5J2UB

Tubulin-mmaf complex
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Structural Basis of Microtubule Destabilization by Potent Auristatin Anti-Mitotics.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 160
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5j2uB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5j2uB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5j2uB01
4I4TB 4ZHQA 2VAMA 3UT5B 4TUYA 5LYJB 1TVKB 5JH7B 3JALB 2BTOA 4X20B 5J2UA 3CB2A 4DRXB 5LOVA 5IJ0B 3V3TA 2Q1YA 4O4LA 3JAKB 3E22A 2VAPA 3WGKA 5EIBC 1W581 4EI9A 4X1YB 5LXTB 3WGMA 3M8KA 1Z5VA 4IIJA 3HKBA 2VXYA 1W59A 5MN6A 1RQ2A 5M7EA 4ZHQB 4TUYB 4LNUA 4X1KA 2VAWA 5IJ9A 5BMVA 3HKCA 4I55A 4IHJA 4O4IA 5JVDA 3N2GA 5J2UB 1RQ7A 5LOVB 5FNVA 4B46A 4O4JA 3VO9A 4O4LB 4HNAA 3E22B 4TV8A 1W5FA 3JASB 1TUBA 5KX5A 4U39A 2RHLA 3RYHA 4O2AA 4KWEA 1W5BA 1JFFA 4IIJB 3HKBB 4E6EA 5IYZA 4X1KB 4LNUB 5JCOC 5IJ9B 5LP6A 5BMVB 4I55B 4EI8A 3RYFA 4IHJB 2XKAA 4O4IB 5JVDB 4YJ2A 3N2GB 4O4HA 5FNVB 1SA0A 3JATA 4O4JB 1FFXB 4HNAB 3ZBPA 3WGLA 4TV8B 5CB4A 5EZYA 1TUBB 2RHOA 4FFBA 3RB8A 3RYHB 4ZOLA 3RYIA 4O2AB 5MN5A 1JFFB 3VO8A 4U3JA 5GONA 5CA1A 5LA6A 5IYZB 5J2TA 5LP6B 1Z5WA 5EYPA 3RYFB 3ZIDA 3HKEA 4YJ2B 1W5AA 4O4HB 2XKBA 1SA0B 3JATB 4EB6A 4X1IA 3WGNA 5MN4A 4B45A 5CB4B 4YJ3A 4FFBB 4O2BA 5CA0A 1OFUA 4ZOLB 3RYIB 5C8YA 3JAWA 3HKCB 4U3JB 4ZI7A 5GONB 5CA1B 5LA6B 5J2TB 5KMGA 2RHJA 3RYCA 5EYPB 3JAKA 3VPAA 4F6RA 3HKEB 3JARA 5KX5B 3N2KA 2GVIA 4EB6B 3ZBQA 2BTQA 4X1IB 3HKDA 1FSZA 3C8LA 4YJ3B 4EI7A 5EIBD 4I50A 3R4VA 4O2BB 5CA0B 4XCQA 5C8YB 2R751 3JAWB 4ZI7B 5JCOA 1W5EA 4DXDA 5JQGA 5ITZA 5KMGB 4M8IA 4WBNA 3RYCB 3VOBA 5EZYB 3JARB 4TV9A 4F6RB 3JASA 3N2KB 4I4TA 2BTQB 3UT5A 3HKDB 5LYJA 1TVKA 5JH7A 3VOAA 3JALA 2RHHA 4X20A 5LP6C 1RLUA 4I50B 4DRXA 3WGJA 5IJ0A 2R6R1 5JQGB 5ITZB 4WBNB 3M89A 4X1YA 1FFXA 5LXTA 2Q1XA 4TV9B
chains in the Genus database with same CATH superfamily
4F5EA 2IEGA 3ZV6A 3D02A 1ZIYA 1OMOA 4DG9A 3AFIA 1IY9A 4HGQA 3W5JA 1KJQA 2XPCA 3MPUA 1M0TA 1PS8A 3C97A 4EHBA 4M1SA 2COKA 3ESYA 1HR0B 1YOBA 3B48A 4ALJA 1D2GA 5AVWA 1QHYA 2B0CA 3KM0A 2NG1A 3AB8A 3V4ZA 4RQUA 4DM7A 3HU3A 4C05A 2AZMA 3JVDA 3BRWD 3CVVA 1FFBA 4Q4JA 2VSNA 4LJRA 4EPXA 3JZDA 1WY5A 1ISFA 4W8GA 4CUZA 1Y5NA 3UUWA 1E1DA 3B9RA 3P8ZA 2LIVA 3K09A 3CRMA 4YJ2B 3GDGA 2V03A 3AG1C 1PT5A 1XZNA 1I0HA 4X62B 4OGWA 3AUXA 4YJ2F 1NQAO 1JIKA 5LIRA 2YXPX 4E4RA 1T1GA 3RS7A 4DUPA 1Q0SA 1ZGJA 1MO2A 1LLUA 3NHPA 4QLOA 1WL8A 1P5RA 1MF7A 4OPMA 3DKPA 2W8BA 4XUDA 5B12A 1GPJA 1ZI6A 1OLSB 4M0EA 2IYUA 4N0MA 3D1JA 3W6NA 2NP6A 3L6BA 4R2HA 4M1ZA 2OTJF 4CCYA 1DXQA 1PK7A 1T5BA 3B09A 1ULTA 3KKLA 4RFVA 1XWWA 4INAA 3IKFA 4D2IA 1PL7A 4DSNA 1DEOA 1MOZA 4R5MA 1OR8A 5BVGA 4PC6A 3BZWA 3WNZA 4RSRA 1S5PA 1LZKA 2O3SA 3G8CA 5I45A 3SX0A 4LISA 1JILA 1J2JA 4NCNA 3W04A 3U44B 2QU8A 4QXPA 3ZN0A 2JIZA 5KIAA 1Z7EA 2I55A 2JB9A 1NU8A 3ESXA 2X8WA 3BFRA 