4C4WC

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
VRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 115
sequence length 115
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4c4wC00
4NUTA 3JCMM 5A2QM 1VQOF 4X3LA 1VQ8F 1CK2A 3ON1A 5GINC 2JNBA 4X3MA 1VQKF 3CCMF 3SIVA 4BW0B 1W41A 3MCAB 3CC2F 1SDSA 1VQPF 5G4UC 2FC3A 1GO1A 3LWQC 1VQMF 3CMAF 1YJWF 2HVYD 3VMFB 3LWVC 1W3EX 5GAPK 3N4ZA 3NK7A 3VI6A 1M1KH 3RA5A 3NVIB 3PAFA 2I6DA 1YIJF 1IPAA 4TZZA 3O85A 3G4SF 1VQ4F 1RLGA 1KQSF 1GO0A 3RA6A 3HJWC 1DT9A 1N8RH 2KTVA 1YITF 1VQ5F 1VQ6F 1X7PA 1KC8H 3LWPC 3CXCF 1W2BF 2OZBA 3LFOA 5GANK 1Q82H 2OTJF 1Q81H 5GIPC 2QI2A 3G71F 1E7KA 5G4VC 3HAXD 1S72F 3SIUA 3AGKA 1PXWA 3GYQA 1VQNF 3CCJF 2AIFA 2OTLF 1K9MH 3V7QA 3CCQF 3CC7F 1YJNF 1M90H 3WXMB 1RA4A 2BO1A 3CD6F 2LBWA 2KG4A 1X52A 3OBYA 1H7MA 1X7OA 2KTUA 1VQLF 3JAMM 1KD1H 1YHQF 2QA4F 5EWRA 1JJ2F 3OBWA 4BY9D 1QVFF 3NVKE 3E1YA 3CPWF 3CCVF 5IT9M 3J81M 2VGNA 3CCLF 1T0KB 2LBXA 3CG6A 3CC4F 1W42A 1QVGF 2QEXF 1NMUB 1YI2F 3CPQA 1VQ7F 5GIOC 1CN7A 3CCEF 1Q7YH 3CCRF 2CZWA 4LCKA 3J80M 3LWRC 3NK6A 1YJ9F 3CMEF 3I55F 3LWOC 1Q86H 1VQ9F 3N4YA 3G6EF 2ALEA 3CCUF 1K8AH 3E20B 3CCSF 3FFMA 1GZ0A 2OHWA 3V7EA 1W40A 5EO3A 1ZWZA 5FLXM 4C4WC 5DCVA 3I56F 5FJ4C 1NJIH 3OW2F 3PLAC 1K73H 3J7AR 1XBIA 2WALA 3NMUC 2VGMA 3IR9A
chains in the Genus database with same CATH superfamily
4O2AB 3JCMM 1VQ8F 1CK2A 3ZOPA 3CB2A 5GINC 2JNBA 3KIZA 1IV4A 4X3MA 5LYJA 4ZHQB 4BW0B 3RYIB 3SIVA 4R40B 1SDSA 3F0GA 2FC3A 1VQMF 2Z1FA 1YJWF 5LXTB 2HVYD 2DT4A 1W3EX 1W57A 2UYNA 2Z1EA 3GHZA 4ZI7A 3VCZA 1W5EA 5GONB 3WJPA 3JASA 1YIJF 3CYQA 3DDNA 4X20B 1H47A 5JVDB 5HY2A 2IAFA 2LBTA 3WGNA 2UZHA 1KQSF 4O2BA 4O4HB 3JAWA 1VQVA 2AMTA 2RHLA 1N8RH 2UYNB 1X7PA 4G4YA 4RQOA 3P10A 3LWPC 1JFFA 2ZAUA 2OZBA 3U0OA 4G88A 4LNUB 1Q82H 3S0WA 3F6MA 3F0FA 3IMPA 4O4JB 1PXWA 2L26A 4O4LA 2HS0A 3F0EA 3GYQA 4XCQA 3CYPB 3JAWB 5KX5A 3V7QA 3CCQF 1M90H 1RA4A 2YYEA 2F9ZC 2LBWA 1PF5A 1X7OA 4X1IB 4ERHA 1TVKB 4IHJB 1R1MA 3NVKE 2CSLA 2VAMA 3QTYA 4WBNA 5HWEA 4TUYA 5EYPA 3WGJA 3CCLF 5J2TB 1IV1A 3CC4F 1QVGF 2R6R1 