2QEXF

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qexF00
5EWRA 3CCMF 5GIOC 1YIJF 3N4ZA 1VQ4F 3FFMA 3PAFA 3G71F 1H7MA 3LFOA 1VQPF 3RA5A 2OHWA 3CD6F 1W2BF 1XBIA 1RLGA 3CC2F 4BW0B 2LBXA 1CK2A 5GIPC 5FLXM 1YJ9F 3LWQC 5EO3A 5FJ4C 3RA6A 3JAMM 3GYQA 1VQOF 3J80M 4NUTA 3I56F 3G6EF 3ON1A 1M90H 2KG4A 2KTUA 1VQ6F 3CMEF 3HAXD 2OZBA 1YITF 1ZWZA 1W42A 1YHQF 1Q86H 3CCUF 3MCAB 3LWPC 1VQMF 3OW2F 2QEXF 3NMUC 4BY9D 1W3EX 1DT9A 1YJNF 3WXMB 1VQ9F 1IPAA 4TZZA 1YJWF 1S72F 3LWOC 5DCVA 1GZ0A 3OBYA 3VMFB 1SDSA 3SIUA 2AIFA 3JCMM 2FC3A 1Q82H 1RA4A 1W40A 1KC8H 2ALEA 3CMAF 2KTVA 1YI2F 1E7KA 1GO0A 3AGKA 4LCKA 1JJ2F 3VI6A 2BO1A 1VQNF 3CCLF 3NK7A 3CCVF 5GAPK 1Q81H 1K9MH 5G4VC 1VQ8F 3CC7F 3N4YA 3CCSF 3CG6A 1W41A 4C4WC 3CCEF 3G4SF 4X3MA 2JNBA 3E20B 1PXWA 3CCJF 1VQ5F 5GINC 1Q7YH 3O85A 3NVIB 1VQLF 3CCQF 3SIVA 3OBWA 3E1YA 2OTLF 1NMUB 1M1KH 5A2QM 1VQ7F 1GO1A 3CC4F 3CPWF 3NVKE 1QVFF 1N8RH 2QI2A 1QVGF 2OTJF 3NK6A 3V7QA 3HJWC 2VGNA 1VQKF 2QA4F 3LWVC 5G4UC 3CXCF 1KQSF 3PLAC 2I6DA 4X3LA 3CCRF 1K8AH 3IR9A 2VGMA 2LBWA 1X7PA 3I55F 1CN7A 5GANK 2WALA 3CPQA 1K73H 2CZWA 2HVYD 3J7AR 1X52A 3LWRC 1T0KB 3V7EA 1KD1H 3J81M 1X7OA 5IT9M 1NJIH
chains in the Genus database with same CATH superfamily
5CA0B 2IG8A 4G4YA 3WPXA 1YGYA 4O4IA 4G88A 1XRGA 3VYSC 3C9SA 4NQ3A 5LYJA 3VYUC 3JVHA 2OHWA 1JY8A 1XBIA 2H6LA 3K14A 4O4LB 3BYQA 1RLGA 2LBXA 5GIPC 5FLXM 1YJ9F 1QD9A 1UFYA 3JAMM 1U40A 4NUTA 3HKCA 1Q8RA 1M90H 2KG4A 4X1IA 2ZF8A 1IV1A 2HP3A 5IJ9B 1SA0B 1SA0A 1VQ6F 5JH7A 4O2BA 1RQ7A 3F6MA 3FD6A 3WPWA 2YYEA 3IKFA 1YITF 4KWEA 3DDNA 4DRXB 4FFBB 1XHOA 1Q86H 3ZO8A 3MDOA 1VQMF 1YJNF 4BVQA 4X1YA 3LWOC 5DCVA 3OBYA 5JVDB 3Q8HA 5HXUA 3RYHB 2PHNA 2RHLA 2DYYA 2ALEA 3CMAF 2KTVA 1E7KA 3AGKA 4LCKA 1JJ2F 3N2GA 2BO1A 1KNJA 3KJJA 3IMPA 3D01A 4I50A 2H8EA 1Q81H 2CVLA 4C8IA 1K9MH 3N4YA 1OFUA 3D00A 3R0PA 4BVRA 1FNKA 5B8FA 4O2AA 3F0FA 4G4VA 1W581 4O4JB 3E20B 2GVIA 1VQLF 3SIVA 1Z5WA 1TUBA 3E1YA 1ODEA 4BT3A 5LP6A 3QUWA 3VIUA 3HKDA 1QVFF 2EWCA 2QI2A 3CB2A 4C81A 3K0TA 4EB6B 5HY0A 1QVGF 3V7QA 2I6DA 1K8AH 3IR9A 3K2XA 