1KORA 4ZTUB 1VQ7F 3LMEA 3IQXA 1CRLA 3TQTA 1ZD5A 3VZCA 2AR7A 4YCBA 2O2HA 3NATA 2GZHA 1D03A 3O92A 3ZNOA 2IJKA 1M8JA 4GLXA 1RAHA 1O0BA 4QE9A 2FP3A 1UBJS 1Q5OA 2NZJA 3PB3A 2ETXA 3G2LA 1V3TA 3JRXA 3HACA 4TN1A 3MJ4A 4RD0A 5DT2A 4DV1B 3DKRA 3CCLF 3QBTA 2EG9A 1JSCA 1BE1A 5KAIZ 2W2XA 4G5HA 3AG5A 5DW3A 3CMEF 2ZRBA 2IPMA 4JITA 4X8HA 4L6CA 1A2OA 2CXQA 1XZBA 3AM4A 3V55A 2HAEA 1BS2A 4R16A 1LR1A 3SMVA 4L0MA 2RAUA 1B23P 5CXXA 3USZA 3NV7A 3BYZA 1P5ZB 5EWLB 4FYYA 3F2IA 3NHSA 3WA7A 4OIMA 3R74A 4ITUA 4E12A 1XO1A 4LFAO 4BU0A 1Q17A 3UICA 3GVMA 3DCNA 2E6UX 4BLTA 4TM7A 1E3MA 2KQUA 1QLEB 3GW8A 1IM5A 4EY5A 3SHOA 1JV2B 1QIIA 3IBSA 1FQWA 2ZE6A 4YCJA 4I4TA 3UT5A 2ZREA 5HIJA 3DBRA 2B7BA 4WZBA 4PSKA 4YUAA 5FWYB 3KUXA 2VT2A 1A9SA 4RCYA 5C1IA 2P4EA 2K1EA 3AGQA 2YN4A 2Q29A 2LWIA 1XL4A 1OA0A 1ZXXA 4WQMA 2DCMA 3L72H 1LY1A 3LHIA 4WNCA 4CM3A 1K34A 5BSWA 1RJWA 3VR3D 3R6WA 1R8QA 2E49A 4CJXA 3ST7A 2EBOA 1H22A 3C45A 3RSQA 3MF4A 3RS4A 1ZH6A 2E0IA 2KSQA 4QZVA 3WL7A 2G80A 2ZRKA 4ZT3A 3THYB 4CLXA 1HDZA 1OBVA 4D97A 3ND6A 2Y0CA 1DDOA 4ZI7A 2HBYA 3Q8WA 5BQ5A 1Q1ZA 3VR4H 3L8GA 2XLCA 3JSXA 4I0WB 1A72A 1Z7YA 5DNYB 3PQ3A 1X15A 3TLBA 2W0MA 1TM2A 4XGNA 1IZYA 4RAIA 1YTFD 1G7CA 4G28B 2A9JA 2Y9MB 3QJYA 2ZPUA 1T0PA 4JI1B 1UXHA 1CUUA 3IEIA 4PQEA 5A03A 5JS7A 1U7DA 4Q9JA 2XDQB 1R6TA 2DR0A 4OM7A 1L8AA 2V8BA 1W1WA 3JVUA 3QZUA 3ZDBA 4A73A 4AMBA 2JFXA 1KK0A 4G8JA 4LGYA 4ZVKA 5CPBA 2LVBA 4LNHA 4QM6A 3RLIA 4RPCA 3PDIA 4BO5A 2GBLA 1E62A 4OHFA 1FDWA 4R2IA 2AVDA 3T0FA 3TRJA 4ZYZA 5IAEA 1J09A 2O54A 3EJ6A 4G26A 4ZEXA 3VR2A 1EXWA 4PXSA 3B9PA 2YRFA 2QZZA 2OP0A 2YUIA 1S4MA 3FZGA 4N3AA 3VX4A 1RZRD 4F06A 3MWDB 2Z56A 1PV2A 4MIYA 4WDQA 1S7CA 2P79A 1XMJA 1EZVH 5M2QA 4OP3A 3UUFA 4LJYA 1R8JA 1NWCA 9LDBA 2X0RA 4Q9NA 4X64O 4YCDA 4RQFA 4WN3A 2A30A 1M6VB 4LQLA 5HKLA 3EQ9A 5AJHA 3B70A 5GANK 2BO1A 4TSFA 2YYSA 3L7MA 2VSOA 4DG5A 4B31A 2BOVA 3X1YA 1OB2A 1M0EA 4KQKA 1YMVA 5D8DA 3ABMC 3R0XA 5I48A 2QVZX 1OBHA 1BEEA 1S8NA 4E22A 2KBEA 1N0JA 3JQAD 3DT8A 2CXTA 3HHPA 5BR4A 2NU8B 5K0TA 5AMXA 1E1RA 2ATCA 4MJXA 5DLEA 4HUQA 1WF6A 3VO8A 3FZYA 1BE8A 4MMZB 2I1VB 2PUEA 4MWSA 3BSYA 1VQ8V 1ZHHA 1MJNA 2PGIA 4DCGA 1SK8A 1Y3DE 4U9IS 1ZWIC 1CK4A 1SY7A 2O2YA 3CCEF 2VPXA 2NM0A 4LE1A 2I4OA 2PUHA 3AQIA 5B1OA 1FRVA 1W5TA 3KT6A 2IYTA 1NN0A 4NG5A 2EKBA 2ZRMA 2I67A 1JHYA 2P35A 1UEJA 3O90A 4JVNA 2WUVA 1DB3A 1N8NA 3PJRA 3LTEA 1A7UA 1VSVA 3A3YA 3N07A 1H3FA 4PR0A 1ZJ6A 4LF9O 3T1HB 1QGED 3UXEA 4DAEA 2JH9A 4D3XA 4FBMA 1ZL8B 4J7UA 1IAVA 1SG0A 3LPCA 3QLUA 3A1UA 3WK5A 3TLZA 2BHSA 4MUGA 4B9AA 2LTAA 4HSEA 3IP9A 1HF3A 5G0VA 2PJRA 1OAKA 4FFBA 5E3HA 2AHOA 1YR6A 5CEFA 5ES3A 1HTBA 3G71F 1S1MA 1JYEA 4R0VA 3KZOA 1SMKA 1P5JA 4RGBA 1CIJA 3DV0B 1NT2B 4PZPA 5AVZA 3GJZA 2P6RA 2OT3B 2YC2C 5LHIA 5KNCH 4C7UA 4ERHA 2DR2A 4AJHA 1DC7A 4NU0A 3Q7EA 1NTOA 2JCBA 3NEYA 5JR3A 5K0NA 3GARA 1RLGA 1OXXK 4PA7A 3M34A 1CJKC 4WXHA 3TIGA 4W7IA 3N8NA 1E0SA 