2QEXF

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qexF00
1W42A 1X7PA 5GANK 3CCRF 1W41A 3CCQF 3ON1A 3PAFA 1H7MA 1DT9A 2LBXA 3G4SF 1RLGA 2FC3A 2VGMA 1YIJF 3CMAF 5DCVA 1JJ2F 2OHWA 1CK2A 3OBYA 1YITF 3NK7A 1X52A 2OZBA 3CD6F 5GIOC 5FJ4C 3V7EA 3JAMM 2I6DA 3OW2F 1VQKF 3NMUC 4TZZA 3CPWF 1N8RH 1IPAA 1GZ0A 2KTUA 2CZWA 3CCLF 1YJWF 1VQ6F 1T0KB 3CXCF 1Q7YH 3CC2F 1VQ5F 1KQSF 3NVIB 3SIVA 1KD1H 1X7OA 5IT9M 2ALEA 2JNBA 2AIFA 2OTLF 2QEXF 3HAXD 3SIUA 1W40A 3LWQC 2LBWA 3PLAC 2QA4F 3WXMB 1QVGF 2QI2A 5A2QM 3J7AR 3CC4F 1VQLF 3I55F 1NMUB 5GAPK 3NVKE 3RA6A 1M1KH 1PXWA 3MCAB 4C4WC 2HVYD 3LWRC 1VQPF 1YJ9F 4X3MA 1GO0A 3OBWA 2KG4A 1Q82H 2BO1A 3GYQA 3NK6A 1CN7A 1M90H 3CG6A 1K9MH 3O85A 4X3LA 1Q81H 2VGNA 3CCVF 3LWVC 3JCMM 3N4YA 4BW0B 3VI6A 1VQOF 1NJIH 1VQ9F 3LWOC 3AGKA 5G4UC 1S72F 3J81M 3VMFB 3E1YA 1W2BF 4LCKA 2KTVA 4BY9D 1YHQF 5G4VC 4NUTA 3J80M 3CC7F 5FLXM 3IR9A 5EO3A 1VQMF 1K8AH 1VQNF 1GO1A 1SDSA 3FFMA 3G6EF 3CMEF 3LWPC 3CPQA 5GINC 3I56F 1Q86H 1VQ4F 1E7KA 3CCJF 3N4ZA 3LFOA 3CCEF 1QVFF 2OTJF 1VQ7F 1XBIA 3RA5A 1K73H 1W3EX 1ZWZA 3CCSF 1KC8H 3CCUF 3HJWC 1RA4A 5GIPC 5EWRA 3CCMF 2WALA 3V7QA 1YI2F 1YJNF 3G71F 1VQ8F 3E20B
chains in the Genus database with same CATH superfamily
3ZOPA 1W42A 2LBTA 3D54A 3K14A 1PF5A 4O4JB 3LMEA 3ON1A 4LNUB 3PAFA 2LBXA 2K1SA 1JJ2F 1W5FA 5JH7A 3RYCB 1RLUA 3DC2A 1H48A 1U3LA 3D01A 3WGJA 3JAMM 2I6DA 3S03A 3R0PA 2CHSA 2B33A 2CZWA 3E22B 3CCLF 3JATB 2Z1FA 4B45A 5EB0A 3HKDA 1KQSF 3HKEA 5C8YB 1OFUA 5HY1A 3IEWA 2H8EA 5KX5B 5MN5A 3WJQA 2UYKA 4R40B 2HP0B 1Q8RA 5GONB 2L26A 1W40A 2OTMA 3WXMB 3C8LA 5LA6B 5B8FA 1W5AA 5CA1B 4X20A 1QVGF 1Z5VA 4F6RB 4NQ3A 3JVHA 2CSLA 4C8EA 1OAPA 3NVKE 3KE1A 4YJ3B 3RA6A 5LYJA 2RHJA 4DRXB 2H8CA 3HTNA 2HVYD 3C9TA 3JAWA 1VQPF 1YJ9F 4B5CA 1IV2A 4BT5A 5JVDB 5IJ0B 3K12A 2W8BC 4G4XA 3IMPA 2KG4A 3WGNA 3KHNA 4FFBA 3V4DA 3N2KA 3CG6A 3HKBA 3O85A 3RYIA 3TD5A 2VGNA 5EYPB 5FNVA 3CCVF 3JCMM 5IYZA 4EB6B 4ZI7A 3VI6A 1UFYA 4B46A 1S72F 2AIZP 5BMVA 2CHTA 4I50A 1QAHA 4ZHYB 3CYPB 4BY9D 3J80M 1FNJA 2AMTA 2I6RA 1K8AH 1GO1A 1JN1A 3G6EF 