3JATA 3M4SA 4ZHQA 4M8IA 3N2KA 3E22A 2VXYA 4WBNA 3HKBA 3CPQA 1K73H 2RHJA 5LA6A 3LWRC 1YQNA 3P4EA 3L7QA 3CYQA 1T0KB 3I7TA 5JCOC 5CA1A 2HQSC 1OAPA 5IT9M 2P6YA 2ZAUA 2MQEA 2AMTA 2Q1YA 5J2TB 1VK3A 3CCMF 4LNUA 3FBAA 1JFFB 3S0YA 3RYFB 2N48A 4ZI7A 2RHOA 4IHJB 4U3JB 2UYNB 1W2BF 2W8BC 3JAWB 4ZHYB 4EI7A 3CC2F 4BW0B 1CK2A 3JARB 4ERHA 5EO3A 3HKEA 1W5BA 2I6RA 5KX5A 3ON1A 5IYZB 3VOAA 5LOVA 3ESJA 5LA6B 2VAWA 3FD5A 3FPIA 5EYPB 3ZP4A 1W57A 2VAPA 3HAXD 3RYCA 1W42A 1W5EA 3RYIA 4O4IB 4RQOA 3MCAB 4RHAA 3LWPC 3OW2F 2RB9A 5LYJB 2UZHA 4BY9D 3NMUC 1VQ9F 4TV8A 4YJ2A 3OONA 1SDSA 2BTQB 2AIFA 3JCMM 1RA4A 1W40A 2ZOVA 5LXTA 1YI2F 2R751 3WGKA 5J2UA 3HKCB 5MN5A 1VQNF 4X1IB 3NK7A 3CCVF 5JH7B 4O2BB 3JALA 5JQGB 5JQGA 4B5CA 3CC7F 3F0EA 3CCSF 3WJQA 3S02A 2HP0A 3MCQA 3G4SF 4X3MA 4X1YB 4C8EA 3CCJF 5GINC 1Q7YH 3NVIB 4TUYA 2OTMA 4I55A 1JD1A 1FFXB 1FFXA 4IIJA 1TVKA 5A2QM 2Z1FA 5BMVA 1GO1A 3CC4F 1IV2A 3N2GB 4X1KA 1U3PA 3CPWF 2OTJF 3NK6A 4I50B 4ZHVA 1VQKF 4B62A 5G4UC 1VH8A 4ZOLA 2B33A 4X20A 4O2AB 4C8GA 1CN7A 2Z1TA 5FNVA 3F0DA 3QTYA 5GANK 2UYJA 3UT5A 3JAKA 4B46A 2CZWA 3ERNA 3VCZA 5HY4A 1X52A 4BVTA 3KHNA 4ZK7A 1QAHA 5MN6A 5IJ0A 4YJ3A 1TUBB 2HRYA 1W55A 3C9UA 4BT4A 3HTNA 5LP6B 1NJIH 3HKDB 4ZHWA 2G9IA 1YIJF 3N4ZA 1KNKA 3IKEA 1VQ4F 3FFMA 3KJKA 2NMUA 5HP7A 3WGLA 4O4HA 3PAFA 1H7MA 3LFOA 1W5FA 3LYBA 3RA5A 3C9RA 3JATB 5AVMA 3TD3A 4ZHQB 3N2KB 3E22B 4WBNB 3HKBB 3LWQC 4PWTA 3RA6A 3GYQA 2CWJA 1VQOF 3J80M 3P0ZA 4I4TA 5CA1B 3VO8A 2KTUA 4EI8A 3CMEF 3T80A 2OZBA 3TD4A 4LNUB 1QU9A 5HP8A 3DC2A 5EB1B 3CCUF 4ZI7B 2F9ZC 2IAFA 3HWUA 5EB0A 1W3EX 4F6RA 1J7HA 1IV3A 1YJWF 1S72F 1XV2A 5KMGA 2HRUA 3SIUA 2HS0A 1KC8H 3HKEB 1SZQA 2BTOA 1GO0A 3MBMA 5C8YA 3VI6A 5KX5B 3CCLF 5LOVB 1U3LA 1JN1A 4HNAA 5GONA 1CLIA 5G4VC 1VQ8F 3RYCB 4TV9A 3CG6A 5JCOA 3RYIB 1RLUA 3CCEF 5CB4A 1ONIA 5ITZA 2UYPA 4C82A 2JNBA 4TV8B 4G4WA 1PXWA 3V4DA 4YJ2B 4E6EA 3JASA 2FGYA 2QTPA 5EAZA 3S0HA 3IEQA 5EIBD 3OBWA 3VYTC 5EZYA 2UYKA 5LXTB 1VQ7F 2Z01A 5J2UB 4NWOB 5CA0A 2PMPA 2CSLA 2VAMA 1NQ3A 2R6R1 3HJWC 2VGNA 2QA4F 3QHDA 1KQSF 3JALB 3PLAC 2LCAA 