3Q98A 1K08A 3ETQA 3CF0A 3FCAA 2JHAA 2P6NA 1K9VF 3RTAA 3K4QA 1H2FA 3ZQ6A 1GZVA 4JASA 1IXYA 2BGWA 2HSWA 1C1DB 3HO1A 1QNLA 4KI0A 4AMUA 2BGUA 5CDHA 4L7QA 3ON1A 4IP0A 4RVGA 1A8IA 2P9YA 3CJRA 5BN4A 2OWDA 3GWOA 1W36C 4HDKB 1QLNA 3OAAG 1P0PA 1ZSPA 4JL5A 5IBQA 3AI3A 2Q0SA 2GWHA 3EC7A 1CR6A 1GP2A 3NS7A 3TKAA 2JAQA 3I6QA 3FY4A 4M98A 3BHIA 5LHGA 4JNCA 4RPHA 3MJHA 2OXEA 3PUHA 4ZPJA 4AJOA 5AIBA 2O1SA 5KQMA 4XTCS 2FMUA 3IT2A 5DNDA 2VNAA 1P84F 2IITA 3F6EX 4MQ6A 4JI8B 2E4YA 1RWNA 2ZJYA 3ZJYA 1HR0O 4D74A 4AN0A 4JLWA 1PU2A 1Y4UA 5DK6A 3AW9A 3FRHA 3I83A 4ALIA 3EIXA 3DYIA 3TCKA 3R7SA 1ELOA 4H0FA 1BXGA 3WV5A 2AIZP 4R5HA 1DFIA 4F8YA 1VIYA 5CT8A 3ZIDA 2GYUA 3FI0A 4P84A 5LP1A 1KPHA 3AY0A 3LY8A 3RFTA 2BBWA 2VJCA 3GEBA 3NDPA 2D13A 1YFKA 4UM5A 3VTKA 4X62O 4JYZA 2QXYA 2P0AA 1XWFA 1MB3A 4L51A 2OV1A 1M0SA 3TTTA 3HI4A 2FPPB 3WSVA 3CU5A 4L15A 4DA7A 4GUAA 3V4SA 4RJIA 3AG2C 1NR5A 3WGUA 5KHAA 3PGJA 4CV2A 3K8QA 2Q4RA 4DE5A 3WDSA 3VPFA 1RHMA 4X1YA 1VHWA 3QTTA 2OCXA 5JJKA 1B73A 1I7NA 3K53A 2FP4B 1QU7A 3W2GA 3I5YA 4I5EA 4K0RA 4H7DA 1QQ5A 1E79D 4LDAA 2H17A 3EEFA 4ID9A 4RA9B 3BBPA 2IG8A 1OE0A 2FWMX 4MVQA 3PP8A 2DMRA 4DGQA 2WHYA 2I6DA 1E1LA 4W8OA 2RHOA 3ZWOA 2W4IA 2RJOA 5GONA 4DZTA 2C88A 2YJ5A 4WZAB 2XOKD 5CB4B 4B5LA 2O8CA 3H4TA 2WA2A 1E2PA 3QO5A 4X8AA 2CHVA 3RVBA 2NVUA 5CB4F 2ZP1A 2F93B 3OZGA 4JAVC 3QHDA 1QRUA 5JNSA 1TEHA 2ETVA 1UPBA 4X3LA 3RF7A 4C0BA 1NLUA 2RBGA 1KU0A 2GASA 1SVMA 2JAXA 3WLQA 3F5QA 3TPCA 4JSTA 2R1VB 4JMLA 3FUWA 1H2ZA 1P6XA 1DE0A 3SJUA 4IZOA 2FG5A 3CUWA 4FU0A 3VR4A 3MJDA 4DLRA 5CDUA 5HP8A 1KNQA 1ZMTA 3E7DA 3GVHA 1HTWA 4DV1O 1M1KH 1VQ5V 1KDRA 3PLNA 5A3QA 3FYSA 4JYAO 2G5PA 3OY2A 4C0HA 3WLSA 4G5QA 3GCXA 4UW9A 2E18A 3F3YA 1VJGA 4F8JA 1F9EA 1ZOOA 3T7RA 3ZUGA 2GYVA 2HDWA 2JLSA 1I1OA 4QOFA 4L9AA 3N6VA 3R6GA 5KJ1A 3NEPX 4N3NA 5K7SA 3KUCA 4I9UA 2XB4A 3IHLA 1KEKA 1NYLA 5KJCA 1ZCBA 4XVRA 4NXMB 4YJDA 2G6TA 1TQ6A 1I01A 1WU7A 4DBVO 5H7XA 3FDZA 1ORQC 3D3QA 1JI3A 1RI2A 3PC8C 2RHWA 3E8XA 2R3SA 1DKUA 3ZHVA 2IH5A 1AKQA 2PMCA 4CFZA 2LGJA 2QD3A 1HLDA 2KWIA 3Q4HA 5C5DA 2G1JA 4IJQA 2IIQA 1IVNA 4FKBA 2AFHB 3Q8MA 1KY2A 3DD5A 3EQ6A 4HZIA 3GEHA 2VS1A 4HNAA 1T6BY 3FJ1A 4ZOQI 5LWHA 5CFZA 3OD1A 5LUAA 4KQ2A 2GEDA 1AMUA 1OZFA 2X5NA 2W42A 4HYTA 3IULA 4P54A 3LWOC 4X65B 4BN5A 2IKQA 1K9MW 4HPWA 1GFZA 1IAQA 3MINA 4KAAA 4CBCA 5BY2A 1WW2A 3HGMA 4NYIQ 4DCVA 1MEEA 1U31A 3NONA 3BABA 3JQ9A 2JI8A 2CYAA 2UYJA 3H9CA 3O0TA 2UUBB 3ZIAG 5JRZA 2XRFA 2C9MA 5DZSA 3WFJA 4W5NA 2IPLA 2YYEA 3I7TA 2NAFA 1CF2O 1UFKA 4HWGA 3T5BA 1VP3A 2FSHA 3OBIA 2H2WA 3KSUA 1D4AA 4QGHA 4ZHWA 4G1BA 1HQDA 2Z1MA 4DIEA 3KJEA 5TQ0B 1KYOF 1L8OA 1X94A 2HA6A 3Q7QA 5A71A 1PFKA 1YBHA 1I3KA 5INTA 4WN9A 4BNIA 3TD5A 4U5XA 2GUZA 3HFSA 4M36A 2C2MA 3JYLA 4L78A 5IWCA 3ISVA 1C0LA 1U0SY 4CUKA 4Q93A 1QNFA 5JCOC 2WD9A 4JVSB 3A1EA 2HVKC 5JMWA 4PX2A 4NCXA 4FZ0A 4LVCA 5CR9A 5HXAA 2Q9CA 1TO2E 3INTA 2VP5A 3HO6A 