;  2LBW A;  3LYB A;  3CCS F;  1Q8R A;  3VYU C;  3N4Z A;  3L7Q A;  2HS3 A;  2LCA A;  3R0P A;  2QEX F;  3JCM M;  1FNK A;  3IR9 A;  4F6R A;  1Z5W A;  5LYJ B;  2WAL A;  3NK7 A;  2HS4 A;  3VOA A;  3VO8 A;  1DBF A;  5LA6 A;  3KJJ A;  2OHW A;  2UYK A;  3RYI B;  1XBI A;  3LME A;  5J2T A;  1QVF F;  3CYP B;  5HWE A;  4O2B A;  1W5F A;  3CXC F;  2RHO A;  5LP6 B;  3C9S A;  2OTM A;  3N2K B;  2QI2 A;  5GAP K;  3ZO8 A;  3GTZ A;  5EAZ A;  4C8I A;  2Z1U A;  2Q1Y A;  1NMU B;  5IYZ B;  4BVQ A;  5B8F A;  3V7E A;  3CCE F;  1VQK F;  3WGM A;  4X1K A;  3K2X A;  5GON B;  5EB1 B;  1U3L A;  4G4V A;  3C9U A;  3RYF A;  5MN4 A;  1H47 A;  4NQ3 A;  3I3F A;  5CA0 A;  4ZI7 A;  4ZOL B;  4BVS A;  5C8Y A;  3J81 M;  4BVR A;  1J7H A;  3OBY A;  1VQ6 F;  1XV2 A;  2RHL A;  4X1Y B;  5GON A;  3IKF A;  2KGW A;  5HY0 A;  5GIN C;  2RHH A;  1Q86 H;  3NVK E;  2CVL A;  1Z5V A;  3C9T A;  3KE1 A;  4C4W C;  4TV8 A;  2HVY D;  5JQG B;  4O4I B;  1KD1 H;  3PAF A;  4LNU B;  1JFF B;  2H6L A;  3HKB A;  4G4W A;  4G4X A;  5C8Y B;  5IJ9 B;  4RQO A;  3N2G B;  1YJN F;  3S03 A;  3VIU A;  5GAN K;  4YJ2 A;  2CHS A;  1Q82 H;  3OON A;  4O2A A;  1W5A A;  2JNB A;  2UYP A;  3HJW C;  3CCR F;  1ZWZ A;  3LWV C;  2K1S A;  3DDN A;  2HRY A;  3DC2 A;  1JFF A;  4EI7 A;  3JAL B;  3CCJ F;  3EOR A;  5EB0 A;  4HNA A;  3WXM B;  4F6R B;  2W8B C;  2L26 A;  4YJ2 B;  4U3J A;  5EYP B;  2I6R A;  1VQO F;  3NVI B;  4BT5 A;  3JAK A;  3CB2 A;  5LXT A;  1ONI A;  3F0E A;  3AGK A;  5J2T B;  5GIP C;  5KX5 A;  1PXW A;  1QVG F;  4IHJ B;  4O2B B;  3OW2 F;  1YI2 F;  5EZY A;  2ZAU A;  4U3J B;  1U43 A;  2KG4 A;  2G9I A;  5EYP A;  1IV4 A;  3V4D A;  1GO0 A;  1W40 A;  1VQN F;  2OTL F;  5HP8 A;  4ZHQ B;  3V3T A;  1RLG A;  2H8E A;  3HKD B;  3VI6 A;  3JAK B;  5CA1 B;  1E7K A;  5EO3 A;  5LXT B;  5A2Q M;  5IYZ A;  2CHT A;  5KX5 B;  3VMF B;  2B33 A;  3WJR A;  4X1K B;  4TV9 B;  4ZK7 A;  5EZY B;  3D54 A;  1QAH A;  1Q7Y H;  4O4J B;  1VH8 A;  5LP6 C;  4ZHQ A;  4BT6 A;  3TD5 A;  4G4Z A;  3N4Y A;  3VTI C;  5MN6 A;  3KIZ A;  4ZI7 B;  1N8R H;  3IEW A;  1X25 A;  3LWR C;  1QU9 A;  3JVH A;  2GLZ A;  1YHQ F;  4IIJ B;  5MN5 A;  2OTJ F;  4X1Y A;  3S0H A;  5J2U A;  1SDS A;  2BTU A;  4C82 A;  2DYY A;  5LOV B;  1W55 A; 