5EIBC 3M84A 2VGMA 2LBWA 1FNJA 1X7PA 3S0WA 2L26A 2HP0B 4O4LA 2WALA 1FSZA 5HY1A 3WGMA 1T0AA 2CHSA 2ZVYA 2HX0A 2HVYD 3TD5A 3J7AR 2LBTA 4TUYB 4I55B 3U0OA 1H48A 2K1SA 3LDTA 4IIJB 1TVKB 3J81M 3ZP7A 5IJ9A 1KD1H 5BMVB 4X1KB 5EWRA 3WGNA 4XCQA 3D54A 5GIOC 4DRXA 4FFBA 3S06A 3S03A 4ZOLB 2RHHA 3G71F 1VQPF 3CD6F 5EYPA 3KE1A 4X20B 3WGJA 1U43A 1VQVA 3KIZA 5FNVB 3GTZA 5LP6C 3UT5B 3I3FA 2DT4A 5JVDA 3JAKB 3IEWA 3RYHA 5FJ4C 5IJ0B 3I56F 4G4ZA 4YJ3B 3G6EF 2GLZA 3ELCA 3VOBA 3WJPA 2HS3A 1ZWZA 1PF5A 3VTIC 1YHQF 3CYPB 2CW4A 3RE3A 4O4HB 2QEXF 2CHTA 1DT9A 3WXMB 1IPAA 4O4JA 4TZZA 3LMEA 1GX1A 4BT6A 1GZ0A 4BT5A 1RQ2A 3VMFB 2FC3A 3V3TA 1Q82H 3WJRA 2KGWA 4U39A 5HWEA 4DXDA 2Z1UA 4I4TB 4EB6A 5MN4A 1VHAA 5GAPK 3C8LA 5HXZA 4BT2A 4G4XA 1W5AA 4BVSA 3F0GA 3P10A 3ZOPA 1W41A 2H8CA 1X25A 4C4WC 2Z1EA 4F6RB 1VQ5F 2HS4A 5KMGB 3O85A 3GHZA 3B6NA 3CCQF 2ZODA 3K12A 2OTLF 1NMUB 2BTUA 1M1KH 5C8YB 1Z5VA 2V9YA 3NVKE 1N8RH 5J2TA 4EI9A 4B45A 4HNAB 3LWVC 1JFFA 3EORA 5GONB 3CXCF 1H47A 1DBFA 3RYFA 2GZLA 4X3LA 4TV9B 3CCRF 3MQWA 4IHJA 4U3JA 2UYNA 2ZVZA 3I55F 2YXZA 3JAWA 5CB4B 5HY2A 1IV4A 1COMA 5ITZB 3JARA 3M1XA 1UI9A 3JASB 3C9TA 4R40B 4BT7A 3V7EA 5EZYB 5IYZA 1R1MA 2IQQA 2Q1XA 2AIZP 1X7OA 1W59A
chains in the Genus database with same CATH topology
5EWRA 4XCQA 3CCMF 5GIOC 1YIJF 3N4ZA 1VQ4F 3FFMA 3PAFA 4NQ3A 1H7MA 3LFOA 3G71F 1VQPF 3RA5A 2OHWA 3CD6F 1W2BF 1XBIA 4EI7A 1RLGA 3CC2F 4BW0B 2LBXA 1CK2A 5GIPC 5FLXM 1YJ9F 3LWQC 5EO3A 5FJ4C 3RA6A 3JAMM 3GYQA 1VQOF 3J80M 4NUTA 3I56F 3G6EF 3ON1A 1M90H 2KG4A 2GLZA 2KTUA 4EI8A 1VQ6F 3CMEF 3HAXD 2OZBA 1YITF 1ZWZA 1W42A 1YHQF 1Q86H 3CCUF 3MCAB 3LWPC 2F9ZC 1VQMF 3OW2F 2QEXF 3NMUC 4BY9D 1W3EX 1DT9A 1YJNF 3WXMB 1VQ9F 1IPAA 4BVQA 4TZZA 1YJWF 1S72F 3LWOC 5DCVA 1GZ0A 3OBYA 3VMFB 1SDSA 3SIUA 2AIFA 3JCMM 5HXUA 2FC3A 3V3TA 1Q82H 1RA4A 1W40A 1KC8H 2ALEA 3CMAF 2KTVA 1YI2F 1E7KA 1GO0A 3AGKA 5HWEA 4LCKA 1JJ2F 3VI6A 2BO1A 1VQNF 3CCLF 3NK7A 3CCVF 5GAPK 1Q81H 1K9MH 5HXZA 5G4VC 1VQ8F 3CC7F 3N4YA 3CCSF 3CG6A 4BVSA 3D00A 4BVRA 1W41A 4C4WC 3CCEF 3G4SF 4X3MA 2JNBA 3E20B 1PXWA 