4C4WC

Structure of a rare, non-standard sequence k-turn bound by l7ae protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
VRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Structure of a Rare, Non-Standard Sequence K-Turn Bound by L7Ae Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 35
structure length 115
sequence length 115
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4c4wC00
2HVYD 3CCLF 3V7EA 1YHQF 1VQPF 1W42A 3NK6A 2KG4A 3CCMF 1PXWA 2WALA 3CCRF 3RA5A 1W40A 1JJ2F 3CPQA 3LWOC 1Q86H 3CCVF 3LWPC 5GINC 1DT9A 1NMUB 3LWQC 3JCMM 1VQ8F 1IPAA 1VQ4F 3CD6F 1VQ9F 1W41A 1QVFF 1YJWF 5DCVA 3CCUF 1Q7YH 2ALEA 1Q82H 4BW0B 3VI6A 3CPWF 3SIVA 2KTUA 2LBWA 4C4WC 5G4UC 3VMFB 1XBIA 1NJIH 3E1YA 3G71F 1RA4A 2I6DA 3OBWA 3ON1A 3AGKA 3NVKE 2QI2A 1GZ0A 5GAPK 5EWRA 2JNBA 3N4YA 2QEXF 4X3MA 3CC4F 1M1KH 1H7MA 1RLGA 1K73H 3OW2F 1W2BF 1YI2F 1VQ6F 1YIJF 3WXMB 1VQOF 2BO1A 3PAFA 3CCSF 3E20B 1VQ5F 3I56F 3HJWC 2AIFA 3NK7A 1VQLF 5EO3A 3GYQA 1YJ9F 3CCQF 3CG6A 3CMAF 4NUTA 4TZZA 2VGNA 3LWRC 3I55F 3J7AR 2OTLF 5GIOC 3FFMA 2LBXA 1KC8H 3CC2F 5GIPC 1K9MH 1GO1A 3JAMM 1E7KA 3HAXD 1CN7A 3OBYA 1VQNF 1CK2A 2QA4F 5GANK 1YJNF 1K8AH 2VGMA 3RA6A 1X7OA 3CMEF 2KTVA 1KQSF 3CCJF 1VQMF 1ZWZA 1QVGF 1SDSA 1T0KB 1N8RH 3MCAB 1M90H 1KD1H 1X7PA 3J80M 3SIUA 3J81M 5A2QM 1VQKF 1W3EX 3NMUC 2FC3A 1S72F 5FLXM 4LCKA 1VQ7F 3V7QA 2OTJF 5G4VC 4BY9D 3CC7F 2OZBA 1X52A 3CCEF 3NVIB 3O85A 3G4SF 3G6EF 3CXCF 3LWVC 1YITF 5FJ4C 3N4ZA 3IR9A 1Q81H 3LFOA 3PLAC 4X3LA 2CZWA 2OHWA 5IT9M 1GO0A
chains in the Genus database with same CATH superfamily
3V7EA 5EAZA 3CCLF 3RYHA 1YHQF 3GTZA 1U40A 3VIUA 3E22A 3RE3A 5GONB 3IEWA 1IV2A 3CD6F 2Z1EA 4RQOA 3JCMM 1VQ4F 5JH7B 1SA0A 4O4LA 1YJWF 3D54A 4X20B 5EYPB 4BW0B 2UYKA 5LYJA 3SIVA 4DRXA 3IEQA 4C4WC 3JAWB 3K0TA 3VTIC 3WPXA 3G71F 3DDNA 4I55B 2I6DA 4ZI7B 5CB4A 3AGKA 1U43A 3RYFB 1GZ0A 3FPIA 5KMGA 4TV8A 4ZK7A 2PHNA 2DYYA 5CA0B 3RYCA 5LP6B 3CYPB 1M1KH 5JVDA 2RHJA 1RLGA 2BTOA 4ZHWA 3U0OA 1YI2F 1VQ6F 3WXMB 1Z5WA 3I3FA 3CCSF 2HX0A 1U3LA 2DT4A 2AIFA 2RB9A 4XCQA 2L26A 5EO3A 2UYJA 5LA6B 3WGJA 1YJ9F 3C9RA 1VHAA 