#chains in the Genus database with same CATH homology
 5G4V C;  3CCE F;  2CZW A;  1VQP F;  5FLX M;  1VQK F;  3G4S F;  1YJ9 F;  3JAM M;  3G71 F;  1K73 H;  5IT9 M;  3GYQ A;  2AIF A;  4BW0 B;  1YJW F;  1VQ4 F;  1M1K H;  4NQ3 A;  1Q81 H;  1YIJ F;  1M90 H;  4BVS A;  3MCA B;  2BO1 A;  3J81 M;  5HY2 A;  3CCQ F;  4BVR A;  3OBY A;  1VQ6 F;  3NK6 A;  3V7Q A;  1KC8 H;  2KTV A;  1CN7 A;  5HY0 A;  5GIN C;  1Q86 H;  4XCQ A;  1VQ5 F;  2OZB A;  3HAX D;  3NVK E;  4EI8 A;  3CPQ A;  4C4W C;  3CC2 F;  2LBX A;  3LWP C;  3CME F;  3LWQ C;  3LFO A;  2HVY D;  1KD1 H;  4NUT A;  3LWO C;  1YIT F;  3PAF A;  2KTU A;  1VQ9 F;  2QA4 F;  1YJN F;  3I55 F;  3CCL F;  5FJ4 C;  2VGM A;  3RA5 A;  5GAN K;  1Q82 H;  3CD6 F;  1VQ7 F;  2JNB A;  1VQ8 F;  3HJW C;  1KQS F;  3O85 A;  1K9M H;  3CCR F;  4BVT A;  1ZWZ A;  1VQL F;  4X3L A;  3RA6 A;  1W41 A;  3LWV C;  5DCV A;  3CMA F;  1VQM F;  2FC3 A;  4EI7 A;  3CCJ F;  3E20 B;  1S72 F;  3WXM B;  2VGN A;  5EWR A;  4EI9 A;  1VQO F;  1W42 A;  1K8A H;  3NVI B;  5HXU A;  2F9Z C;  3CG6 A;  4LCK A;  1DT9 A;  3CPW F;  3AGK A;  5GIP C;  1T0K B;  3OBW A;  3CC4 F;  1GO1 A;  3I56 F;  1PXW A;  1X7O A;  2I6D A;  1QVG F;  3G6E F;  3OW2 F;  1YI2 F;  1NJI H;  1GZ0 A;  2LBW A;  2FGY A;  3CCS F;  2KG4 A;  1GO0 A;  3N4Z A;  1W40 A;  4BY9 D;  2OTL F;  1VQN F;  3V3T A;  1RLG A;  1IPA A;  3VI6 A;  2QEX F;  3JCM M;  3IR9 A;  1E7K A;  1H7M A;  5EO3 A;  3NMU C;  5A2Q M;  5G4U C;  3D00 A;  2WAL A;  1X7P A;  3NK7 A;  3VMF B;  3FFM A;  3CCV F;  5HY1 A;  3J7A R;  3CCM F;  3PLA C;  2OHW A;  4TZZ A;  1JJ2 F;  4X3M A;  3CCU F;  2ALE A;  1Q7Y H;  3ON1 A;  3SIU A;  1XBI A;  3CC7 F;  1QVF F;  5HWE A;  3N4Y A;  3J80 M;  1RA4 A;  3CXC F;  1N8R H;  3LWR C;  1W2B F;  2GLZ A;  3SIV A;  2QI2 A;  5GIO C;  1X52 A;  5GAP K;  1YHQ F;  2OTJ F;  3E1Y A;  1SDS A;  1NMU B;  4BVQ A;  1CK2 A;  1W3E X;  5HXZ A;  3V7E A;  5HY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...