3CCJF 1VQ5F 5GINC 1Q7YH 3O85A 2FGYA 3NVIB 1VQLF 3CCQF 3SIVA 3OBWA 3E1YA 2OTLF 1NMUB 1M1KH 5A2QM 1VQ7F 1GO1A 3CC4F 3CPWF 3NVKE 1QVFF 1N8RH 2QI2A 5HY0A 1QVGF 2OTJF 4EI9A 3NK6A 3V7QA 3HJWC 2VGNA 1VQKF 2QA4F 3LWVC 5G4UC 3CXCF 1KQSF 3PLAC 2I6DA 4X3LA 3CCRF 1K8AH 3IR9A 2VGMA 2LBWA 1X7PA 3I55F 1CN7A 5GANK 5HY2A 2WALA 5HY1A 3CPQA 1K73H 2CZWA 2HVYD 5HY4A 1X52A 4BVTA 3J7AR 3LWRC 1T0KB 3V7EA 1KD1H 3J81M 1X7OA 5IT9M 1NJIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWR A;  3CCM F;  5GIO C;  1YIJ F;  3N4Z A;  1VQ4 F;  3FFM A;  3PAF A;  3G71 F;  1H7M A;  3LFO A;  1VQP F;  3RA5 A;  2OHW A;  3CD6 F;  1W2B F;  1XBI A;  1RLG A;  3CC2 F;  4BW0 B;  2LBX A;  1CK2 A;  5GIP C;  5FLX M;  1YJ9 F;  3LWQ C;  5EO3 A;  5FJ4 C;  3RA6 A;  3JAM M;  3GYQ A;  1VQO F;  3J80 M;  4NUT A;  3I56 F;  3G6E F;  3ON1 A;  1M90 H;  2KG4 A;  2KTU A;  1VQ6 F;  3CME F;  3HAX D;  2OZB A;  1YIT F;  1ZWZ A;  1W42 A;  1YHQ F;  1Q86 H;  3CCU F;  3MCA B;  3LWP C;  1VQM F;  3OW2 F;  2QEX F;  3NMU C;  4BY9 D;  1W3E X;  1DT9 A;  1YJN F;  3WXM B;  1VQ9 F;  1IPA A;  4TZZ A;  1YJW F;  1S72 F;  3LWO C;  5DCV A;  1GZ0 A;  3OBY A;  3VMF B;  1SDS A;  3SIU A;  2AIF A;  3JCM M;  2FC3 A;  1Q82 H;  1RA4 A;  1W40 A;  1KC8 H;  2ALE A;  3CMA F;  2KTV A;  1YI2 F;  1E7K A;  1GO0 A;  3AGK A;  4LCK A;  1JJ2 F;  3VI6 A;  2BO1 A;  1VQN F;  3CCL F;  3NK7 A;  3CCV F;  5GAP K;  1Q81 H;  1K9M H;  5G4V C;  1VQ8 F;  3CC7 F;  3N4Y A;  3CCS F;  3CG6 A;  1W41 A;  4C4W C;  3CCE F;  3G4S F;  4X3M A;  2JNB A;  3E20 B;  1PXW A;  3CCJ F;  1VQ5 F;  5GIN C;  1Q7Y H;  3O85 A;  3NVI B;  1VQL F;  3CCQ F;  3SIV A;  3OBW A;  3E1Y A;  2OTL F;  1NMU B;  1M1K H;  5A2Q M;  1VQ7 F;  1GO1 A;  3CC4 F;  3CPW F;  3NVK E;  1QVF F;  1N8R H;  2QI2 A;  1QVG F;  2OTJ F;  3NK6 A;  3V7Q A;  3HJW C;  2VGN A;  1VQK F;  2QA4 F;  3LWV C;  5G4U C;  3CXC F;  1KQS F;  3PLA C;  2I6D A;  4X3L A;  3CCR F;  1K8A H;  3IR9 A;  2VGM A;  2LBW A;  1X7P A;  3I55 F;  1CN7 A;  5GAN K;  2WAL A;  3CPQ A;  1K73 H;  2CZW A;  2HVY D;  3J7A R;  1X52 A;  3LWR C;  1T0K B;  3V7E A;  1KD1 H;  3J81 M;  1X7O A;  5IT9 M;  1NJI H; 