4MVJA 5A62A 3MZ0A 3RFVA 3KHKA 3EZ7A 5DCWA 3F49S 2PAAA 1P7YA 1D4OA 3LJKA 4BMCA 1RLMA 1R3KC 4B33A 4DYLA 3ZLJA 1R6DA 3EXEB 1I7SB 1A04A 2SICE 7YASA 3DNFA 5ALUA 2K5UA 1WA5A 3DBLA 2KM1A 4HYEA 1SD5A 3H7IA 2QDOA 2PUCA 4JLBA 3ZEAA 3PPIA 3Q10A 3KAJA 1AQYA 1P0CA 2H4ZA 1W581 3UJ8A 3VC7A 4MQFB 1J2TA 4TTJA 4DV0B 4AXBA 4EUEA 4OM8A 3HR4A 4KACA 4YA6A 4FOTA 5GWXA 3VVLA 1SESA 1IY8A 2GZSA 4NBKA 1AS2A 5BNZA 4O0LA 4TV8B 3NBXX 5NULA 2C5FA 3BXFA 3DH0A 3RVLA 3SYPA 3UJNA 2IV3A 1YOVB 1KETA 4W7HA 1X86B 3SAJA 1JIVA 4OGQB 1EQ2A 2GA9A 1VMDA 3PBKA 5K0JA 3FB8C 3OEHG 1GWNA 2B69A 4DMKA 3MM4A 4HNRA 4OX9B 2IXDA 1GZSA 3HB1A 1ZCAA 2J59A 4MXDA 4EUNA 4GAEA 1EVEA 3KQUA 2OYQA 2WEKA 1KAMA 1WMFA 1R9JA 1IATA 3K1AB 2CNDA 2PZBA 4N4AA 4RTMA 2A1UB 1FXWA 5AKYA 3WISA 4ALMA 1EVZA 4FZJA 4L08A 4EYGA 1JAXA 4LCJA 4BQQA 1VQOV 2NO7A 1MAUA 2JLWA 5IBCA 2DT4A 3G4SV 4QPJC 3ZN2A 3AF4A 2GHRA 1G9TA 4FYMA 5A7HA 4KUEA 4UU7A 4CV3A 1VQPF 5CLHA 4IYHA 3DBHA 1XE3A 2ZSEA 3GJ4A 3GUHA 5CD9A 2AXTZ 2ZBFA 3LWQC 1NBME 5F4ZA 2GAOA 4MYHA 4A2PA 2FLWA 2VHEA 2YOGA 1CX9B 4EQZA 5ALYA 2NUTB 2AZTA 2W48A 1CTQA 2QD1A 2QT1A 3U37A 3RH0A 3Q2OA 4G09A 1C1HA 3RU2A 4JP2A 4JKYA 1G20B 3EXFA 1P19A 4U8HA 3VIUA 4FFSA 3KXDA 3H9BA 2XVAA 3H8SA 3KG2A 3AG6A 1H2MA 4NJOA 2XMCA 4P3XA 1YS2X 1SURA 3QW2A 4JVLA 3H1TA 3KTOA 4OGGA 4CTNA 5IDVA 2DTXA 4EKDA 2HLHA 4FONA 4QC2A 4RW0A 3DF9A 3CONA 3M4YA 4JPRA 3TQOA 3T9EA 1JVSA 2NO6A 1GGMA 2Y68A 1TKAA 1ZPDA 2QA4F 3D4IA 4JX8A 1G60A 4OXRA 2FVYA 2YIVX 3T61A 1M90H 3ZGZA 4QTZA 3KSBC 1Z75A 1Q1GA 3MT9A 3FNEA 1R8SA 1ORWA 3HCOA 4PWTA 5CVJA 2H2AA 2PL3A 2ZI4A 3D59A 1IZ9A 4BNFA 1AN9A 2Q7XA 2O14A 3K3WA 1YQGA 4ONEA 5HJ7A 5LZ5A 4BZWA 5KMGA 3A06A 2L26A 5GIOE 2QV0A 1Z2CA 4C6RA 5BXQC 1YB1A 2IEZA 3M1XA 3ND5A 2PLAA 5C8YB 2MIIA 3DMTC 3PVZA 4ZYLA 2WUEA 2VSXA 3OKCA 1N32B 2QGFA 5C8YF 3VU9A 3OZCA 4OLBA 1RXYA 5AK6A 3TOVA 4XQCA 3LOQA 2Q5LA 1FMJA 1N6PA 4H31A 4ZOBA 3U4CA 3P5SA 2XZPA 1DRWA 5DM4A 4AK9A 1TVEA 3R8XA 3C9RA 2DKOA 4YNBA 5HDQA 5H0IA 2EU8A 2IHYA 1EZ1A 5BOVA 1BFUA 4QM7A 2HBZA 3AUAA 3V7EA 3NMUC 3IBFA 2BFWA 4ZKIA 1VE5A 1U1FA 4HBGA 3TRFA 1OWOA 5C3MA 4JI8O 2I4NA 1ECLA 1HZZC 4E6PA 1DP4A 4AZ0B 1I3LA 1N36B 4DIMA 5HF6A 1W29A 3IIKA 2I8CA 4L8GA 1M1YA 1YH3A 2A4KA 1GFIA 5IPFA 1UJ2A 5E38A 4D8YA 4GS5A 3KU4A 3WKEA 4HLUA 3HWRA 1S7GA 3ZY3A 2AD1A 3GNSA 3ROQA 4HWTA 1E3IA 4FYJA 4PPNA 4DHEA 3HCEA 4TKUA 4UB6Z 3B1VA 3ZWWA 4JAAA 1ESEA 1KVQA 2OHIA 4RCVA 2IYEA 2QL9A 1PDWA 3M6FA 3AR6A 3VHRA 3HO8A 4R71A 2QL6A 1GGEA 1RCUA 4PX9A 1AI4A 1AJPA 3STXA 1R3LC 4XSHA 2YV4A 1NRJB 3ZYCA 3LC0A 2PS3A 5K8JB 2G9NA 4PINA 1J9ZA 1DEXA 4G4WA 5F12A 1U3CA 2NTYC 2YZGA 1ACLA 2PI5A 1GITA 1VKZA 4FGSA 2G8LA 1DMSA 1ONSA 2X0JA 2AG0A 4LOKA 2WPDD 1UKBA 3FBTA 1VSUA 5KDLA 2Z43A 3AIKA 5CYFA 1VKHA 1WUJS 3IVXA 3K9WA 5CB0A 3MS7A 3ABQB 2EIKB 4Q34A 1MX9A 2VDVE 2J9GA 1PDVA 2ANBA 3TEFA 3SDLA 4LI3X 3TZCA 2VQEO 2GN0A 2DLCX 2YVQA 2WIBA 2ZULA 2CNWD 1IY1A 3FPGA 