3EORA 4X1KA 5IJ9A 5LA6A 2RB9A 3P0ZA 5EIBD 3LDTA 5LOVA 2HP0B 5GIOC 3CCEF 1JN1A 1TUBA 2CZWA 3J80M 4TUYB 1YJ9F 2ZVZA 5EYPB 2QTPA 4PWTA 3LMEA 3CMEF 3FBAA 3LWOC 3I55F 5HP7A 3JARB 3S06A 3UT5A 5EAZA 1VK3A 2ALEA 1U3PA 5IJ9B 4F6RB 3RYHA 3CCSF 1W59A 1W40A 3E22B 1ZWZA 3I56F 3F0DA 5FJ4C 3HKEB 3TD5A 3OW2F 3PLAC 3NMUC 3JAKA 2Z1UA 3HKCB 2R751 2H8EA 2I6RA 4HNAA 4BVQA 3VYUC 3UT5B 3K2XA 3CC2F 3RYCA 1COMA 5JCOA 4O2AA 3N4ZA 2HRUA 3NK7A 3VI6A 4ZHQA 3RYIA 1FFXB 5B8FA 3FD5A 3RA5A 3VTIC 3ZP4A 2I6DA 3JAKB 4NQ3A 2IG8A 5LXTA 1KNKA 3WPXA 1VQ4F 3GTZA 2W8BC 5GONA 2H8CA 1Q8RA 1W5FA 3RYCB 2ZF8A 1VH8A 5J2UB 4TV9B 5JVDA 5KMGB 4X1YB 3WGKA 1VQ6F 1W5AA 1KNJA 3R0PA 2N48A 4O4HA 3KJKA 3M1XA 3G71F 4ZK7A 5CA1A 4BVTA 4C8EA 5HXUA 1OAPA 3K0TA 5CA0B 4I50A 4LNUA 1W581 4B46A 3N2KB 1U3LA 2AIFA 1ONIA 1ODEA 1YJNF 3DC2A 3D00A 3WXMB 3C8LA 4O4JA 2BO1A 1W55A 3MQWA 2KG4A 4ZHVA 1VQLF 5IJ0B 4YJ2B 4BT4A 1YHQF 1XHOA 5EWRA 1JJ2F 5CA1B 2HX0A 1UI9A 3OBWA 1FNKA 5AVMA 1QVFF 4X1IA 3E1YA 4I50B 1TVKA 3CCVF 3LYBA 2CHTA 1JD1A 2VGNA 5FNVA 2CWJA 5HY0A 3BYQA 2Z01A 4EB6B 4IHJA 3TD3A 2Q1XA 1T0AA 1RQ2A 5MN4A 1QAHA 3CPQA 4KWEA 3VO8A 1OFUA 5J2TA 1VHAA 3OONA 3N2GB 1FNJA 1UFYA 5FNVB 2ZVYA 5LP6C 1VQ9F 2HP0A 3ZO8A 4M8IA 3WPWA 3CCUF 2IQQA 2VXYA 3HKBA 3FD6A 3VYSC 3S03A 1JY8A 4C81A 1GZ0A 3JARA 3V7EA 5DCVA 5FLXM 4EI7A 3JALB 3K14A 5JH7B 1NQ3A 2H6LA 4F6RA 3E22A 1SA0B 4NUTA 1VQOF 3HKEA 3ON1A 4BT7A 1W41A 3HKBB 2KGWA 1GO1A 2MQEA 3HKCA 3CMAF 2RHJA 1H48A 3RE3A 4U39A 2B33A 2DYYA 3NVIB 4C8IA 3JVHA 3PAFA 4FFBB 1IPAA 3K12A 3O85A 4ZOLA 3WJRA 3M84A 5IYZB 1FFXA 3D01A 2BTQB 3ERNA 3S0HA 3C9SA 5C8YA 5LP6B 3HJWC 1XV2A 1GX1A 1U43A 4O4IB 4TV8B 1IV2A 1DT9A 1Z5VA 2KTVA 3MDOA 5HP8A 1YITF 1KC8H 3CXCF 1CLIA 4C82A 5GANK 2OTJF 5J2UA 4TV9A 1Q81H 5KMGA 1E7KA 4X1YA 4ZOLB 2VAPA 2UYKA 1S72F 3S02A 3C9RA 4BVSA 1QU9A 1VQNF 3CCJF 5C8YB 1W5BA 2HQSC 3CC7F 1IV3A 2AIZP 3QUWA 1YQNA 3CD6F 3KJJA 3P4EA 3OBYA 1H7MA 5CA0A 3VIUA 3N2KA 3TD4A 2CHSA 3JAMM 1KD1H 3IKEA 3C9UA 1FSZA 5EZYB 4BY9D 2BTOA 3ZP7A 4C8GA 5CB4A 4B62A 2PHNA 3RYFB 4I4TB 3VOBA 3CPWF 5IT9M 5IJ0A 4YJ2A 2LBXA 