#chains in the Genus database with same CATH topology
 5CA0 B;  2IG8 A;  4G4Y A;  3WPX A;  1YGY A;  4O4I A;  4G88 A;  1XRG A;  3VYS C;  3C9S A;  4NQ3 A;  5LYJ A;  3VYU C;  3JVH A;  2OHW A;  1JY8 A;  1XBI A;  2H6L A;  3K14 A;  4O4L B;  3BYQ A;  1RLG A;  2LBX A;  5GIP C;  5FLX M;  1YJ9 F;  1QD9 A;  1UFY A;  3JAM M;  1U40 A;  4NUT A;  3HKC A;  1Q8R A;  1M90 H;  2KG4 A;  4X1I A;  2ZF8 A;  1IV1 A;  2HP3 A;  5IJ9 B;  1SA0 B;  1SA0 A;  1VQ6 F;  5JH7 A;  4O2B A;  1RQ7 A;  3F6M A;  3FD6 A;  3WPW A;  2YYE A;  3IKF A;  1YIT F;  4KWE A;  3DDN A;  4DRX B;  4FFB B;  1XHO A;  1Q86 H;  3ZO8 A;  3MDO A;  1VQM F;  1YJN F;  4BVQ A;  4X1Y A;  3LWO C;  5DCV A;  3OBY A;  5JVD B;  3Q8H A;  5HXU A;  3RYH B;  2PHN A;  2RHL A;  2DYY A;  2ALE A;  3CMA F;  2KTV A;  1E7K A;  3AGK A;  4LCK A;  1JJ2 F;  3N2G A;  2BO1 A;  1KNJ A;  3KJJ A;  3IMP A;  3D01 A;  4I50 A;  2H8E A;  1Q81 H;  2CVL A;  4C8I A;  1K9M H;  3N4Y A;  1OFU A;  3D00 A;  3R0P A;  4BVR A;  1FNK A;  5B8F A;  4O2A A;  3F0F A;  4G4V A;  1W58 1;  4O4J B;  3E20 B;  2GVI A;  1VQL F;  3SIV A;  1Z5W A;  1TUB A;  3E1Y A;  1ODE A;  4BT3 A;  5LP6 A;  3QUW A;  3VIU A;  3HKD A;  1QVF F;  2EWC A;  2QI2 A;  3CB2 A;  4C81 A;  3K0T A;  4EB6 B;  5HY0 A;  1QVG F;  3V7Q A;  2I6D A;  1K8A H;  3IR9 A;  3K2X A;  3JAT A;  3M4S A;  4ZHQ A;  4M8I A;  3N2K A;  3E22 A;  2VXY A;  4WBN A;  3HKB A;  3CPQ A;  1K73 H;  2RHJ A;  5LA6 A;  3LWR C;  1YQN A;  3P4E A;  3L7Q A;  3CYQ A;  1T0K B;  3I7T A;  5JCO C;  5CA1 A;  2HQS C;  1OAP A;  5IT9 M;  2P6Y A;  2ZAU A;  2MQE A;  2AMT A;  2Q1Y A;  5J2T B;  1VK3 A;  3CCM F;  4LNU A;  3FBA A;  1JFF B;  3S0Y A;  3RYF B;  2N48 A;  4ZI7 A;  2RHO A;  4IHJ B;  4U3J B;  2UYN B;  1W2B F;  2W8B C;  3JAW B;  4ZHY B;  4EI7 A;  3CC2 F;  4BW0 B;  1CK2 A;  3JAR B;  4ERH A;  5EO3 A;  3HKE A;  1W5B A;  2I6R A;  5KX5 A;  3ON1 A;  5IYZ B;  3VOA A;  5LOV A;  3ESJ A;  5LA6 B;  2VAW A;  3FD5 A;  3FPI A;  5EYP B;  3ZP4 A;  1W57 A;  2VAP A;  