4ZOLB 2H6LA 1W5AA 2P6YA 2IG8A 4X20A 5EYPA 3J7AR 2OTLF 3VO8A 1CN7A 3S0YA 5C8YA 3ERNA 1GX1A 3HKEB 1K8AH 1TUBA 3IKEA 4FFBB 2CW4A 4EI9A 3KE1A 5MN6A 1VQMF 1QVGF 1SDSA 4U3JA 4R40B 3HKBB 3JALB 1VQKF 1XHOA 4I4TA 3F6MA 4C8IA 2HS3A 5IJ9B 2OTMA 4BY9D 1X52A 1JY8A 3F0DA 1KNJA 4HNAB 2VAWA 3VOAA 5LA6A 2CHSA 3KJKA 3P4EA 4X1YB 4ZOLA 1RLUA 3PLAC 5IT9M 5CA1B 1GO0A 2HVYD 5HWEA 1W42A 3VOBA 2RHHA 3RYIB 4BT5A 1YQNA 3CCRF 1RQ2A 4B5CA 2Z1FA 3LWOC 1UI9A 1Q86H 3LWPC 4C81A 1DT9A 1JN1A 3OONA 4C8EA 4FFBA 3LWQC 2AMTA 1H48A 1VQ9F 5LP6C 5DCVA 5FNVB 4O4IB 3WGLA 2Z01A 4ERHA 2HP0A 3VI6A 1TVKB 3HKDB 2KTUA 5KX5A 1XBIA 3B6NA 4F6RB 5G4UC 3JALA 5HY4A 1NJIH 1NQ3A 5EIBD 2Z1UA 2GVIA 3JARB 1X25A 5AVMA 3WGKA 1UFYA 2R751 1YGYA 3N4YA 3P10A 3IKFA 2RHOA 2HRUA 4X1YA 5IYZA 5CA1A 1K73H 2BTUA 2H8EA 3L7QA 1XV2A 3EORA 3OW2F 4WBNB 1W2BF 4YJ2B 2HRYA 2BO1A 4O4JB 1DBFA 4LNUB 4G4WA 1IV4A 3NK7A 2UYPA 3C8LA 1VQLF 2VAPA 4NUTA 5FNVA 4TZZA 1JFFB 2HS4A 4O4IA 4C8GA 3LWRC 3JAKA 5GIOC 1OFUA 4IHJB 2V9YA 1TVKA 5GIPC 1K9MH 3HKDA 1GO1A 3JAMM 1VQVA 1U3PA 1YJNF 3C9TA 3MCQA 2PMPA 5EIBC 2ZAUA 3JARA 3S02A 5LOVB 2ZVYA 3CCJF 4NQ3A 2H8CA 5EZYB 1T0KB 5GONA 4BT6A 2K1SA 2NMUA 5JCOA 5JH7A 1X7PA 5LXTB 3J80M 3J81M 1QAHA 4O2AB 3NMUC 4WBNA 3GHZA 3K12A 4YJ2A 4G4YA 5G4VC 4O4JA 4LNUA 2CWJA 3JAWA 4I50B 4U39A 3NVIB 3UT5B 4I55A 5IJ0B 5FJ4C 3N4ZA 3IR9A 4EI8A 1QU9A 1Q81H 4ZI7A 3TD5A 3RYFA 4IHJA 5HY0A 3FBAA 3S0WA 1J7HA 3NK6A 5CA0A 2KG4A 5LP6A 1PXWA 4X1IB 5J2UB 1JJ2F 3CPQA 3D00A 2CSLA 5GINC 3WJRA 3WGNA 3CB2A 5LOVA 3WJPA 4EI7A 5JCOC 5HY1A 3CCUF 2YXZA 1W5FA 1Q7YH 4TV9B 5EZYA 3V4DA 2ZF8A 3F0GA 1VH8A 2LBWA 3P0ZA 3VMFB 3M1XA 5LXTA 4X1KB 2HP3A 4O2AA 4ZHYB 1RA4A 2VXYA 3MBMA 3V3TA 3WJQA 1OAPA 2ZOVA 4ZHVA 3N2KB 2LCAA 4B46A 3D01A 4O4HB 4I50A 1IV3A 3HKEA 5JQGB 2QEXF 3CC4F 4M8IA 1T0AA 3VYTC 3M84A 1FFXB 2CVLA 3LMEA 1W581 1VQOF 3HKBA 3QHDA 3R0PA 1H47A 1VQ5F 3HJWC 5LYJB 2UYNB 4DRXB 1FSZA 3C9SA 4IIJB 3CCQF 4BT7A 3I55F 2N48A 5IJ9A 2ZVZA 3FFMA 3JATB 2LBXA 4HNAA 5HP7A 5CB4B 2MQEA 5BMVB 3VCZA 3HAXD 5KMGB 1ONIA 2AIZP 4TV8B 4X1KA 1COMA 3I7TA 1Z5VA 2VGMA 3RYCB 1XRGA 3HKCB 1X7OA 5JVDB 3RYIA 