4ZHQB 1FSZA 4YJ2A 3I56F 3N4ZA 3S0YA 3ZP4A 5HY4A 3Q8HA 1VQ7F 5J2TA 4X1KA 3CCUF 2PHNA 3WGKA 1U3PA 4EI8A 3HJWC 1UI9A 4PWTA 5GIPC 5EWRA 1TVKB 3CCMF 1W5EA 1YI2F 4I4TA 3VYTC 3BYQA 1W41A 1DT9A 3JALA 1RLGA 2FC3A 1TUBA 1ODEA 4ZHVA 1R1MA 4I55B 2HQSC 1CK2A 3OBYA 4HNAB 3JAKB 4O4JA 3WPXA 3NK7A 1X52A 4LNUA 3ELCA 3VOBA 4TV8B 3OW2F 3D00A 4TZZA 4X1IA 1SZQA 2RHLA 3MCQA 3RYCA 1U43A 2F9ZC 1DBFA 5IJ9B 1Q7YH 3SIVA 4G4ZA 5LOVB 4BVQA 1X7OA 5LP6B 1W55A 5IT9M 3E22A 2RHOA 3JATA 2HS4A 2AIFA 3QUWA 2QEXF 3SIUA 5C8YA 3F0FA 1VQVA 5KX5A 2UYNB 4U39A 2QI2A 3S0WA 2HP0A 2KGWA 2RB9A 5GONA 1VQLF 3I55F 3DDNA 1NMUB 5GAPK 5HWEA 1PXWA 2VAMA 3MCAB 4C4WC 4TUYB 2DT4A 1W57A 5LA6A 2PMPA 2R6R1 3VO8A 5CA1A 4F6RA 5CA0B 3LDTA 3OBWA 5HP8A 5LXTA 1IV3A 5EZYB 4U3JB 2Z01A 3VOAA 1RQ7A 4O2BB 1J7HA 2NMUA 1M90H 4O2AB 1QU9A 3UT5A 1Q81H 3LWVC 5IJ0A 4BW0B 1JFFB 3VYUC 2GZLA 3MDOA 4WBNA 4IHJB 2Q1XA 3J81M 3VMFB 3E1YA 4EI9A 3VTIC 1FNKA 5EYPA 5LP6C 4LCKA 1W581 1IV1A 1YHQF 4EB6A 2Z1UA 3KJJA 5FLXM 2ZF8A 5EO3A 1VQMF 1VH8A 2GVIA 3LWPC 3CPQA 5GINC 2ZODA 1Q86H 1W59A 5HP7A 1QVFF 5J2UB 5EIBD 3HKCB 5MN4A 1XBIA 1K73H 1W3EX 4EI7A 1KC8H 1JY8A 4ZHQA 4XCQA 4BT4A 2R751 3B6NA 3LYBA 2HRYA 4ZHWA 3MBMA 4X1YA 3V3TA 4B62A 3I3FA 5EAZA 3ZP7A 4X20B 2VGMA 4O4IB 5MN6A 4C8GA 5CB4B 1YITF 3F6MA 5JCOC 2RHHA 2OZBA 3CD6F 5FJ4C 3QHDA 3V7EA 3C9UA 2CW4A 5HXZA 1VQKF 2IQQA 1N8RH 4I55A 1GZ0A 1YJWF 1VQ6F 4HNAA 1T0KB 4C82A 3JAKA 3WPWA 3HKBB 3ESJA 3OONA 1VQ5F 2VAPA 3CC2F 3NVIB 4TV8A 1KD1H 4TV9A 5IYZB 2ALEA 3C9RA 2V9YA 3WGLA 4ZOLB 2JNBA 3S06A 2OTLF 2FGYA 5ITZB 5KMGB 5IJ9A 3IKFA 3HAXD 3FPIA 3JARA 2LBWA 2QA4F 5LP6A 2QTPA 1CLIA 4C8IA 5A2QM 2HS0A 4BT3A 4ERHA 3J7AR 3S02A 2Q1YA 4G4WA 3RE3A 2VXYA 4YJ2B 3M84A 2UYNA 1FFXB 2P6YA 4O4HB 4O4LB 4X3MA 4BT7A 1X25A 2UYJA 3IKEA 2YXZA 1NQ3A 4NWOB 4TUYA 3TD4A 3GHZA 3N2GB 2ZOVA 1SA0B 4X3LA 3L7QA 5HY2A 2LCAA 3WJRA 1YQNA 3N4YA 1VQOF 1YGYA 2EWCA 5AVMA 5EZYA 4IIJB 3LWOC 1H47A 4U3JA 4O2BA 3K2XA 4O2AA 4RQOA 3F0GA 1W2BF 2KTVA 4NUTA 5JQGB 3CC7F 1JFFA 3IR9A 3JASB 5JCOA 4IHJA 3FFMA 3CMEF 4YJ3A 4X1IB 4DRXA 4G4VA 1E7KA 