3HAX D;  3RYC A;  1W42 A;  1W5E A;  3RYI A;  4O4I B;  4RQO A;  3MCA B;  4RHA A;  3LWP C;  3OW2 F;  2RB9 A;  5LYJ B;  2UZH A;  4BY9 D;  3NMU C;  1VQ9 F;  4TV8 A;  4YJ2 A;  3OON A;  1SDS A;  2BTQ B;  2AIF A;  3JCM M;  1RA4 A;  1W40 A;  2ZOV A;  5LXT A;  1YI2 F;  2R75 1;  3WGK A;  5J2U A;  3HKC B;  5MN5 A;  1VQN F;  4X1I B;  3NK7 A;  3CCV F;  5JH7 B;  4O2B B;  3JAL A;  5JQG B;  5JQG A;  4B5C A;  3CC7 F;  3F0E A;  3CCS F;  3WJQ A;  3S02 A;  2HP0 A;  3MCQ A;  3G4S F;  4X3M A;  4X1Y B;  4C8E A;  3CCJ F;  5GIN C;  1Q7Y H;  3NVI B;  4TUY A;  2OTM A;  4I55 A;  1JD1 A;  1FFX B;  1FFX A;  4IIJ A;  1TVK A;  5A2Q M;  2Z1F A;  5BMV A;  1GO1 A;  3CC4 F;  1IV2 A;  3N2G B;  4X1K A;  1U3P A;  3CPW F;  2OTJ F;  3NK6 A;  4I50 B;  4ZHV A;  1VQK F;  4B62 A;  5G4U C;  1VH8 A;  4ZOL A;  2B33 A;  4X20 A;  4O2A B;  4C8G A;  1CN7 A;  2Z1T A;  5FNV A;  3F0D A;  3QTY A;  5GAN K;  2UYJ A;  3UT5 A;  3JAK A;  4B46 A;  2CZW A;  3ERN A;  3VCZ A;  5HY4 A;  1X52 A;  4BVT A;  3KHN A;  4ZK7 A;  1QAH A;  5MN6 A;  5IJ0 A;  4YJ3 A;  1TUB B;  2HRY A;  1W55 A;  3C9U A;  4BT4 A;  3HTN A;  5LP6 B;  1NJI H;  3HKD B;  4ZHW A;  2G9I A;  1YIJ F;  3N4Z A;  1KNK A;  3IKE A;  1VQ4 F;  3FFM A;  3KJK A;  2NMU A;  5HP7 A;  3WGL A;  4O4H A;  3PAF A;  1H7M A;  3LFO A;  1W5F A;  3LYB A;  3RA5 A;  3C9R A;  3JAT B;  5AVM A;  3TD3 A;  4ZHQ B;  3N2K B;  3E22 B;  4WBN B;  3HKB B;  3LWQ C;  4PWT A;  3RA6 A;  3GYQ A;  2CWJ A;  1VQO F;  3J80 M;  3P0Z A;  4I4T A;  5CA1 B;  3VO8 A;  2KTU A;  4EI8 A;  3CME F;  3T80 A;  2OZB A;  3TD4 A;  4LNU B;  1QU9 A;  5HP8 A;  3DC2 A;  5EB1 B;  3CCU F;  4ZI7 B;  2F9Z C;  2IAF A;  3HWU A;  5EB0 A;  1W3E X;  4F6R A;  1J7H A;  1IV3 A;  1YJW F;  1S72 F;  1XV2 A;  5KMG A;  2HRU A;  3SIU A;  2HS0 A;  1KC8 H;  3HKE B;  1SZQ A;  2BTO A;  1GO0 A;  3MBM A;  5C8Y A;  3VI6 A;  5KX5 B;  3CCL F;  5LOV B;  1U3L A;  1JN1 A;  4HNA A;  5GON A;  1CLI A;  5G4V C;  1VQ8 F;  3RYC B;  4TV9 A;  3CG6 A;  5JCO A;  3RYI B;  1RLU A;  3CCE F;  5CB4 A;  1ONI A;  5ITZ A;  2UYP A;  4C82 A;  