3V4DA 3HKDA 2GLZA 2EWCA 1NMUB 2P6YA 1YI2F 3HWUA 2HRYA 4EB6A 1SZQA 4DRXA 1VQ7F 3S0YA 2UYJA 4B5CA 5CB4B 2BTUA 2Q1YA 3CCRF 4I55B 3NK6A 5HXZA 3IEWA 1DBFA 3M4SA 1Q86H 3D54A 3N4YA 3HKDB 2HP3A 3ESJA 3JATB 3N2GA 3V3TA 2VAWA 2CW4A 3FFMA 4DRXB 5EO3A 3C9TA 4C4WC 3WGLA 4BVRA 3Q8HA 4BT5A 2RHOA 4G4XA 2LCAA 5LYJB 3IEQA 4ZHYB 1XBIA 4EI8A 3IR9A 5A2QM 4NWOB 4X3LA 3MCQA 4EI9A 5BMVA 3JALA 4ZI7B 5JH7A 1VQKF 3CCMF 3MCAB 1VQPF 5G4UC 3JASB 3LWQC 1SA0A 4RHAA 5ITZA 3VMFB 3LWVC 5GAPK 3IKFA 2K1SA 2OTMA 1M1KH 2YXZA 4O2BB 5HY4A 5MN5A 2UYPA 5JQGA 3VOAA 4TZZA 3G4SF 2GZLA 3B6NA 5BMVB 1RLGA 1GO0A 1JFFB 4FFBA 3RA6A 4YJ3A 3WGMA 1RLUA 1XRGA 5ITZB 1J7HA 1VQ5F 2GVIA 3FPIA 5IYZA 3MBMA 4G4VA 1Z5WA 4O4LB 1W2BF 3LFOA 2FGYA 5LP6A 5JQGB 3WJQA 4O4IA 4BT2A 4TV8A 5GIPC 5KX5B 2QI2A 3HAXD 5G4VC 3KE1A 3VYTC 3AGKA 3SIUA 1RQ7A 3L7QA 5EB0A 1YGYA 4YJ3B 1K9MH 2OTLF 2G9IA 2ZOVA 1X52A 1U40A 5MN6A 3HTNA 4BT3A 2KTUA 4B45A 4U3JA 4WBNB 2RHHA 4ZHWA 2QA4F 4E6EA 5JCOC 1QD9A 4X1KB 2HS3A 3ELCA 5LA6B 3J81M 2HS4A 5LOVB 1T0KB 5EZYA 3QHDA 3CG6A 2ZODA 1W42A 2QEXF 3RYFA 5EIBC 4I4TA 1TUBB 3I7TA 4BT6A 4U3JB 4IIJA 4G4ZA 2V9YA 3KHNA 1CN7A 1Q7YH 4DXDA 5EB1B 4LCKA 3LWRC 4G4WA 3RYHB 3G6EF 2Z1TA 1K8AH 4I55A 3E20B 3T80A 2NMUA 4IIJB 2OHWA 3I3FA 1X25A 4HNAB 3JATA 2PMPA 2CVLA 1NJIH 1K73H 5HY1A 3J7AR 2WALA 2VGMA 4X20A
chains in the Genus database with same CATH topology
4NUTA 3JCMM 5A2QM 4BVQA 4X3LA 4EI9A 1VQOF 1CK2A 1VQ8F 3ON1A 5GINC 2JNBA 4X3MA 1VQKF 3CCMF 3SIVA 4BW0B 1W41A 3MCAB 3CC2F 1SDSA 1VQPF 5G4UC 2FC3A 1GO1A 3LWQC 1VQMF 3CMAF 1YJWF 2HVYD 3VMFB 3LWVC 1W3EX 5GAPK 3N4ZA 3NK7A 3VI6A 1M1KH 3RA5A 3NVIB 5HY4A 3PAFA 2I6DA 1YIJF 1IPAA 4NQ3A 3O85A 4TZZA 3G4SF 5HY2A 1VQ4F 1RLGA 1KQSF 1GO0A 3RA6A 3HJWC 1DT9A 1N8RH 2KTVA 1YITF 1VQ5F 1VQ6F 1X7PA 1KC8H 3LWPC 3CXCF 1W2BF 2OZBA 3LFOA 2FGYA 5GANK 1Q82H 2OTJF 1Q81H 5GIPC 2QI2A 3G71F 1E7KA 5G4VC 3HAXD 4BVTA 1S72F 3SIUA 3AGKA 1PXWA 5HXUA 3GYQA 4BVSA 4XCQA 1VQNF 3CCJF 2AIFA 2OTLF 1K9MH 3V7QA 3CCQF 3CC7F 1YJNF 3D00A 1M90H 3WXMB 1RA4A 2BO1A 3CD6F 2F9ZC 2KG4A 2LBWA 1X52A 3OBYA 1H7MA 1X7OA 2KTUA 