3CCJF 4BVSA 3CCEF 2MQEA 3P10A 3F0DA 4BT2A 2OTJF 3RYHB 4BVRA 3RYFB 3RA5A 5JVDA 1ZWZA 3F0EA 3P0ZA 2H6LA 1RA4A 2WALA 3V7QA 3K0TA 4E6EA 5J2UA 1YJNF 3G71F 3HKCA 4C81A 3VIUA 1VQ8F 5JH7B 5EIBC 4DXDA 1X7PA 5GANK 3CCRF 3CCQF 2IG8A 1H7MA 3FD5A 3G4SF 5EB1B 1YIJF 3CMAF 3M4SA 3TD3A 5DCVA 3P4EA 2ZAUA 2OHWA 1T0AA 3FD6A 2BTUA 2DYYA 1QD9A 2BTQB 5GIOC 3HKDB 1COMA 3HKEB 4O4IA 3NMUC 3CPWF 1IPAA 1XV2A 5LXTB 3MQWA 2KTUA 2BTOA 5CB4A 3CXCF 3FBAA 3WJPA 3UT5B 1XHOA 2VAWA 2UYPA 1VK3A 1TVKA 4WBNB 5HXUA 2Z1TA 4BVTA 1JD1A 5LYJB 3LWQC 3PLAC 3S0HA 5HY0A 3CB2A 3JAWB 1KNKA 4G4YA 4ZOLA 3CC4F 5ITZA 5KMGA 2CVLA 4BT6A 3VYSC 1M1KH 1IV4A 3ZO8A 2YYEA 4FFBB 2G9IA 3LWRC 3N2KB 3GTZA 2HX0A 2HS3A 2N48A 2UZHA 3KJKA 3RYIB 5FNVB 1U40A 3VCZA 2ZVZA 1GO0A 2ZVYA 4ZI7B 2Z1EA 3EORA 1Q82H 2BO1A 3GYQA 2HRUA 3NK6A 5BMVB 1CN7A 4I50B 1FFXA 1K9MH 3U0OA 4O4HA 4O4LA 3CYQA 3WGMA 4X1YB 5LOVA 1VHAA 3I7TA 1NJIH 1VQ9F 3AGKA 1GX1A 5G4UC 3N2GA 1XRGA 1W5BA 2IAFA 1SA0A 1ONIA 2HP3A 3ERNA 5G4VC 3T80A 1Z5WA 4IIJA 1VQNF 4M8IA 5J2TB 3KIZA 4X1KB 1SDSA 2CWJA 1RQ2A 2GLZA 1KNJA 4RHAA 4ZK7A 5JQGA 1VQ4F 3IEQA 3C9SA 3LFOA 3JASA 5CA0A 3CCSF 4TV9B 3M1XA 4I4TB 3JALB 1TUBB 3QTYA 4KWEA 4G88A 3RYHA 3HWUA 3RYFA 3E20B 3JARB
chains in the Genus database with same CATH topology
1W42A 3V3TA 1X7PA 5GANK 3CCRF 1W41A 3CCQF 3ON1A 3PAFA 1H7MA 1DT9A 2LBXA 3G4SF 1RLGA 2FC3A 2VGMA 1YIJF 3CMAF 5DCVA 1JJ2F 2OHWA 1CK2A 3OBYA 1YITF 3NK7A 1X52A 2OZBA 3CD6F 5GIOC 5FJ4C 3V7EA 3JAMM 2I6DA 3D00A 3OW2F 5HXZA 1VQKF 3NMUC 4TZZA 3CPWF 1N8RH 1IPAA 1GZ0A 2KTUA 2CZWA 3CCLF 1YJWF 1VQ6F 1T0KB 2F9ZC 3CXCF 1Q7YH 3CC2F 1VQ5F 1KQSF 3NVIB 3SIVA 1KD1H 5HY1A 4BVQA 1X7OA 5IT9M 2ALEA 2JNBA 2AIFA 5HXUA 2OTLF 2FGYA 4BVTA 2QEXF 3HAXD 3SIUA 1W40A 3LWQC 2LBWA 3PLAC 5HY0A 2QA4F 3WXMB 1QVGF 2QI2A 5A2QM 3J7AR 3CC4F 1VQLF 4NQ3A 3I55F 1NMUB 5GAPK 3NVKE 3RA6A 5HWEA 1M1KH 1PXWA 3MCAB 4C4WC 2HVYD 3LWRC 1VQPF 1YJ9F 4X3MA 1GO0A 3OBWA 2KG4A 1Q82H 2BO1A 3GYQA 3NK6A 1CN7A 1M90H 3CG6A 1K9MH 3O85A 4X3LA 1Q81H 2VGNA 5HY2A 3CCVF 3LWVC 3JCMM 3N4YA 4BW0B 3VI6A 1VQOF 1NJIH 1VQ9F 