3JVHA 4PWTA 5B8FA 2GLZA 5HXZA 5J2TB 3CMEF 4BVRA 4NWOB 1KQSF 4O4HA 3Q8HA 2HS0A 5EB0A 5JQGA 3C9UA 2CHTA 3MCAB 1M90H 1KD1H 1W57A 3KIZA 2ZODA 1FFXA 3ZP7A 2FC3A 3S0HA 1W59A 5FLXM 1KNKA 2YYEA 2F9ZC 4F6RA 3CCEF 3O85A 3G4SF 4EB6B 1R1MA 2UYNA 3CXCF 3LWVC 3JASB 4G88A 5C8YB 4IIJA 3N2GB 4X3LA 2CZWA 5EB1B 2RHLA 2FGYA 1TUBB 3JATA 4O2BB 5ITZB 2IQQA 1VQPF 3M4SA 2KGWA 5BMVA 3CCMF 2WALA 3RA5A 1W40A 3QTYA 3CCVF 4G4ZA 4U3JB 1NMUB 3HKCA 1VQ8F 4YJ3B 1IPAA 4BVSA 1W41A 3WPWA 3TD4A 5J2TA 1QVFF 3KJJA 4I4TB 2ALEA 1Q82H 3ZO8A 3ZP4A 1PF5A 3CPWF 5MN5A 4G4VA 5HXUA 3E1YA 3HTNA 1JFFA 3BYQA 3KHNA 1CLIA 3ESJA 1ODEA 3OBWA 3ON1A 3S03A 3NVKE 2QI2A 4E6EA 5GAPK 4BT2A 4TUYB 2EWCA 5EWRA 2JNBA 5HY2A 4EB6A 4KWEA 3JASA 4X3MA 1W5EA 3N2GA 1H7MA 1JD1A 2G9IA 3FD5A 1W55A 2R6R1 4O2BA 3S06A 5ITZA 4B45A 2IAFA 1YIJF 2UZHA 3K14A 3F0FA 3PAFA 3WGMA 3ZOPA 3E20B 2HP0B 3I56F 2BTQB 5MN4A 2GZLA 4YJ3A 3GYQA 2LBTA 5KX5B 1RQ7A 4ZHQB 3CG6A 3CMAF 2VAMA 3DC2A 2VGNA 1Q8RA 2QTPA 2I6RA 5HP8A 3RYHB 1KC8H 3CC2F 3UT5A 2W8BC 1QD9A 5IJ0A 4RHAA 1E7KA 3OBYA 1VQNF 3E22B 1CK2A 2QA4F 4G4XA 1VK3A 5GANK 3T80A 3RA6A 4BT3A 1SA0B 5IYZB 1FNKA 4O4LB 3VYUC 2KTVA 4X1IA 5J2UA 1ZWZA 4TUYA 4C82A 1N8RH 2B33A 3VYSC 3MDOA 4BVQA 3ELCA 3F0EA 2Z1TA 3LYBA 2Q1XA 2Q1YA 3SIUA 3MQWA 2HQSC 5A2QM 1W5BA 3CYQA 3FD6A 1W3EX 4TV9A 1S72F 3QUWA 4LCKA 3TD3A 1VQ7F 3V7QA 1IV1A 2OTJF 2OZBA 3CC7F 3JAKB 4DXDA 3IMPA 3G6EF 3LDTA 1FNJA 1YITF 3HWUA 4BVTA 4ZHQA 1SZQA 3K2XA 3LFOA 2OHWA 4B62A 3N2KA 4BT4A
chains in the Genus database with same CATH topology
2HVYD 3CCLF 3V7EA 5HWEA 5HY0A 1YHQF 1VQPF 1W42A 3NK6A 2KG4A 3CCMF 1PXWA 2WALA 3CCRF 3RA5A 1W40A 1JJ2F 3CPQA 3D00A 3LWOC 1Q86H 3CCVF 3LWPC 5GINC 1DT9A 1NMUB 3LWQC 3JCMM 1VQ8F 1IPAA 1VQ4F 3CD6F 4BVSA 1VQ9F 1W41A 1QVFF 4EI7A 1YJWF 5DCVA 5HY1A 3CCUF 1Q7YH 2ALEA 1Q82H 4BW0B 3VI6A 3CPWF 3SIVA 2KTUA 2LBWA 5HXUA 4C4WC 5G4UC 3VMFB 1XBIA 5HY4A 1NJIH 3E1YA 3G71F 1RA4A 2I6DA 3OBWA 3ON1A 3V3TA 3AGKA 3NVKE 2QI2A 1GZ0A 5GAPK 5EWRA 2JNBA 5HY2A 3N4YA 2QEXF 4X3MA 3CC4F 1M1KH 1H7MA 1RLGA 1K73H 3OW2F 1W2BF 1YI2F 1VQ6F 1YIJF 3WXMB 1VQOF 2BO1A 3PAFA 3CCSF 