4GMFA 2YIBA 2HMUA 3FNRA 1Y3BE 3KEMA 3BFVA 1ZUD1 5EZYB 4HCJA 4J7XA 1NFFA 5CGQB 3A31A 5EZYF 4RLQA 1BHSA 1G3UA 4PU0A 3CMAF 3EXG1 1NQ5A 2D62A 3M8AA 2PS0A 1Z56C 4J75A 4QWMA 4NVRA 2PT7A 4YRRA 3BCHA 2ZZNA 1C7JA 1OFGA 1CP3A 2C2WA 2EFHB 1F4PA 2IHBA 3AESB 3ENZA 2GESA 1DG9A 4BMXA 2EIXA 3PXXA 2UUPA 1SUAA 3C1UA 3HWSA 4XZ3A 3KCNA 5AW7A 4AJEA 4RTRA 4KPYA 2R25B 2VQFB 1T3ZA 4XWAA 3BGWA 2MINA 3AEZA 1TGVA 1EESA 4Y6PA 2NLJC 3PF9A 1ZG3A 2QWXA 4HFJA 1K4MA 2F6RA 1GRVA 1T3SA 3W5CA 3DPSA 5L51A 3DAYA 2P9JA 3X2FA 1OU0A 4NXMO 3HTXA 4Q00A 1CY0A 3RDPA 5IKPA 2CLMB 1D0IA 4K3AA 3UT0A 3USES 3R5KA 2X2FA 5I8WA 2ZT5A 4N23A 3CXRA 4G0NA 1B2RA 4KN8A 4ARSA 3UOWA 3TG2A 3WMWA 4OPAA 4B3BA 1E1CA 3OQ6A 3GYQA 2FWJA 3VYWA 1M66A 2HOQA 5FJIA 2X6BA 5JATA 2IX9A 4PGHA 5AW6A 1OGJA 3OZWA 4R2JA 2IHKA 3ZKAA 1AILA 4DSOA 3H2BA 1I0IA 4BP8A 3KLBA 1A2BA 1VXRA 2XTJA 3Q8LA 3FVTA 1P7VA 3U3RA 1T9GR 1HDXA 3ZDYB 1UBUS 3D31A 4HGNA 3S1AB 5EVJA 2W2QA 4GDMA 4X65O 1V48A 3KWFA 2O6LA 1SXHA 4MVZA 3C3XA 5DPMA 3A0RB 4N5IX 4KE8A 3P4UA 3QENA 4OKIA 3DUFB 3HJNA 3EUWA 4DLKA 3QKTA 4U9UA 3QA3E 1HNXO 2B25A 3LWBA 1VZ2A 3V8VA 3FYTA 3WAKA 4WESA 1I4OA 2HA2A 2ZKLA 2PGOA 2XXJA 5HOEA 3IPCA 4NJEB 2Z3WA 3ANYB 5IDYA 2UUAB 3R0IA 3NVIB 3U40A 4RANA 3QWFA 4CMHA 1D5WA 4H6VA 4KR0A 5DBHX 1E3LA 1ZK4A 3RF6A 1OWPA 3LI2A 3R0JA 5LP6A 5CW2A 1XDGA 4N7BA 1Z68A 2IUFA 3OWHA 2AGAA 1EVIA 5EBWC 4C22A 3N59A 2PLNA 5T6MA 1QX4A 1W55A 4MV3A 4N5HX 1FP1D 1JDBB 3VBBA 5SZHB 2NXNA 4FXOA 5AKZA 4EJSC 2P65A 1HYGA 2P4HX 2O2XA 4ZVUA 3PGXA 2VBCA 3D0OA 3OJFA 2H8PC 4J0JA 4BO3A 4Q3OA 3EMBA 1WM1A 5JU6A 1PG0A 5CJPA 1Z4KA 1FTYA 3AEUB 4AYWA 2QB5A 4JJ6A 4ZU3A 4HQ6A 4MOWA 4LK2A 1A4XA 3B9QA 4TT3A 2ZSIA 1A82A 5B1BB 4CKZA 2JATA 4UHHA 4B74A 4ISBA 1Q0LA 4LFAB 5AVSA 3KTDA 1D4ZA 2E1PA 4XI9A 2UZAA 4BMDA 1Q19A 3KS9A 4RKFA 5K3BA 5KHHA 5E9JA 3ZVNA 4DV0O 4N8SA 4QSMA 4OJKA 4KC0A 5D1NA 4PYIA 2NU6B 3IEMA 3SNHA 4EKNB 4R1LA 1W57A 2RE8A 1PHRA 4PQRA 4A16A 2HO4A 1P0QA 2CHTA 4EEXA 4JS0A 1V5FA 3U6BA 3E48A 2JJYA 1IG3A 3WAGA 4PTYA 3TZEA 4TMWA 2Y69B 2NYVA 1X7WA 3K9GA 2GKOA 3R1IA 2JJ2A 2HA4A 3DW1X 2BFOA 1VKNA 1YA6A 4CIWA 5TVKA 1D1QA 5J4HA 5B3LA 1QTNA 3KXPA 4OX9O 3ROMA 4TL7A 2DFLA 5DYYA 3G8BA 4OI0A 3DOHA 1YHZA 4BGVA 4G23A 3PGKA 4DCTA 4YIOA 1F14A 3MDOA 2XUJA 2Q5FA 4LBVA 4EGAA 4XIYA 5DLQC 4PY2A 3INYA 1JLLB 3EQ2A 2UXXA 1FFDA 1NW6A 2G67A 3TQFA 3SK0A 1VM6A 5TMEA 1XP5A 1U5BA 3ZU5A 4H15A 5SYAA 1ODKA 3KFVA 2PUAA 2HWYA 3R3ZA 1SA0A 3A4IA 2V7XA 2VRNA 3NGLA 1S3IA 5ES4B 3DXZA 2QM0A 2UYYA 3EIQA 1Q7RA 2OHXA 2CFIA 4PG7A 1YS9A 4URYR 3U7FB 1GVHA 5A9SA 3W79A 1NBHA 5ULLA 3H7AA 1CB0A 3LT1A 2JAWA 1GFSA 4LZZA 5I7AA 1U9JA 3VZBA 2H00A 4OB7A 3WGJA 2UZ1A 3R5TA 5KWVA 2ZXWC 4KHPB 2OFPA 2Q1TA 4ETWA 3LDTA 1IURA 2CSUA 5ESWA 2H0QA 1RE1A 5JOQA 1CETA 1JX6A 2TYSB 2YZ2A 2GUWA 1V96A 3I55V 4H6XA 4IZHA 4BC0A 4V24A 4ZHQB 2HWXA 4L4SA 3ZEIA 3ABRB 2E37A 4K3VA 4ZHQF 3UMBA 1IDSA 4BTEA 1D2HA 3PQ2A 1IVYA 