3LWOC 3AGKA 5G4UC 1S72F 3J81M 3VMFB 3E1YA 4EI9A 1W2BF 4LCKA 2KTVA 4BY9D 1YHQF 5G4VC 4NUTA 3J80M 3CC7F 5FLXM 3IR9A 5EO3A 1VQMF 1K8AH 1VQNF 1GO1A 1SDSA 3FFMA 3G6EF 3CMEF 3LWPC 3CPQA 2GLZA 5GINC 3I56F 1Q86H 1VQ4F 1E7KA 3CCJF 3N4ZA 3LFOA 4BVSA 3CCEF 1QVFF 5HY4A 2OTJF 1VQ7F 4BVRA 1XBIA 3RA5A 1K73H 1W3EX 1ZWZA 4EI7A 3CCSF 1KC8H 3CCUF 4EI8A 4XCQA 3HJWC 1RA4A 5GIPC 5EWRA 3CCMF 2WALA 3V7QA 1YI2F 1YJNF 3G71F 1VQ8F 3E20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W42 A;  1X7P A;  5GAN K;  3CCR F;  1W41 A;  3CCQ F;  3ON1 A;  3PAF A;  1H7M A;  1DT9 A;  2LBX A;  3G4S F;  1RLG A;  2FC3 A;  2VGM A;  1YIJ F;  3CMA F;  5DCV A;  1JJ2 F;  2OHW A;  1CK2 A;  3OBY A;  1YIT F;  3NK7 A;  1X52 A;  2OZB A;  3CD6 F;  5GIO C;  5FJ4 C;  3V7E A;  3JAM M;  2I6D A;  3OW2 F;  1VQK F;  3NMU C;  4TZZ A;  3CPW F;  1N8R H;  1IPA A;  1GZ0 A;  2KTU A;  2CZW A;  3CCL F;  1YJW F;  1VQ6 F;  1T0K B;  3CXC F;  1Q7Y H;  3CC2 F;  1VQ5 F;  1KQS F;  3NVI B;  3SIV A;  1KD1 H;  1X7O A;  5IT9 M;  2ALE A;  2JNB A;  2AIF A;  2OTL F;  2QEX F;  3HAX D;  3SIU A;  1W40 A;  3LWQ C;  2LBW A;  3PLA C;  2QA4 F;  3WXM B;  1QVG F;  2QI2 A;  5A2Q M;  3J7A R;  3CC4 F;  1VQL F;  3I55 F;  1NMU B;  5GAP K;  3NVK E;  3RA6 A;  1M1K H;  1PXW A;  3MCA B;  4C4W C;  2HVY D;  3LWR C;  1VQP F;  1YJ9 F;  4X3M A;  1GO0 A;  3OBW A;  2KG4 A;  1Q82 H;  2BO1 A;  3GYQ A;  3NK6 A;  1CN7 A;  1M90 H;  3CG6 A;  1K9M H;  3O85 A;  4X3L A;  1Q81 H;  2VGN A;  3CCV F;  3LWV C;  3JCM M;  3N4Y A;  4BW0 B;  3VI6 A;  1VQO F;  1NJI H;  1VQ9 F;  3LWO C;  3AGK A;  5G4U C;  1S72 F;  3J81 M;  3VMF B;  3E1Y A;  1W2B F;  4LCK A;  2KTV A;  4BY9 D;  1YHQ F;  5G4V C;  4NUT A;  3J80 M;  3CC7 F;  5FLX M;  3IR9 A;  5EO3 A;  1VQM F;  1K8A H;  1VQN F;  1GO1 A;  1SDS A;  3FFM A;  3G6E F;  3CME F;  3LWP C;  3CPQ A;  5GIN C;  3I56 F;  1Q86 H;  1VQ4 F;  1E7K A;  3CCJ F;  3N4Z A;  3LFO A;  3CCE F;  1QVF F;  2OTJ F;  1VQ7 F;  1XBI A;  3RA5 A;  1K73 H;  1W3E X;  1ZWZ A;  3CCS F;  1KC8 H;  3CCU F;  3HJW C;  1RA4 A;  5GIP C;  5EWR A;  3CCM F;  2WAL A;  3V7Q A;  1YI2 F;  1YJN F;  3G71 F;  1VQ8 F;  3E20 B; 