1VQLF 3JAMM 1KD1H 1YHQF 2QA4F 5EWRA 1JJ2F 3OBWA 4BY9D 1QVFF 3NVKE 3E1YA 5HWEA 3CPWF 3CCVF 5IT9M 3J81M 2VGNA 5HY0A 3CCLF 1T0KB 2LBXA 3CG6A 3CC4F 1W42A 1QVGF 2QEXF 2GLZA 1NMUB 1YI2F 3CPQA 1VQ7F 5GIOC 1CN7A 3CCEF 1Q7YH 3CCRF 2CZWA 4LCKA 3J80M 3LWRC 3NK6A 1YJ9F 5HXZA 3CMEF 3I55F 3LWOC 1Q86H 1VQ9F 3N4YA 3G6EF 2ALEA 3CCUF 3V3TA 1K8AH 3E20B 3CCSF 3FFMA 1GZ0A 2OHWA 3V7EA 1W40A 5EO3A 1ZWZA 5FLXM 4C4WC 5DCVA 3I56F 4EI7A 5FJ4C 4BVRA 1NJIH 3OW2F 3PLAC 1K73H 5HY1A 3J7AR 1XBIA 2WALA 4EI8A 3NMUC 2VGMA 3IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUT A;  3JCM M;  5A2Q M;  1VQO F;  4X3L A;  1VQ8 F;  1CK2 A;  3ON1 A;  5GIN C;  2JNB A;  4X3M A;  1VQK F;  3CCM F;  3SIV A;  4BW0 B;  1W41 A;  3MCA B;  3CC2 F;  1SDS A;  1VQP F;  5G4U C;  2FC3 A;  1GO1 A;  3LWQ C;  1VQM F;  3CMA F;  1YJW F;  2HVY D;  3VMF B;  3LWV C;  1W3E X;  5GAP K;  3N4Z A;  3NK7 A;  3VI6 A;  1M1K H;  3RA5 A;  3NVI B;  3PAF A;  2I6D A;  1YIJ F;  1IPA A;  4TZZ A;  3O85 A;  3G4S F;  1VQ4 F;  1RLG A;  1KQS F;  1GO0 A;  3RA6 A;  3HJW C;  1DT9 A;  1N8R H;  2KTV A;  1YIT F;  1VQ5 F;  1VQ6 F;  1X7P A;  1KC8 H;  3LWP C;  3CXC F;  1W2B F;  2OZB A;  3LFO A;  5GAN K;  1Q82 H;  2OTJ F;  1Q81 H;  5GIP C;  2QI2 A;  3G71 F;  1E7K A;  5G4V C;  3HAX D;  1S72 F;  3SIU A;  3AGK A;  1PXW A;  3GYQ A;  1VQN F;  3CCJ F;  2AIF A;  2OTL F;  1K9M H;  3V7Q A;  3CCQ F;  3CC7 F;  1YJN F;  1M90 H;  3WXM B;  1RA4 A;  2BO1 A;  3CD6 F;  2LBW A;  2KG4 A;  1X52 A;  3OBY A;  1H7M A;  1X7O A;  2KTU A;  1VQL F;  3JAM M;  1KD1 H;  1YHQ F;  2QA4 F;  5EWR A;  1JJ2 F;  3OBW A;  4BY9 D;  1QVF F;  3NVK E;  3E1Y A;  3CPW F;  3CCV F;  5IT9 M;  3J81 M;  2VGN A;  3CCL F;  1T0K B;  2LBX A;  3CG6 A;  3CC4 F;  1W42 A;  1QVG F;  2QEX F;  1NMU B;  1YI2 F;  3CPQ A;  1VQ7 F;  5GIO C;  1CN7 A;  3CCE F;  1Q7Y H;  3CCR F;  2CZW A;  4LCK A;  3J80 M;  3LWR C;  3NK6 A;  1YJ9 F;  3CME F;  3I55 F;  3LWO C;  1Q86 H;  1VQ9 F;  3N4Y A;  3G6E F;  2ALE A;  3CCU F;  1K8A H;  3E20 B;  3CCS F;  3FFM A;  1GZ0 A;  2OHW A;  3V7E A;  1W40 A;  5EO3 A;  1ZWZ A;  5FLX M;  4C4W C;  5DCV A;  3I56 F;  5FJ4 C;  1NJI H;  3OW2 F;  3PLA C;  1K73 H;  3J7A R;  1XBI A;  2WAL A;  3NMU C;  2VGM A;  3IR9 A; 