3E20B 1VQ5F 3I56F 3HJWC 2AIFA 3NK7A 1VQLF 4XCQA 5EO3A 3GYQA 1YJ9F 3CCQF 3CG6A 3CMAF 4NUTA 4TZZA 2VGNA 3LWRC 3I55F 3J7AR 2OTLF 5GIOC 3FFMA 2LBXA 1KC8H 3CC2F 5GIPC 1K9MH 1GO1A 3JAMM 1E7KA 3HAXD 1CN7A 3OBYA 1VQNF 1CK2A 2QA4F 5GANK 1YJNF 1K8AH 2VGMA 3RA6A 1X7OA 4EI9A 3CMEF 2GLZA 5HXZA 2KTVA 4BVRA 3CCJF 1KQSF 4NQ3A 1VQMF 1ZWZA 1QVGF 1SDSA 1T0KB 1N8RH 4BVQA 3MCAB 1M90H 1KD1H 1X7PA 3J80M 3SIUA 3J81M 5A2QM 1VQKF 1W3EX 3NMUC 2FC3A 1S72F 5FLXM 4LCKA 1VQ7F 3V7QA 2OTJF 2F9ZC 5G4VC 4BY9D 3CC7F 2OZBA 1X52A 3CCEF 3NVIB 3O85A 3G4SF 3G6EF 3CXCF 3LWVC 1YITF 5FJ4C 3N4ZA 3IR9A 4EI8A 1Q81H 4BVTA 3LFOA 3PLAC 4X3LA 2CZWA 2OHWA 5IT9M 1GO0A 2FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVY D;  3CCL F;  3V7E A;  1YHQ F;  1VQP F;  1W42 A;  3NK6 A;  2KG4 A;  3CCM F;  1PXW A;  2WAL A;  3CCR F;  3RA5 A;  1W40 A;  1JJ2 F;  3CPQ A;  3LWO C;  1Q86 H;  3CCV F;  3LWP C;  5GIN C;  1DT9 A;  1NMU B;  3LWQ C;  3JCM M;  1VQ8 F;  1IPA A;  1VQ4 F;  3CD6 F;  1VQ9 F;  1W41 A;  1QVF F;  1YJW F;  5DCV A;  3CCU F;  1Q7Y H;  2ALE A;  1Q82 H;  4BW0 B;  3VI6 A;  3CPW F;  3SIV A;  2KTU A;  2LBW A;  4C4W C;  5G4U C;  3VMF B;  1XBI A;  1NJI H;  3E1Y A;  3G71 F;  1RA4 A;  2I6D A;  3OBW A;  3ON1 A;  3AGK A;  3NVK E;  2QI2 A;  1GZ0 A;  5GAP K;  5EWR A;  2JNB A;  3N4Y A;  2QEX F;  4X3M A;  3CC4 F;  1M1K H;  1H7M A;  1RLG A;  1K73 H;  3OW2 F;  1W2B F;  1YI2 F;  1VQ6 F;  1YIJ F;  3WXM B;  1VQO F;  2BO1 A;  3PAF A;  3CCS F;  3E20 B;  1VQ5 F;  3I56 F;  3HJW C;  2AIF A;  3NK7 A;  1VQL F;  5EO3 A;  3GYQ A;  1YJ9 F;  3CCQ F;  3CG6 A;  3CMA F;  4NUT A;  4TZZ A;  2VGN A;  3LWR C;  3I55 F;  3J7A R;  2OTL F;  5GIO C;  3FFM A;  2LBX A;  1KC8 H;  3CC2 F;  5GIP C;  1K9M H;  1GO1 A;  3JAM M;  1E7K A;  3HAX D;  1CN7 A;  3OBY A;  1VQN F;  1CK2 A;  2QA4 F;  5GAN K;  1YJN F;  1K8A H;  2VGM A;  3RA6 A;  1X7O A;  3CME F;  2KTV A;  1KQS F;  3CCJ F;  1VQM F;  1ZWZ A;  1QVG F;  1SDS A;  1T0K B;  1N8R H;  3MCA B;  1M90 H;  1KD1 H;  1X7P A;  3J80 M;  3SIU A;  3J81 M;  5A2Q M;  1VQK F;  1W3E X;  3NMU C;  2FC3 A;  1S72 F;  5FLX M;  4LCK A;  1VQ7 F;  3V7Q A;  2OTJ F;  5G4V C;  4BY9 D;  3CC7 F;  2OZB A;  1X52 A;  3CCE F;  3NVI B;  3O85 A;  3G4S F;  3G6E F;  3CXC F;  3LWV C;  1YIT F;  5FJ4 C;  3N4Z A;  3IR9 A;  1Q81 H;  3LFO A;  3PLA C;  4X3L A;  2CZW A;  2OHW A;  5IT9 M;  1GO0 A; 