2JNB A;  4TV8 B;  4G4W A;  1PXW A;  3V4D A;  4YJ2 B;  4E6E A;  3JAS A;  2FGY A;  2QTP A;  5EAZ A;  3S0H A;  3IEQ A;  5EIB D;  3OBW A;  3VYT C;  5EZY A;  2UYK A;  5LXT B;  1VQ7 F;  2Z01 A;  5J2U B;  4NWO B;  5CA0 A;  2PMP A;  2CSL A;  2VAM A;  1NQ3 A;  2R6R 1;  3HJW C;  2VGN A;  2QA4 F;  3QHD A;  1KQS F;  3JAL B;  3PLA C;  2LCA A;  5EIB C;  3M84 A;  2VGM A;  2LBW A;  1FNJ A;  1X7P A;  3S0W A;  2L26 A;  2HP0 B;  4O4L A;  2WAL A;  1FSZ A;  5HY1 A;  3WGM A;  1T0A A;  2CHS A;  2ZVY A;  2HX0 A;  2HVY D;  3TD5 A;  3J7A R;  2LBT A;  4TUY B;  4I55 B;  3U0O A;  1H48 A;  2K1S A;  3LDT A;  4IIJ B;  1TVK B;  3J81 M;  3ZP7 A;  5IJ9 A;  1KD1 H;  5BMV B;  4X1K B;  5EWR A;  3WGN A;  4XCQ A;  3D54 A;  5GIO C;  4DRX A;  4FFB A;  3S06 A;  3S03 A;  4ZOL B;  2RHH A;  3G71 F;  1VQP F;  3CD6 F;  5EYP A;  3KE1 A;  4X20 B;  3WGJ A;  1U43 A;  1VQV A;  3KIZ A;  5FNV B;  3GTZ A;  5LP6 C;  3UT5 B;  3I3F A;  2DT4 A;  5JVD A;  3JAK B;  3IEW A;  3RYH A;  5FJ4 C;  5IJ0 B;  3I56 F;  4G4Z A;  4YJ3 B;  3G6E F;  2GLZ A;  3ELC A;  3VOB A;  3WJP A;  2HS3 A;  1ZWZ A;  1PF5 A;  3VTI C;  1YHQ F;  3CYP B;  2CW4 A;  3RE3 A;  4O4H B;  2QEX F;  2CHT A;  1DT9 A;  3WXM B;  1IPA A;  4O4J A;  4TZZ A;  3LME A;  1GX1 A;  4BT6 A;  1GZ0 A;  4BT5 A;  1RQ2 A;  3VMF B;  2FC3 A;  3V3T A;  1Q82 H;  3WJR A;  2KGW A;  4U39 A;  5HWE A;  4DXD A;  2Z1U A;  4I4T B;  4EB6 A;  5MN4 A;  1VHA A;  5GAP K;  3C8L A;  5HXZ A;  4BT2 A;  4G4X A;  1W5A A;  4BVS A;  3F0G A;  3P10 A;  3ZOP A;  1W41 A;  2H8C A;  1X25 A;  4C4W C;  2Z1E A;  4F6R B;  1VQ5 F;  2HS4 A;  5KMG B;  3O85 A;  3GHZ A;  3B6N A;  3CCQ F;  2ZOD A;  3K12 A;  2OTL F;  1NMU B;  2BTU A;  1M1K H;  5C8Y B;  1Z5V A;  2V9Y A;  3NVK E;  1N8R H;  5J2T A;  4EI9 A;  4B45 A;  4HNA B;  3LWV C;  1JFF A;  3EOR A;  5GON B;  3CXC F;  1H47 A;  1DBF A;  3RYF A;  2GZL A;  4X3L A;  4TV9 B;  3CCR F;  3MQW A;  4IHJ A;  4U3J A;  2UYN A;  2ZVZ A;  3I55 F;  2YXZ A;  3JAW A;  5CB4 B;  5HY2 A;  1IV4 A;  1COM A;  5ITZ B;  3JAR A;  3M1X A;  1UI9 A;  3JAS B;  3C9T A;  4R40 B;  4BT7 A;  3V7E A;  5EZY B;  5IYZ A;  1R1M A;  2IQQ A;  2Q1X A;  2AIZ P;  1X7O A;  1W59 A; 