#chains in the Genus database with same CATH topology
 4O2A B;  3JCM M;  1VQ8 F;  1CK2 A;  3ZOP A;  3CB2 A;  5GIN C;  2JNB A;  3KIZ A;  1IV4 A;  4X3M A;  5LYJ A;  4ZHQ B;  4BW0 B;  3RYI B;  3SIV A;  4R40 B;  1SDS A;  3F0G A;  2FC3 A;  1VQM F;  2Z1F A;  1YJW F;  5LXT B;  2HVY D;  2DT4 A;  1W3E X;  1W57 A;  2UYN A;  2Z1E A;  3GHZ A;  4ZI7 A;  3VCZ A;  1W5E A;  5GON B;  3WJP A;  3JAS A;  1YIJ F;  3CYQ A;  3DDN A;  4X20 B;  1H47 A;  5JVD B;  5HY2 A;  2IAF A;  2LBT A;  3WGN A;  2UZH A;  1KQS F;  4O2B A;  4O4H B;  3JAW A;  1VQV A;  2AMT A;  2RHL A;  1N8R H;  2UYN B;  1X7P A;  4G4Y A;  4RQO A;  3P10 A;  3LWP C;  1JFF A;  2ZAU A;  2OZB A;  3U0O A;  4G88 A;  4LNU B;  1Q82 H;  3S0W A;  3F6M A;  3F0F A;  3IMP A;  4O4J B;  1PXW A;  2L26 A;  4O4L A;  2HS0 A;  3F0E A;  3GYQ A;  4XCQ A;  3CYP B;  3JAW B;  5KX5 A;  3V7Q A;  3CCQ F;  1M90 H;  1RA4 A;  2YYE A;  2F9Z C;  2LBW A;  1PF5 A;  1X7O A;  4X1I B;  4ERH A;  1TVK B;  4IHJ B;  1R1M A;  3NVK E;  2CSL A;  2VAM A;  3QTY A;  4WBN A;  5HWE A;  4TUY A;  5EYP A;  3WGJ A;  3CCL F;  5J2T B;  1IV1 A;  3CC4 F;  1QVG F;  2R6R 1;  3EOR A;  4X1K A;  5IJ9 A;  5LA6 A;  2RB9 A;  3P0Z A;  5EIB D;  3LDT A;  5LOV A;  2HP0 B;  5GIO C;  3CCE F;  1JN1 A;  1TUB A;  2CZW A;  3J80 M;  4TUY B;  1YJ9 F;  2ZVZ A;  5EYP B;  2QTP A;  4PWT A;  3LME A;  3CME F;  3FBA A;  3LWO C;  3I55 F;  5HP7 A;  3JAR B;  3S06 A;  3UT5 A;  5EAZ A;  1VK3 A;  2ALE A;  1U3P A;  5IJ9 B;  4F6R B;  3RYH A;  3CCS F;  1W59 A;  1W40 A;  3E22 B;  1ZWZ A;  3I56 F;  3F0D A;  5FJ4 C;  3HKE B;  3TD5 A;  3OW2 F;  3PLA C;  3NMU C;  3JAK A;  2Z1U A;  3HKC B;  2R75 1;  2H8E A;  2I6R A;  4HNA A;  4BVQ A;  3VYU C;  3UT5 B;  3K2X A;  3CC2 F;  3RYC A;  1COM A;  5JCO A;  4O2A A;  3N4Z A;  2HRU A;  3NK7 A;  3VI6 A;  4ZHQ A;  3RYI A;  1FFX B;  5B8F A;  3FD5 A;  3RA5 A;  3VTI C;  3ZP4 A;  2I6D A;  3JAK B;  4NQ3 A;  2IG8 A;  5LXT A;  1KNK A;  3WPX