4A5SA 1ZRSA 5IWAO 2NV2B 5E9QA 2IEDA 2GT1A 5F2VO 2ODTX 2Q28A 5LQAA 5D87A 2VP9A 4HZGA 1B8NA 1NQWA 4UUPA 4Y30A 3L0SA 5FV4A 5E6SA 4AMGA 4F6LA 4O2AB 5HBGA 2CGEA 4P4LA 3SCZA 5CBGA 1NPYA 5KTMA 4O2AF 4X64B 4IO0A 4I1OA 3REOA 2ZPAA 4N47A 4XPIA 2HKIA 2NVBA 3HM2A 3B2EE 2YXZA 4O2RA 1QHGA 3ORRA 3A3KA 3QOXA 1UZMA 5C4MA 4B8YA 5I9IA 3EEQA 5LWQA 4K28A 4CEIB 5F21A 4GUNA 1QCYA 4BFVA 2RJNA 4WCFB 2A9VA 1N32O 4RVSA 2HWWA 1OV4A 3IMFA 2DC1A 2FEPA 3I53A 3EARA 4Q3EA 5TPZA 4TQFA 2GPTA 3Q8HA 3LBAA 3BD6A 1HMYA 3HNOA 2XYQA 2WZDA 3PITA 4EPTA 4D45A 3KHSA 3RYHA 3L7YA 1JZSA 5L4NA 3CX3A 5ABPA 4JBNA 4GX2A 5ALPA 4JKIA 3BJRA 2P9BA 2B94A 1EIWA 3ROKA 1LX7A 4BVJA 2FRDA 2X1LA 2R8PA 1UK7A 1N36O 3QOYA 2IGTA 4BAGA 4UM9B 2FSVC 4LF9B 2H5EA 1AKMA 4FGJA 3I73A 4KUMA 2JFYA 1GZ0A 1U40A 2F43G 3H1EA 1QIMA 1NF2A 2YJZA 4DJFC 1Q2XA 2GCIA 4WINA 3A1TA 2P69A 4HEHA 3NYQA 4J0QA 3C4QA 4KRGA 3RJ5A 1OJLA 2HBQA 2GGSA 4K6OA 2AJDA 2I29A 4KPUB 1L4HA 2OC4A 3PTAA 2CJFA 4LJ5A 5BOSB 3U1BA 2YWEA 3IXQA 2CXXA 4JYYA 3A6KA 4CTMA 1A0OA 3KELA 1ESZA 5LKAA 1JB9A 5DHUA 4KK4A 3ZH9B 4B1FA 4GLFA 4NEGA 1W1IA 1DXHA 3ME5A 1M93A 1ORDA 2QYOA 2Z30A 5HJ2A 1EGAA 3LHSA 3ULKA 3GLIE 4I7EA 3ICVA 1MAVA 4W7SA 1JPNA 2A7XA 1W25A 1XXHB 2GFQA 4FZ5A 4MR7B 5KTOA 3GT4A 3BPSA 4Z4CA 1XKTA 1G9XA 3PNLA 3OA2A 3SJ7A 4UATA 2DHEA 3F7MA 3QRWA 4GH5A 4O3FA 1XBTA 3FPIA 2CLHB 2DFDA 3G1TA 3UGJA 4MQEB 1Y8CA 1PR9A 3NP7A 4Z2WA 1UJ4A 1RP7A 4B0OA 5FUXA 4M55A 3N27A 1T9KA 3LSYA 2PIDA 3GMSA 4QEDA 1X74A 4CL0A 1F23A 4KVFA 5JNUA 1NBOA 4FB4A 2BEWB 3I2YX 2GWRA 2QTNA 3L4EA 2C4UA 3TW8B 2JAUA 2FN3A 3CC8A 2YXNA 3R3UA 3OE5A 1Q6ZA 1ZWZA 1HT2E 3LAWA 4LK3A 2TS1A 2C9CA 1AUPA 1LV8A 5KSPA 1LQUA 4OHRA 4EGQA 5JJEB 1W87A 4W99A 4RHAA 5KDDA 3KU1A 2QSYA 3BAZA 5EZSA 3DKIA 2JI9A 2GTIA 4IH1A 1KYTA 1EFHA 5CLQA 3CCQV 3TZQA 4QHSA 5EA2A 4BOYA 1YB4A 3ESZA 4IFBA 3KLNA 4YR7A 5E2AA 2W5UA 3NHZA 3ZBUA 2HT6A 4ZKDA 2DM6A 5K3FB 2G40A 4XX1A 3LVFO 5C4IA 3CPWU 4N39A 1FE8A 4E0BA 2NAPA 4E13A 1E59A 1A2QA 4XDZA 2V0GA 3U0BA 2WWVD 1D07A 4Q21A 4BFCA 3VI6A 3PGVA 3ZGLA 1R4NA 5JCJD 3AETA 4MJ3A 2AFIB 1M7BA 1ZX3A 1G5QA 3SC2B 3OFNG 3AJAA 4ZAVA 2ERXA 4M9XA 4CGYA 4V0ME 3E7PA 4R8KA 1BD3A 4E2FA 3LUBA 1KYIA 3E22B 1N2OA 4ND2A 1MO5A 2DYSC 5D84A 1I36A 1G7TA 3C5HA 4LHSA 2H1FA 4PD4F 4JH0A 4TWZA 2RJZA 2QXTA 3H5LA 3ZK7A 1UEIA 4D8TA 3HXQA 5LBQA 1DX9A 5IG2A 1ZSNA 2V4ZA 4DFDA 1YVUA 2CVFA 5BPFA 3OLCX 3RYIB 4NS4A 1VOTA 2EWVA 1DUVG 2ZB4A 1MPXA 4K2HA 4O63O 1FU7A 4N3GA 4UVGA 5E8RA 1F06A 1FFSA 4JEHA 2ZR8A 5AKLA 2ZU0C 2VRWA 4U9HS 2WZQA 1EZ4A 3EA5A 2NYRA 4G07A 1D3AA 3UHFA 3SY8A 4GOKA 2VNHA 4REQA 5DGHA 4M0FA 4LZNA 4EO9A 3HS3A 4RDXA 1B3RA 1QKIA 1VQLF 2HSJA 5AK5A 1F0PA 2WKWA 5K3OA 2EKLA 5EIOA 1C0PA 1L0LH 3DB1A 1ENZA 5JJJB 2IHZA 5D2CA 3VOSA 1AZSC 2R7NA 1MC4A 2VSFA 3D01A 4RV4A 2GXUA 4Z7JA 3TETA 3UN1A 3GJ6A 3UK7A 2UUAO 5B7GA 3KD3A 3UIEA 3MWKA 1T9HA 4OA8A 2ZNJA 2VUTA 1Y1TA 1SHKA 5IT4A 1SF9A 1FVHA 3IEXA 