#chains in the Genus database with same CATH topology
 3V7E A;  5EAZ A;  3CCL F;  3RYH A;  1YHQ F;  3GTZ A;  1U40 A;  3VIU A;  3E22 A;  3RE3 A;  5GON B;  3IEW A;  1IV2 A;  3CD6 F;  2Z1E A;  4RQO A;  3JCM M;  1VQ4 F;  5JH7 B;  1SA0 A;  4O4L A;  1YJW F;  3D54 A;  4X20 B;  5EYP B;  4BW0 B;  2UYK A;  5LYJ A;  3SIV A;  4DRX A;  3IEQ A;  4C4W C;  3JAW B;  3K0T A;  3VTI C;  3WPX A;  3G71 F;  3DDN A;  4I55 B;  2I6D A;  4ZI7 B;  5CB4 A;  3AGK A;  1U43 A;  3RYF B;  1GZ0 A;  3FPI A;  5KMG A;  4TV8 A;  4ZK7 A;  2PHN A;  2DYY A;  5CA0 B;  3RYC A;  5LP6 B;  3CYP B;  1M1K H;  5JVD A;  2RHJ A;  1RLG A;  2BTO A;  4ZHW A;  3U0O A;  1YI2 F;  1VQ6 F;  3WXM B;  1Z5W A;  3I3F A;  3CCS F;  2HX0 A;  1U3L A;  2DT4 A;  2AIF A;  2RB9 A;  4XCQ A;  2L26 A;  5EO3 A;  2UYJ A;  5LA6 B;  3WGJ A;  1YJ9 F;  3C9R A;  1VHA A;  4ZOL B;  2H6L A;  1W5A A;  2P6Y A;  2IG8 A;  4X20 A;  5EYP A;  3J7A R;  2OTL F;  3VO8 A;  1CN7 A;  3S0Y A;  5C8Y A;  3ERN A;  1GX1 A;  3HKE B;  1K8A H;  1TUB A;  3IKE A;  4FFB B;  2CW4 A;  4EI9 A;  3KE1 A;  5MN6 A;  1VQM F;  1QVG F;  1SDS A;  4U3J A;  4R40 B;  3HKB B;  3JAL B;  1VQK F;  1XHO A;  4I4T A;  3F6M A;  4C8I A;  2HS3 A;  5IJ9 B;  2OTM A;  4BY9 D;  1X52 A;  1JY8 A;  3F0D A;  1KNJ A;  4HNA B;  2VAW A;  3VOA A;  5LA6 A;  2CHS A;  3KJK A;  3P4E A;  4X1Y B;  4ZOL A;  1RLU A;  3PLA C;  5IT9 M;  5CA1 B;  1GO0 A;  2HVY D;  5HWE A;  1W42 A;  3VOB A;  2RHH A;  3RYI B;  4BT5 A;  1YQN A;  3CCR F;  1RQ2 A;  4B5C A;  2Z1F A;  3LWO C;  1UI9 A;  1Q86 H;  3LWP C;  4C81 A;  1DT9 A;  1JN1 A;  3OON A;  4C8E A;  4FFB A;  3LWQ C;  2AMT A;  1H48 A;  1VQ9 F;  5LP6 C;  5DCV A;  5FNV B;  4O4I B;  3WGL A;  2Z01 A;  4ERH A;  2HP0 A;  3VI6 A;  1TVK B;  3HKD B;  2KTU A;  5KX5 A;  1XBI A;  3B6N A;  4F6R B;  5G4U C;  3JAL A;  5HY4 A;  1NJI H;  1NQ3 A;  5EIB D;  2Z1U A;  