A;  1VQ4 F;  3GTZ A;  2W8B C;  5GON A;  2H8C A;  1Q8R A;  1W5F A;  3RYC B;  2ZF8 A;  1VH8 A;  5J2U B;  4TV9 B;  5JVD A;  5KMG B;  4X1Y B;  3WGK A;  1VQ6 F;  1W5A A;  1KNJ A;  3R0P A;  2N48 A;  4O4H A;  3KJK A;  3M1X A;  3G71 F;  4ZK7 A;  5CA1 A;  4BVT A;  4C8E A;  5HXU A;  1OAP A;  3K0T A;  5CA0 B;  4I50 A;  4LNU A;  1W58 1;  4B46 A;  3N2K B;  1U3L A;  2AIF A;  1ONI A;  1ODE A;  1YJN F;  3DC2 A;  3D00 A;  3WXM B;  3C8L A;  4O4J A;  2BO1 A;  1W55 A;  3MQW A;  2KG4 A;  4ZHV A;  1VQL F;  5IJ0 B;  4YJ2 B;  4BT4 A;  1YHQ F;  1XHO A;  5EWR A;  1JJ2 F;  5CA1 B;  2HX0 A;  1UI9 A;  3OBW A;  1FNK A;  5AVM A;  1QVF F;  4X1I A;  3E1Y A;  4I50 B;  1TVK A;  3CCV F;  3LYB A;  2CHT A;  1JD1 A;  2VGN A;  5FNV A;  2CWJ A;  5HY0 A;  3BYQ A;  2Z01 A;  4EB6 B;  4IHJ A;  3TD3 A;  2Q1X A;  1T0A A;  1RQ2 A;  5MN4 A;  1QAH A;  3CPQ A;  4KWE A;  3VO8 A;  1OFU A;  5J2T A;  1VHA A;  3OON A;  3N2G B;  1FNJ A;  1UFY A;  5FNV B;  2ZVY A;  5LP6 C;  1VQ9 F;  2HP0 A;  3ZO8 A;  4M8I A;  3WPW A;  3CCU F;  2IQQ A;  2VXY A;  3HKB A;  3FD6 A;  3VYS C;  3S03 A;  1JY8 A;  4C81 A;  1GZ0 A;  3JAR A;  3V7E A;  5DCV A;  5FLX M;  4EI7 A;  3JAL B;  3K14 A;  5JH7 B;  1NQ3 A;  2H6L A;  4F6R A;  3E22 A;  1SA0 B;  4NUT A;  1VQO F;  3HKE A;  3ON1 A;  4BT7 A;  1W41 A;  3HKB B;  2KGW A;  1GO1 A;  2MQE A;  3HKC A;  3CMA F;  2RHJ A;  1H48 A;  3RE3 A;  4U39 A;  2B33 A;  2DYY A;  3NVI B;  4C8I A;  3JVH A;  3PAF A;  4FFB B;  1IPA A;  3K12 A;  3O85 A;  4ZOL A;  3WJR A;  3M84 A;  5IYZ B;  1FFX A;  3D01 A;  2BTQ B;  3ERN A;  3S0H A;  3C9S A;  5C8Y A;  5LP6 B;  3HJW C;  1XV2 A;  1GX1 A;  1U43 A;  4O4I B;  4TV8 B;  1IV2 A;  1DT9 A;  1Z5V A;  2KTV A;  3MDO A;  5HP8 A;  1YIT F;  1KC8 H;  3CXC F;  1CLI A;  4C82 A;  5GAN K;  2OTJ F;  5J2U A;  4TV9 A;  1Q81 H;  5KMG A;  1E7K A;  4X1Y A;  4ZOL B;  2VAP A;  2UYK A;  1S72 F;  3S02 A;  3C9R A;  4BVS A;  1QU9 A;  1VQN F;  3CCJ F;  5C8Y B;  1W5B A;  2HQS C;  3CC7 F;  1IV3 A;  2AIZ P;  3QUW A;  1YQN A;  3CD6 F;  3KJJ A;  3P4E A;  3OBY A;  1H7M A;  5CA0 A;  3VIU A;  