4ZI2A 3RLFA 5FT9A 1A1VA 3E1GA 1DJLA 1UMCB 3EG9B 2G4LA 3K2BA 4B4DA 5H6RA 4ZANA 1A50B 4S1TA 3QQPA 3EIOA 3TGPA 2ZT6A 3C1AA 4L22A 1SXGA 2ZDHA 4JYAB 4DV3B 2RHCA 3URKA 4B7EA 3G23A 2HP0B 1NPDA 4JSRA 1CUEA 4EFDA 2Y0PA 3KYJB 3UHOA 5I9SA 5FAXA 3M89A 4HD8A 4OF4A 4H4DA 4MAMA 3NT5A 5EE1A 5BQFA 4HATA 2JLCA 1CUWA 2UVPA 3CO0S 5AXCA 2CUGA 3C4VA 1RM1B 5DK4A 3WQRA 4MGIR 5C37A 4KFSA 2I7CA 3BMNB 5K09A 4BAZA 1GGNA 3CZMA 4JT9A 4YK7A 1Q1NA 4KN9S 4NL4H 4MICA 1TZ2A 5L3DA 1S5LZ 4NABA 1P7GA 1ZD4A 1JGTA 3AGKA 1XTJA 1MLDA 3DZDA 2ALEA 1NIPA 1AURA 2PRYA 4H1UA 5C5EA 2IOYA 1R1DA 4B6JA 4MUFA 1HETA 3R2JA 1Y98A 1UF9A 3HPRA 1NVEA 4OXXA 2NV6A 2OD7A 3O4VA 2ZDIA 3BJIC 1DKLA 1DCMA 5DFAA 2XAUA 5I4CA 3RBAA 2QKYA 1XJQA 1BGWA 2A14A 3URMA 1F8UA 2IEAA 3TRKA 4Z2AA 2B33A 3L1HA 3COZA 2VHJA 3BXGA 1SQBH 1YRLA 5LN1A 5H9CA 4Y6RA 2V3CC 1NP6A 3JYHA 1O8CA 1GMGA 1RBQA 1KXZA 1J21A 3WKCA 4MLDA 3HJGA 2ZIZA 1SCIA 2JGUA 2JK0A 1GPWB 2Y6VA 3P0FA 1XVVA 3T9BA 1O94A 2JD0A 3HXOA 4RJKA 4URFA 4JUBA 3AM5A 2WA3A 3QVTA 3GFOA 4UJ5A 3LUJA 2QM8A 4B7ZA 5D5QA 2GEKA 3OURA 1WBBA 2UYPA 4GYJA 2H18A 3DPUA 3QEKA 1VL0A 5M34A 3HUDA 2GTPA 1BRMA 1OSNA 2GTSA 1ML3A 1N25A 4DY6A 4UXIA 5GW7A 3NHFA 1A5TA 4RPLA 1OX4B 1JPVA 1N5DA 5DTJA 1JT9A 2VUSA 1ZD9A 2J9RA 2WPNA 4K3UA 4E7OA 4N76A 1QG0A 3NCTA 4BVAA 1BHO1 2HF8A 1PEAA 5ESRA 4CL2A 1B04A 3BHMA 1ECCA 2FW0A 4F2PA 3FLAA 4KHPO 1CRWG 1QYIA 3PNPA 1KQSU 5JDIA 1FP7A 1VE3A 5HQ3A 4BT7A 3LQYA 4KNWA 4BNYA 4NY1A 2AN3A 2G71A 4K8XA 3T3OA 5JXIA 2PNFA 2CVLA 2ZVJA 3GHYA 3HFRA 1E7WA 4LIPD 2XAJA 1DZ3A 3FXAA 1D2DA 1W85B 1MAHA 3ABUA 5A6SA 1WHSA 5AOVA 3MT7A 3BAFA 3RT3C 4PXAA 5KYVA 2WAAA 4HQNA 2VQ3A 4TTPA 1V1MB 2BT4A 1WPGA 1Z5WA 3OJEA 4MHSA 1V55C 7GPBA 4PN7A 1Z4OA 3GCWA 4GPEA 3CRQA 3VR5H 2ALJA 1WPBA 1ISPA 4LZWA 4DW1A 1YQ9A 1EN5A 1RC1A 1NKSA 3L4JA 2O06A 4UTRA 1R88A 4ZOCA 1KVSA 5F1PA 2QD4A 5ITZA 1PD0A 2QV7A 1TQ4A 3ODGA 6GPBA 4JJAA 1W4CA 3GLRA 3RVJA 1EMDA 4WPGA 1O3YA 4YRBA 2Z95A 5KTPA 3PFBA 1XEWY 4H60A 5KHIA 2RB9A 4BNWA 4MHOA 3GLSA 2CAZC 3LGAA 2QSAA 1DAOA 3BJMA 4F2GA 3IERA 3WNQA 2YMMA 2DLDA 2NTEA 1PJCA 3C43A 3HKBB 3LE8A 5ISMA 2PZEA 3PCTA 3R3SA 1U0JA 5DTRA 2P3OA 5EFOA 3I3FA 3TDKA 3A8TA 4I9QA 1CXZA 1YI2V 1WV1A 4IJVA 4RD1A 2Q3EA 1YRQA 1T4BA 2J8ZA 1V7QA 1GGVA 1AZWA 2LBWA 4LXGA 3UJ7A 4JI3O 1G20E 1EBFA 4K9PA 3GA7A 1AZTA 3ZJ4A 2R9AA 2FJUA 1GNPA 2HQSC 3H83A 2QTPA 3K7EA 5L7YA 3D8UA 1G8YA 4LGMA 2V7VA 2ZQ5A 3BMOA 1OV6A 1W49A 4J3FA 3SLKA 4BNDA 4E5MA 4JMPA 4R40A 1FSSA 3G7SA 1E89A 4QGFA 3WXMA 3OTFA 2QN8A 2ZTVA 4MUYA 3NTRA 1R5OA 2ODEA 4QPCA 1O97D 3REQB 4G4YA 4Y6LA 1EE2A 1LDGA 1E66A 2EGUA 3W4KA 1ZS9A 4QRDA 1J99A 4Q1FA 4BNNA 4RXTA 2Q45A 4C9BA 1FP4B 4MW7A 3ANLA 3B4SA 4RVHA 4DREA 4CM4A 4C6TA 4CKWB 4AKHA 2V9ZA 5EIHA 2YL2A 3J7TA 2FJ0A 1DRVA 1DC6A 3WWOA 4BTLA 3RWRD 2C3PA 3SPXA 1W4BA 1R0XA 2FPOA 1SXQA 1IPHA 1LPMA 1O6FA 2HEIA 4TZKA 3AMVA 3RYFB 4J0CA 3U39A 1GUDA 1TKRA 2YIJA 5AI5A 3HLKA 3G5MA 