2GVI A;  3JAR B;  1X25 A;  5AVM A;  3WGK A;  1UFY A;  2R75 1;  1YGY A;  3N4Y A;  3P10 A;  3IKF A;  2RHO A;  2HRU A;  4X1Y A;  5IYZ A;  5CA1 A;  1K73 H;  2BTU A;  2H8E A;  3L7Q A;  1XV2 A;  3EOR A;  3OW2 F;  4WBN B;  1W2B F;  4YJ2 B;  2HRY A;  2BO1 A;  4O4J B;  1DBF A;  4LNU B;  4G4W A;  1IV4 A;  3NK7 A;  2UYP A;  3C8L A;  1VQL F;  2VAP A;  4NUT A;  5FNV A;  4TZZ A;  1JFF B;  2HS4 A;  4O4I A;  4C8G A;  3LWR C;  3JAK A;  5GIO C;  1OFU A;  4IHJ B;  2V9Y A;  1TVK A;  5GIP C;  1K9M H;  3HKD A;  1GO1 A;  3JAM M;  1VQV A;  1U3P A;  1YJN F;  3C9T A;  3MCQ A;  2PMP A;  5EIB C;  2ZAU A;  3JAR A;  3S02 A;  5LOV B;  2ZVY A;  3CCJ F;  4NQ3 A;  2H8C A;  5EZY B;  1T0K B;  5GON A;  4BT6 A;  2K1S A;  2NMU A;  5JCO A;  5JH7 A;  1X7P A;  5LXT B;  3J80 M;  3J81 M;  1QAH A;  4O2A B;  3NMU C;  4WBN A;  3GHZ A;  3K12 A;  4YJ2 A;  4G4Y A;  5G4V C;  4O4J A;  4LNU A;  2CWJ A;  3JAW A;  4I50 B;  4U39 A;  3NVI B;  3UT5 B;  4I55 A;  5IJ0 B;  5FJ4 C;  3N4Z A;  3IR9 A;  4EI8 A;  1QU9 A;  1Q81 H;  4ZI7 A;  3TD5 A;  3RYF A;  4IHJ A;  5HY0 A;  3FBA A;  3S0W A;  1J7H A;  3NK6 A;  5CA0 A;  2KG4 A;  5LP6 A;  1PXW A;  4X1I B;  5J2U B;  1JJ2 F;  3CPQ A;  3D00 A;  2CSL A;  5GIN C;  3WJR A;  3WGN A;  3CB2 A;  5LOV A;  3WJP A;  4EI7 A;  5JCO C;  5HY1 A;  3CCU F;  2YXZ A;  1W5F A;  1Q7Y H;  4TV9 B;  5EZY A;  3V4D A;  2ZF8 A;  3F0G A;  1VH8 A;  2LBW A;  3P0Z A;  3VMF B;  3M1X A;  5LXT A;  4X1K B;  2HP3 A;  4O2A A;  4ZHY B;  1RA4 A;  2VXY A;  3MBM A;  3V3T A;  3WJQ A;  1OAP A;  2ZOV A;  4ZHV A;  3N2K B;  2LCA A;  4B46 A;  3D01 A;  4O4H B;  4I50 A;  1IV3 A;  3HKE A;  5JQG B;  2QEX F;  3CC4 F;  4M8I A;  1T0A A;  3VYT C;  3M84 A;  1FFX B;  2CVL A;  3LME A;  1W58 1;  1VQO F;  3HKB A;  3QHD A;  3R0P A;  1H47 A;  1VQ5 F;  3HJW C;  5LYJ B;  2UYN B;  4DRX B;  1FSZ A;  3C9S A;  4IIJ B;  3CCQ F;  4BT7 A;  3I55 F;  2N48 A;  5IJ9 A;  2ZVZ A;  3FFM A;  3JAT B;  2LBX A;  4HNA A;  5HP7 A;  5CB4 B;  2MQE A;  5BMV B;  3VCZ A;  3HAX D;  5KMG B;  1ONI A;  2AIZ P;  4TV8 B;  4X1K A;  1COM A;  3I7T A;  1Z5V A;  2VGM A;  3RYC B;  1XRG