3N2K A;  3TD4 A;  2CHS A;  3JAM M;  1KD1 H;  3IKE A;  3C9U A;  1FSZ A;  5EZY B;  4BY9 D;  2BTO A;  3ZP7 A;  4C8G A;  5CB4 A;  4B62 A;  2PHN A;  3RYF B;  4I4T B;  3VOB A;  3CPW F;  5IT9 M;  5IJ0 A;  4YJ2 A;  2LBX A;  3V4D A;  3HKD A;  2GLZ A;  2EWC A;  1NMU B;  2P6Y A;  1YI2 F;  3HWU A;  2HRY A;  4EB6 A;  1SZQ A;  4DRX A;  1VQ7 F;  3S0Y A;  2UYJ A;  4B5C A;  5CB4 B;  2BTU A;  2Q1Y A;  3CCR F;  4I55 B;  3NK6 A;  5HXZ A;  3IEW A;  1DBF A;  3M4S A;  1Q86 H;  3D54 A;  3N4Y A;  3HKD B;  2HP3 A;  3ESJ A;  3JAT B;  3N2G A;  3V3T A;  2VAW A;  2CW4 A;  3FFM A;  4DRX B;  5EO3 A;  3C9T A;  4C4W C;  3WGL A;  4BVR A;  3Q8H A;  4BT5 A;  2RHO A;  4G4X A;  2LCA A;  5LYJ B;  3IEQ A;  4ZHY B;  1XBI A;  4EI8 A;  3IR9 A;  5A2Q M;  4NWO B;  4X3L A;  3MCQ A;  4EI9 A;  5BMV A;  3JAL A;  4ZI7 B;  5JH7 A;  1VQK F;  3CCM F;  3MCA B;  1VQP F;  5G4U C;  3JAS B;  3LWQ C;  1SA0 A;  4RHA A;  5ITZ A;  3VMF B;  3LWV C;  5GAP K;  3IKF A;  2K1S A;  2OTM A;  1M1K H;  2YXZ A;  4O2B B;  5HY4 A;  5MN5 A;  2UYP A;  5JQG A;  3VOA A;  4TZZ A;  3G4S F;  2GZL A;  3B6N A;  5BMV B;  1RLG A;  1GO0 A;  1JFF B;  4FFB A;  3RA6 A;  4YJ3 A;  3WGM A;  1RLU A;  1XRG A;  5ITZ B;  1J7H A;  1VQ5 F;  2GVI A;  3FPI A;  5IYZ A;  3MBM A;  4G4V A;  1Z5W A;  4O4L B;  1W2B F;  3LFO A;  2FGY A;  5LP6 A;  5JQG B;  3WJQ A;  4O4I A;  4BT2 A;  4TV8 A;  5GIP C;  5KX5 B;  2QI2 A;  3HAX D;  5G4V C;  3KE1 A;  3VYT C;  3AGK A;  3SIU A;  1RQ7 A;  3L7Q A;  5EB0 A;  1YGY A;  4YJ3 B;  1K9M H;  2OTL F;  2G9I A;  2ZOV A;  1X52 A;  1U40 A;  5MN6 A;  3HTN A;  4BT3 A;  2KTU A;  4B45 A;  4U3J A;  4WBN B;  2RHH A;  4ZHW A;  2QA4 F;  4E6E A;  5JCO C;  1QD9 A;  4X1K B;  2HS3 A;  3ELC A;  5LA6 B;  3J81 M;  2HS4 A;  5LOV B;  1T0K B;  5EZY A;  3QHD A;  3CG6 A;  2ZOD A;  1W42 A;  2QEX F;  3RYF A;  5EIB C;  4I4T A;  1TUB B;  3I7T A;  4BT6 A;  4U3J B;  4IIJ A;  4G4Z A;  2V9Y A;  3KHN A;  1CN7 A;  1Q7Y H;  4DXD A;  5EB1 B;  4LCK A;  3LWR C;  4G4W A;  3RYH B;  3G6E F;  2Z1T A;  1K8A H;  4I55 A;  3E20 B;  3T80 A;  2NMU A;  4IIJ B;  2OHW A;  3I3F A;  1X25 A;  4HNA B;  3JAT A;  2PMP A;  2CVL A;  1NJI H;  1K73 H;  5HY1 A;  3J7A R;  2WAL A;  2VGM A;  4X20 A; 