#chains in the Genus database with same CATH topology
 3ZOP A;  1W42 A;  2LBT A;  3D54 A;  3K14 A;  1PF5 A;  4O4J B;  3LME A;  3ON1 A;  4LNU B;  3PAF A;  2LBX A;  2K1S A;  1JJ2 F;  1W5F A;  5JH7 A;  3RYC B;  1RLU A;  3DC2 A;  1H48 A;  1U3L A;  3D01 A;  3WGJ A;  3JAM M;  2I6D A;  3S03 A;  3R0P A;  2CHS A;  2B33 A;  2CZW A;  3E22 B;  3CCL F;  3JAT B;  2Z1F A;  4B45 A;  5EB0 A;  3HKD A;  1KQS F;  3HKE A;  5C8Y B;  1OFU A;  5HY1 A;  3IEW A;  2H8E A;  5KX5 B;  5MN5 A;  3WJQ A;  2UYK A;  4R40 B;  2HP0 B;  1Q8R A;  5GON B;  2L26 A;  1W40 A;  2OTM A;  3WXM B;  3C8L A;  5LA6 B;  5B8F A;  1W5A A;  5CA1 B;  4X20 A;  1QVG F;  1Z5V A;  4F6R B;  4NQ3 A;  3JVH A;  2CSL A;  4C8E A;  1OAP A;  3NVK E;  3KE1 A;  4YJ3 B;  3RA6 A;  5LYJ A;  2RHJ A;  4DRX B;  2H8C A;  3HTN A;  2HVY D;  3C9T A;  3JAW A;  1VQP F;  1YJ9 F;  4B5C A;  1IV2 A;  4BT5 A;  5JVD B;  5IJ0 B;  3K12 A;  2W8B C;  4G4X A;  3IMP A;  2KG4 A;  3WGN A;  3KHN A;  4FFB A;  3V4D A;  3N2K A;  3CG6 A;  3HKB A;  3O85 A;  3RYI A;  3TD5 A;  2VGN A;  5EYP B;  5FNV A;  3CCV F;  3JCM M;  5IYZ A;  4EB6 B;  4ZI7 A;  3VI6 A;  1UFY A;  4B46 A;  1S72 F;  2AIZ P;  5BMV A;  2CHT A;  4I50 A;  1QAH A;  4ZHY B;  3CYP B;  4BY9 D;  3J80 M;  1FNJ A;  2AMT A;  2I6R A;  1K8A H;  1GO1 A;  1JN1 A;  3G6E F;  4ZHQ B;  1FSZ A;  4YJ2 A;  3I56 F;  3N4Z A;  3S0Y A;  3ZP4 A;  5HY4 A;  3Q8H A;  1VQ7 F;  5J2T A;  4X1K A;  3CCU F;  2PHN A;  3WGK A;  1U3P A;  4EI8 A;  3HJW C;  1UI9 A;  4PWT A;  5GIP C;  5EWR A;  1TVK B;  3CCM F;  1W5E A;  1YI2 F;  4I4T A;  3VYT C;  3BYQ A;  1W41 A;  1DT9 A;  3JAL A;  1RLG A;  2FC3 A;  1TUB A;  1ODE A;  4ZHV A;  1R1M A;  4I55 B;  2HQS C;  1CK2 A;  3OBY A;  4HNA B;  3JAK B;  4O4J A;  3WPX A;  3NK7 A;  1X52 A;  4LNU A;  3ELC A;  3VOB A;  4TV8 B;  3OW2 F;  3D00 A;  4TZZ A;  4X1I A;  1SZQ A;  2RHL A;  3MCQ A;  3RYC A;  1U43 A;  2F9Z C;  1DBF A;  5IJ9 B;  1Q7Y H;  3SIV A;  4G4Z A;  5LOV B;  4BVQ A;  1X7O A;  5LP6 B;  1W55 A;  