#chains in the Genus database with same CATH homology
 5EWR A;  4XCQ A;  3CCM F;  5GIO C;  1YIJ F;  3N4Z A;  1VQ4 F;  3FFM A;  3PAF A;  4NQ3 A;  1H7M A;  3LFO A;  3G71 F;  1VQP F;  3RA5 A;  2OHW A;  3CD6 F;  1W2B F;  1XBI A;  4EI7 A;  1RLG A;  3CC2 F;  4BW0 B;  2LBX A;  1CK2 A;  5GIP C;  5FLX M;  1YJ9 F;  3LWQ C;  5EO3 A;  5FJ4 C;  3RA6 A;  3JAM M;  3GYQ A;  1VQO F;  3J80 M;  4NUT A;  3I56 F;  3G6E F;  3ON1 A;  1M90 H;  2KG4 A;  2GLZ A;  2KTU A;  4EI8 A;  1VQ6 F;  3CME F;  3HAX D;  2OZB A;  1YIT F;  1ZWZ A;  1W42 A;  1YHQ F;  1Q86 H;  3CCU F;  3MCA B;  3LWP C;  2F9Z C;  1VQM F;  3OW2 F;  2QEX F;  3NMU C;  4BY9 D;  1W3E X;  1DT9 A;  1YJN F;  3WXM B;  1VQ9 F;  1IPA A;  4BVQ A;  4TZZ A;  1YJW F;  1S72 F;  3LWO C;  5DCV A;  1GZ0 A;  3OBY A;  3VMF B;  1SDS A;  3SIU A;  2AIF A;  3JCM M;  5HXU A;  2FC3 A;  3V3T A;  1Q82 H;  1RA4 A;  1W40 A;  1KC8 H;  2ALE A;  3CMA F;  2KTV A;  1YI2 F;  1E7K A;  1GO0 A;  3AGK A;  5HWE A;  4LCK A;  1JJ2 F;  3VI6 A;  2BO1 A;  1VQN F;  3CCL F;  3NK7 A;  3CCV F;  5GAP K;  1Q81 H;  1K9M H;  5HXZ A;  5G4V C;  1VQ8 F;  3CC7 F;  3N4Y A;  3CCS F;  3CG6 A;  4BVS A;  3D00 A;  4BVR A;  1W41 A;  4C4W C;  3CCE F;  3G4S F;  4X3M A;  2JNB A;  3E20 B;  1PXW A;  3CCJ F;  1VQ5 F;  5GIN C;  1Q7Y H;  3O85 A;  2FGY A;  3NVI B;  1VQL F;  3CCQ F;  3SIV A;  3OBW A;  3E1Y A;  2OTL F;  1NMU B;  1M1K H;  5A2Q M;  1VQ7 F;  1GO1 A;  3CC4 F;  3CPW F;  3NVK E;  1QVF F;  1N8R H;  2QI2 A;  5HY0 A;  1QVG F;  2OTJ F;  4EI9 A;  3NK6 A;  3V7Q A;  3HJW C;  2VGN A;  1VQK F;  2QA4 F;  3LWV C;  5G4U C;  3CXC F;  1KQS F;  3PLA C;  2I6D A;  4X3L A;  3CCR F;  1K8A H;  3IR9 A;  2VGM A;  2LBW A;  1X7P A;  3I55 F;  1CN7 A;  5GAN K;  5HY2 A;  2WAL A;  5HY1 A;  3CPQ A;  1K73 H;  2CZW A;  2HVY D;  5HY4 A;  1X52 A;  4BVT A;  3J7A R;  3LWR C;  1T0K B;  3V7E A;  1KD1 H;  3J81 M;  1X7O A;  5IT9 M;  1NJI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...