#chains in the Genus database with same CATH homology
 4NUT A;  3JCM M;  5A2Q M;  4BVQ A;  4X3L A;  4EI9 A;  1VQO F;  1CK2 A;  1VQ8 F;  3ON1 A;  5GIN C;  2JNB A;  4X3M A;  1VQK F;  3CCM F;  3SIV A;  4BW0 B;  1W41 A;  3MCA B;  3CC2 F;  1SDS A;  1VQP F;  5G4U C;  2FC3 A;  1GO1 A;  3LWQ C;  1VQM F;  3CMA F;  1YJW F;  2HVY D;  3VMF B;  3LWV C;  1W3E X;  5GAP K;  3N4Z A;  3NK7 A;  3VI6 A;  1M1K H;  3RA5 A;  3NVI B;  5HY4 A;  3PAF A;  2I6D A;  1YIJ F;  1IPA A;  4NQ3 A;  3O85 A;  4TZZ A;  3G4S F;  5HY2 A;  1VQ4 F;  1RLG A;  1KQS F;  1GO0 A;  3RA6 A;  3HJW C;  1DT9 A;  1N8R H;  2KTV A;  1YIT F;  1VQ5 F;  1VQ6 F;  1X7P A;  1KC8 H;  3LWP C;  3CXC F;  1W2B F;  2OZB A;  3LFO A;  2FGY A;  5GAN K;  1Q82 H;  2OTJ F;  1Q81 H;  5GIP C;  2QI2 A;  3G71 F;  1E7K A;  5G4V C;  3HAX D;  4BVT A;  1S72 F;  3SIU A;  3AGK A;  1PXW A;  5HXU A;  3GYQ A;  4BVS A;  4XCQ A;  1VQN F;  3CCJ F;  2AIF A;  2OTL F;  1K9M H;  3V7Q A;  3CCQ F;  3CC7 F;  1YJN F;  3D00 A;  1M90 H;  3WXM B;  1RA4 A;  2BO1 A;  3CD6 F;  2F9Z C;  2KG4 A;  2LBW A;  1X52 A;  3OBY A;  1H7M A;  1X7O A;  2KTU A;  1VQL F;  3JAM M;  1KD1 H;  1YHQ F;  2QA4 F;  5EWR A;  1JJ2 F;  3OBW A;  4BY9 D;  1QVF F;  3NVK E;  3E1Y A;  5HWE A;  3CPW F;  3CCV F;  5IT9 M;  3J81 M;  2VGN A;  5HY0 A;  3CCL F;  1T0K B;  2LBX A;  3CG6 A;  3CC4 F;  1W42 A;  1QVG F;  2QEX F;  2GLZ A;  1NMU B;  1YI2 F;  3CPQ A;  1VQ7 F;  5GIO C;  1CN7 A;  3CCE F;  1Q7Y H;  3CCR F;  2CZW A;  4LCK A;  3J80 M;  3LWR C;  3NK6 A;  1YJ9 F;  5HXZ A;  3CME F;  3I55 F;  3LWO C;  1Q86 H;  1VQ9 F;  3N4Y A;  3G6E F;  2ALE A;  3CCU F;  3V3T A;  1K8A H;  3E20 B;  3CCS F;  3FFM A;  1GZ0 A;  2OHW A;  3V7E A;  1W40 A;  5EO3 A;  1ZWZ A;  5FLX M;  4C4W C;  5DCV A;  3I56 F;  4EI7 A;  5FJ4 C;  4BVR A;  1NJI H;  3OW2 F;  3PLA C;  1K73 H;  5HY1 A;  3J7A R;  1XBI A;  2WAL A;  4EI8 A;  3NMU C;  2VGM A;  3IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...