5IT9 M;  3E22 A;  2RHO A;  3JAT A;  2HS4 A;  2AIF A;  3QUW A;  2QEX F;  3SIU A;  5C8Y A;  3F0F A;  1VQV A;  5KX5 A;  2UYN B;  4U39 A;  2QI2 A;  3S0W A;  2HP0 A;  2KGW A;  2RB9 A;  5GON A;  1VQL F;  3I55 F;  3DDN A;  1NMU B;  5GAP K;  5HWE A;  1PXW A;  2VAM A;  3MCA B;  4C4W C;  4TUY B;  2DT4 A;  1W57 A;  5LA6 A;  2PMP A;  2R6R 1;  3VO8 A;  5CA1 A;  4F6R A;  5CA0 B;  3LDT A;  3OBW A;  5HP8 A;  5LXT A;  1IV3 A;  5EZY B;  4U3J B;  2Z01 A;  3VOA A;  1RQ7 A;  4O2B B;  1J7H A;  2NMU A;  1M90 H;  4O2A B;  1QU9 A;  3UT5 A;  1Q81 H;  3LWV C;  5IJ0 A;  4BW0 B;  1JFF B;  3VYU C;  2GZL A;  3MDO A;  4WBN A;  4IHJ B;  2Q1X A;  3J81 M;  3VMF B;  3E1Y A;  4EI9 A;  3VTI C;  1FNK A;  5EYP A;  5LP6 C;  4LCK A;  1W58 1;  1IV1 A;  1YHQ F;  4EB6 A;  2Z1U A;  3KJJ A;  5FLX M;  2ZF8 A;  5EO3 A;  1VQM F;  1VH8 A;  2GVI A;  3LWP C;  3CPQ A;  5GIN C;  2ZOD A;  1Q86 H;  1W59 A;  5HP7 A;  1QVF F;  5J2U B;  5EIB D;  3HKC B;  5MN4 A;  1XBI A;  1K73 H;  1W3E X;  4EI7 A;  1KC8 H;  1JY8 A;  4ZHQ A;  4XCQ A;  4BT4 A;  2R75 1;  3B6N A;  3LYB A;  2HRY A;  4ZHW A;  3MBM A;  4X1Y A;  3V3T A;  4B62 A;  3I3F A;  5EAZ A;  3ZP7 A;  4X20 B;  2VGM A;  4O4I B;  5MN6 A;  4C8G A;  5CB4 B;  1YIT F;  3F6M A;  5JCO C;  2RHH A;  2OZB A;  3CD6 F;  5FJ4 C;  3QHD A;  3V7E A;  3C9U A;  2CW4 A;  5HXZ A;  1VQK F;  2IQQ A;  1N8R H;  4I55 A;  1GZ0 A;  1YJW F;  1VQ6 F;  4HNA A;  1T0K B;  4C82 A;  3JAK A;  3WPW A;  3HKB B;  3ESJ A;  3OON A;  1VQ5 F;  2VAP A;  3CC2 F;  3NVI B;  4TV8 A;  1KD1 H;  4TV9 A;  5IYZ B;  2ALE A;  3C9R A;  2V9Y A;  3WGL A;  4ZOL B;  2JNB A;  3S06 A;  2OTL F;  2FGY A;  5ITZ B;  5KMG B;  5IJ9 A;  3IKF A;  3HAX D;  3FPI A;  3JAR A;  2LBW A;  2QA4 F;  5LP6 A;  2QTP A;  1CLI A;  4C8I A;  5A2Q M;  2HS0 A;  4BT3 A;  4ERH A;  3J7A R;  3S02 A;  2Q1Y A;  4G4W A;  3RE3 A;  2VXY A;  4YJ2 B;  3M84 A;  2UYN A;  1FFX B;  2P6Y A;  4O4H B;  4O4L B;  4X3M A;  4BT7 A;  1X25 A;  2UYJ A;  3IKE A;  2YXZ A;  1NQ3 A;  4NWO B;  4TUY A;  3TD4 A;  3GHZ A;  3N2G B;  2ZOV A;  1SA0 B;  4X3L A;  