A;  3HKC B;  1X7O A;  5JVD B;  3RYI A;  3JVH A;  4PWT A;  5B8F A;  2GLZ A;  5HXZ A;  5J2T B;  3CME F;  4BVR A;  4NWO B;  1KQS F;  4O4H A;  3Q8H A;  2HS0 A;  5EB0 A;  5JQG A;  3C9U A;  2CHT A;  3MCA B;  1M90 H;  1KD1 H;  1W57 A;  3KIZ A;  2ZOD A;  1FFX A;  3ZP7 A;  2FC3 A;  3S0H A;  1W59 A;  5FLX M;  1KNK A;  2YYE A;  2F9Z C;  4F6R A;  3CCE F;  3O85 A;  3G4S F;  4EB6 B;  1R1M A;  2UYN A;  3CXC F;  3LWV C;  3JAS B;  4G88 A;  5C8Y B;  4IIJ A;  3N2G B;  4X3L A;  2CZW A;  5EB1 B;  2RHL A;  2FGY A;  1TUB B;  3JAT A;  4O2B B;  5ITZ B;  2IQQ A;  1VQP F;  3M4S A;  2KGW A;  5BMV A;  3CCM F;  2WAL A;  3RA5 A;  1W40 A;  3QTY A;  3CCV F;  4G4Z A;  4U3J B;  1NMU B;  3HKC A;  1VQ8 F;  4YJ3 B;  1IPA A;  4BVS A;  1W41 A;  3WPW A;  3TD4 A;  5J2T A;  1QVF F;  3KJJ A;  4I4T B;  2ALE A;  1Q82 H;  3ZO8 A;  3ZP4 A;  1PF5 A;  3CPW F;  5MN5 A;  4G4V A;  5HXU A;  3E1Y A;  3HTN A;  1JFF A;  3BYQ A;  3KHN A;  1CLI A;  3ESJ A;  1ODE A;  3OBW A;  3ON1 A;  3S03 A;  3NVK E;  2QI2 A;  4E6E A;  5GAP K;  4BT2 A;  4TUY B;  2EWC A;  5EWR A;  2JNB A;  5HY2 A;  4EB6 A;  4KWE A;  3JAS A;  4X3M A;  1W5E A;  3N2G A;  1H7M A;  1JD1 A;  2G9I A;  3FD5 A;  1W55 A;  2R6R 1;  4O2B A;  3S06 A;  5ITZ A;  4B45 A;  2IAF A;  1YIJ F;  2UZH A;  3K14 A;  3F0F A;  3PAF A;  3WGM A;  3ZOP A;  3E20 B;  2HP0 B;  3I56 F;  2BTQ B;  5MN4 A;  2GZL A;  4YJ3 A;  3GYQ A;  2LBT A;  5KX5 B;  1RQ7 A;  4ZHQ B;  3CG6 A;  3CMA F;  2VAM A;  3DC2 A;  2VGN A;  1Q8R A;  2QTP A;  2I6R A;  5HP8 A;  3RYH B;  1KC8 H;  3CC2 F;  3UT5 A;  2W8B C;  1QD9 A;  5IJ0 A;  4RHA A;  1E7K A;  3OBY A;  1VQN F;  3E22 B;  1CK2 A;  2QA4 F;  4G4X A;  1VK3 A;  5GAN K;  3T80 A;  3RA6 A;  4BT3 A;  1SA0 B;  5IYZ B;  1FNK A;  4O4L B;  3VYU C;  2KTV A;  4X1I A;  5J2U A;  1ZWZ A;  4TUY A;  4C82 A;  1N8R H;  2B33 A;  3VYS C;  3MDO A;  4BVQ A;  3ELC A;  3F0E A;  2Z1T A;  3LYB A;  2Q1X A;  2Q1Y A;  3SIU A;  3MQW A;  2HQS C;  5A2Q M;  1W5B A;  3CYQ A;  3FD6 A;  1W3E X;  4TV9 A;  1S72 F;  3QUW A;  4LCK A;  3TD3 A;  1VQ7 F;  3V7Q A;  1IV1 A;  2OTJ F;  2OZB A;  3CC7 F;  3JAK B;  4DXD A;  3IMP A;  3G6E F;  3LDT A;  1FNJ A;  1YIT F;  3HWU A;  4BVT A;  4ZHQ A;  1SZQ A;  3K2X A;  3LFO A;  2OHW A;  4B62 A;  3N2K A;  4BT4 A; 