3L7Q A;  5HY2 A;  2LCA A;  3WJR A;  1YQN A;  3N4Y A;  1VQO F;  1YGY A;  2EWC A;  5AVM A;  5EZY A;  4IIJ B;  3LWO C;  1H47 A;  4U3J A;  4O2B A;  3K2X A;  4O2A A;  4RQO A;  3F0G A;  1W2B F;  2KTV A;  4NUT A;  5JQG B;  3CC7 F;  1JFF A;  3IR9 A;  3JAS B;  5JCO A;  4IHJ A;  3FFM A;  3CME F;  4YJ3 A;  4X1I B;  4DRX A;  4G4V A;  1E7K A;  3CCJ F;  4BVS A;  3CCE F;  2MQE A;  3P10 A;  3F0D A;  4BT2 A;  2OTJ F;  3RYH B;  4BVR A;  3RYF B;  3RA5 A;  5JVD A;  1ZWZ A;  3F0E A;  3P0Z A;  2H6L A;  1RA4 A;  2WAL A;  3V7Q A;  3K0T A;  4E6E A;  5J2U A;  1YJN F;  3G71 F;  3HKC A;  4C81 A;  3VIU A;  1VQ8 F;  5JH7 B;  5EIB C;  4DXD A;  1X7P A;  5GAN K;  3CCR F;  3CCQ F;  2IG8 A;  1H7M A;  3FD5 A;  3G4S F;  5EB1 B;  1YIJ F;  3CMA F;  3M4S A;  3TD3 A;  5DCV A;  3P4E A;  2ZAU A;  2OHW A;  1T0A A;  3FD6 A;  2BTU A;  2DYY A;  1QD9 A;  2BTQ B;  5GIO C;  3HKD B;  1COM A;  3HKE B;  4O4I A;  3NMU C;  3CPW F;  1IPA A;  1XV2 A;  5LXT B;  3MQW A;  2KTU A;  2BTO A;  5CB4 A;  3CXC F;  3FBA A;  3WJP A;  3UT5 B;  1XHO A;  2VAW A;  2UYP A;  1VK3 A;  1TVK A;  4WBN B;  5HXU A;  2Z1T A;  4BVT A;  1JD1 A;  5LYJ B;  3LWQ C;  3PLA C;  3S0H A;  5HY0 A;  3CB2 A;  3JAW B;  1KNK A;  4G4Y A;  4ZOL A;  3CC4 F;  5ITZ A;  5KMG A;  2CVL A;  4BT6 A;  3VYS C;  1M1K H;  1IV4 A;  3ZO8 A;  2YYE A;  4FFB B;  2G9I A;  3LWR C;  3N2K B;  3GTZ A;  2HX0 A;  2HS3 A;  2N48 A;  2UZH A;  3KJK A;  3RYI B;  5FNV B;  1U40 A;  3VCZ A;  2ZVZ A;  1GO0 A;  2ZVY A;  4ZI7 B;  2Z1E A;  3EOR A;  1Q82 H;  2BO1 A;  3GYQ A;  2HRU A;  3NK6 A;  5BMV B;  1CN7 A;  4I50 B;  1FFX A;  1K9M H;  3U0O A;  4O4H A;  4O4L A;  3CYQ A;  3WGM A;  4X1Y B;  5LOV A;  1VHA A;  3I7T A;  1NJI H;  1VQ9 F;  3AGK A;  1GX1 A;  5G4U C;  3N2G A;  1XRG A;  1W5B A;  2IAF A;  1SA0 A;  1ONI A;  2HP3 A;  3ERN A;  5G4V C;  3T80 A;  1Z5W A;  4IIJ A;  1VQN F;  4M8I A;  5J2T B;  3KIZ A;  4X1K B;  1SDS A;  2CWJ A;  1RQ2 A;  2GLZ A;  1KNJ A;  4RHA A;  4ZK7 A;  5JQG A;  1VQ4 F;  3IEQ A;  3C9S A;  3LFO A;  3JAS A;  5CA0 A;  3CCS F;  4TV9 B;  3M1X A;  4I4T B;  3JAL B;  1TUB B;  3QTY A;  4KWE A;  4G88 A;  3RYH A;  3HWU A;  3RYF A;  3E20 B;  3JAR B; 