#chains in the Genus database with same CATH homology
 2HVY D;  3CCL F;  3V7E A;  5HWE A;  5HY0 A;  1YHQ F;  1VQP F;  1W42 A;  3NK6 A;  2KG4 A;  3CCM F;  1PXW A;  2WAL A;  3CCR F;  3RA5 A;  1W40 A;  1JJ2 F;  3CPQ A;  3D00 A;  3LWO C;  1Q86 H;  3CCV F;  3LWP C;  5GIN C;  1DT9 A;  1NMU B;  3LWQ C;  3JCM M;  1VQ8 F;  1IPA A;  1VQ4 F;  3CD6 F;  4BVS A;  1VQ9 F;  1W41 A;  1QVF F;  4EI7 A;  1YJW F;  5DCV A;  5HY1 A;  3CCU F;  1Q7Y H;  2ALE A;  1Q82 H;  4BW0 B;  3VI6 A;  3CPW F;  3SIV A;  2KTU A;  2LBW A;  5HXU A;  4C4W C;  5G4U C;  3VMF B;  1XBI A;  5HY4 A;  1NJI H;  3E1Y A;  3G71 F;  1RA4 A;  2I6D A;  3OBW A;  3ON1 A;  3V3T A;  3AGK A;  3NVK E;  2QI2 A;  1GZ0 A;  5GAP K;  5EWR A;  2JNB A;  5HY2 A;  3N4Y A;  2QEX F;  4X3M A;  3CC4 F;  1M1K H;  1H7M A;  1RLG A;  1K73 H;  3OW2 F;  1W2B F;  1YI2 F;  1VQ6 F;  1YIJ F;  3WXM B;  1VQO F;  2BO1 A;  3PAF A;  3CCS F;  3E20 B;  1VQ5 F;  3I56 F;  3HJW C;  2AIF A;  3NK7 A;  1VQL F;  4XCQ A;  5EO3 A;  3GYQ A;  1YJ9 F;  3CCQ F;  3CG6 A;  3CMA F;  4NUT A;  4TZZ A;  2VGN A;  3LWR C;  3I55 F;  3J7A R;  2OTL F;  5GIO C;  3FFM A;  2LBX A;  1KC8 H;  3CC2 F;  5GIP C;  1K9M H;  1GO1 A;  3JAM M;  1E7K A;  3HAX D;  1CN7 A;  3OBY A;  1VQN F;  1CK2 A;  2QA4 F;  5GAN K;  1YJN F;  1K8A H;  2VGM A;  3RA6 A;  1X7O A;  4EI9 A;  3CME F;  2GLZ A;  5HXZ A;  2KTV A;  4BVR A;  3CCJ F;  1KQS F;  4NQ3 A;  1VQM F;  1ZWZ A;  1QVG F;  1SDS A;  1T0K B;  1N8R H;  4BVQ A;  3MCA B;  1M90 H;  1KD1 H;  1X7P A;  3J80 M;  3SIU A;  3J81 M;  5A2Q M;  1VQK F;  1W3E X;  3NMU C;  2FC3 A;  1S72 F;  5FLX M;  4LCK A;  1VQ7 F;  3V7Q A;  2OTJ F;  2F9Z C;  5G4V C;  4BY9 D;  3CC7 F;  2OZB A;  1X52 A;  3CCE F;  3NVI B;  3O85 A;  3G4S F;  3G6E F;  3CXC F;  3LWV C;  1YIT F;  5FJ4 C;  3N4Z A;  3IR9 A;  4EI8 A;  1Q81 H;  4BVT A;  3LFO A;  3PLA C;  4X3L A;  2CZW A;  2OHW A;  5IT9 M;  1GO0 A;  2FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...