#chains in the Genus database with same CATH homology
 1W42 A;  3V3T A;  1X7P A;  5GAN K;  3CCR F;  1W41 A;  3CCQ F;  3ON1 A;  3PAF A;  1H7M A;  1DT9 A;  2LBX A;  3G4S F;  1RLG A;  2FC3 A;  2VGM A;  1YIJ F;  3CMA F;  5DCV A;  1JJ2 F;  2OHW A;  1CK2 A;  3OBY A;  1YIT F;  3NK7 A;  1X52 A;  2OZB A;  3CD6 F;  5GIO C;  5FJ4 C;  3V7E A;  3JAM M;  2I6D A;  3D00 A;  3OW2 F;  5HXZ A;  1VQK F;  3NMU C;  4TZZ A;  3CPW F;  1N8R H;  1IPA A;  1GZ0 A;  2KTU A;  2CZW A;  3CCL F;  1YJW F;  1VQ6 F;  1T0K B;  2F9Z C;  3CXC F;  1Q7Y H;  3CC2 F;  1VQ5 F;  1KQS F;  3NVI B;  3SIV A;  1KD1 H;  5HY1 A;  4BVQ A;  1X7O A;  5IT9 M;  2ALE A;  2JNB A;  2AIF A;  5HXU A;  2OTL F;  2FGY A;  4BVT A;  2QEX F;  3HAX D;  3SIU A;  1W40 A;  3LWQ C;  2LBW A;  3PLA C;  5HY0 A;  2QA4 F;  3WXM B;  1QVG F;  2QI2 A;  5A2Q M;  3J7A R;  3CC4 F;  1VQL F;  4NQ3 A;  3I55 F;  1NMU B;  5GAP K;  3NVK E;  3RA6 A;  5HWE A;  1M1K H;  1PXW A;  3MCA B;  4C4W C;  2HVY D;  3LWR C;  1VQP F;  1YJ9 F;  4X3M A;  1GO0 A;  3OBW A;  2KG4 A;  1Q82 H;  2BO1 A;  3GYQ A;  3NK6 A;  1CN7 A;  1M90 H;  3CG6 A;  1K9M H;  3O85 A;  4X3L A;  1Q81 H;  2VGN A;  5HY2 A;  3CCV F;  3LWV C;  3JCM M;  3N4Y A;  4BW0 B;  3VI6 A;  1VQO F;  1NJI H;  1VQ9 F;  3LWO C;  3AGK A;  5G4U C;  1S72 F;  3J81 M;  3VMF B;  3E1Y A;  4EI9 A;  1W2B F;  4LCK A;  2KTV A;  4BY9 D;  1YHQ F;  5G4V C;  4NUT A;  3J80 M;  3CC7 F;  5FLX M;  3IR9 A;  5EO3 A;  1VQM F;  1K8A H;  1VQN F;  1GO1 A;  1SDS A;  3FFM A;  3G6E F;  3CME F;  3LWP C;  3CPQ A;  2GLZ A;  5GIN C;  3I56 F;  1Q86 H;  1VQ4 F;  1E7K A;  3CCJ F;  3N4Z A;  3LFO A;  4BVS A;  3CCE F;  1QVF F;  5HY4 A;  2OTJ F;  1VQ7 F;  4BVR A;  1XBI A;  3RA5 A;  1K73 H;  1W3E X;  1ZWZ A;  4EI7 A;  3CCS F;  1KC8 H;  3CCU F;  4EI8 A;  4XCQ A;  3HJW C;  1RA4 A;  5GIP C;  5EWR A;  3CCM F;  2WAL A;  3V7Q A;  1YI2 F;  1YJN F;  3G71 F;  1VQ8 F;  3E20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...