1N0UA 4J7AA 4AS1A 1NDQA 4IXTA 1KC3A 1FS0G 1QGUA 3N70A 3IC9A 4PYKA 3ZHXA 1N0NA 1UZLA 1MSWD 1X0XA 1NNUA 2YZNA 3V4RA 4RS4A 4UNPA 3TZKA 3HJRA 5JMTA 1WVGA 3BWEA 4HDAA 2EOAA 1Y89A 1QZUA 2BP7B 2JH3A 3HJAA 4IOKA 2C83A 4ABMA 5BR7A 2XUQA 2VF8A 1QG2A 2BE3A 1E2DA 2GXAA 2B8WA 5AH0A 1OIXA 1EUCA 4WXMA 1JSLA 2ZRJA 1C9JA 3SXUA 4AM8A 1ECGA 4P4SB 3GVPA 1Q90D 4PZ0A 3WYEA 1IMOA 3NM5A 1M9NA 4X9XA 4TSFD 1FDVA 3U0OA 3H1KH 4PYMA 1Q7YW 3DT9A 5C1OA 5AW5A 3NR2A 2NUPB 1BDBA 3OCXA 4U3JB 1GRNA 1P29A 5DM60 3DE4X 2VF5X 3U7GA 4B6EA 1YJNV 1WTCA 3FPCA 3TTXA 2HLPA 5IDXA 2P78A 2DGDA 3CE2A 1PZXA 3I9KA 2QX7A 4KH0A 1KO8A 4BN4A 4QICA 5AW1A 1C9NA 4YAWA 2V45A 3HY4A 5F52A 5FH9A 4R54A 4IGGA 1TOAA 1E2IA 1YR9A 1VJRA 2VIIA 1O95D 1PJSA 4DA4A 1SVLA 2X23A 3JASB 4G97A 1QO0A 3A6JA 1T91A 1EZJA 4WBXC 5KNLA 4P1ZA 3LC7O 4J0DA 2Z04A 4UAGA 5B5EZ 3IPYA 5IK2D 2Z8ZA 2NTNA 2ZIWB 2CGOA 2KTVA 4L4ZA 4TYYA 4N7MA 4QVIA 2GCPA 3WOVA 1SC4A 5BUQA 2Y05A 1F7VA 3IEQA 3FAZA 3CC2F 1Z63A 4NS1A 2Z58A 2YHIB 1ODIA 5AI8A 2VNJA 1LB1B 1D7AA 4UZFA 1DRJA 3L5KA 1CN7A 3F71A 4P30A 1WJGA 1PJAA 1GSIA 4DXAA 3G49A 5JCZA 1RXVA 2EARA 4WV3A 1XEXB 3QKRA 2VQEB 3IHWA 3ESJA 3IVGA 4R8VA 1GV0A 2CJWA 1B6GA 4DA8A 1N8TA 2GM9A 5LQUA 1BWSA 1FRFS 3KTFA 3LYHA 1U3DA 1N6LA 1K75A 2RG7A 3C8UA 4MWBA 4ARBA 2XA1A 3VX3A 1YUNA 4B2LA 2UXDO 1TJ5A 3EWIA 4RFSA 3W2TA 3VGJA 3BVPA 1VGRA 3I64A 2I8LA 1UC4B 4MVWA 3OFKA 4G0YA 4ENRA 1BGYH 4LTMA 2H92A 2ZJOA 1P7BA 3FRJA 3GV0A 3LDFA 2ZUEA 4EG3A 2JS3A 4DLUA 4M4SA 1G19A 1RRKA 3GZNA 3AK2A 3E5RA 4DV3O 1KDTA 4AWAA 5E4TA 2RK6A 4F4DA 2JVDA 2VOJA 3RYTC 1RS0A 1HK7A 4RMNA 5TC4A 2QJRA 1GIAA 3QKIA 1X7XA 1U3WA 3VKUA 1H0RA 4QT0A 3T3MB 1JVMA 2V5VA 1VBMA 5IM4A 1FFHA 1XWIA 3JQAB 5CBKA 3EZXA 10MHA 3F7OA 3I76A 2X0IA 1V7PC 2P0YA 1PGJA 3O83A 2J32A 2PTHA 1Y3AA 4F86A 2HJRA 3CLHA 3EQ7A 2HC9A 3H0KA 4Y0NA 1M3SA 5IE9A 1BU8A 2C00A 4Q18A 3EW9A 5EHNA 5A1JA 1V4VA 5EO3A 1E6WA 3IE2A 5KSOA 2DU8A 4DEXA 4S1OA 2FNAA 4DCNA 1MABA 2QQFA 1PP4A 4ND4A 1D1PA 4WCEV 4JLVA 2IIVA 2OLKA 4AS2A 2QW8A 5IJ0A 4QVKA 4XB2A 4YYEA 1CUJA 3P96A 2JEUA 2OHGA 5HYVA 5CITA 1L9XA 4FZ1A 4CFSA 2PMFA 3FG9A 2Q46A 5DHAA 1MO4A 4TWRA 3OTOO 2EP5A 3GJQA 4Z4EA 3ITEA 3PYXA 2AZDA 4DJJA 2CLEB 3IMPA 3ZDXB 1QVVA 4UM7A 3WQBA 1EFRA 1UFOA 3ZDAA 1XMOO 2RHLA 3FDXA 4BYMA 2R9VA 4IJ6A 2B36A 2I3AA 2JD1A 2ZYHA 1SBNE 1O96B 2Z1FA 1V1RB 3EVKA 5CX1A 3H0CA 4YP9A 3MMSA 1HNXB 3IBYA 2OO5C 3SJBA 5EJ9A 5KJ6A 1QF9A 1XBIA 5LM3A 4LAFA 3NIWA 4DXHA 3QE9Y 2K6GA 1Y8QB 3D6MA 3TW6A 3KFLA 3WL3A 4G0XA 3OBWA 1P4RA 4ME6A 2FETA 2HQOA 3RFCA 4LXIA 3DV9A 1M5TA 4G3XA 1XEQA 2EBHX 3LBFA 4DUYO 2HJSA 1TTHA 3B77A 1RJ9A 4YRMA 1C8BA 2QHXA 1VE1A 2TSYB 2HCBA 4DSUA 2PY6A 3ADKA 2VAXA 2DY1A 1JSRA 5TQVA 1CZUA 2WG1A 1VP7A 2OESA 3L73H 1NI4A 4GU5A 3PI6A 4GYKA 4FI3C 2C8LA 5GVSA 3TB6A 4IKEA 4B3CA 4KPFC 3DMHA 2HYIC 1SUCA 3A7EA 3E3LA 2QRHA 3J7AR 2GD2A 3D7KA 3WLFA 2WLLA 2RDCA 4Q1EA 5FBQB 1TT7A 4TL8A 4FS8A 5KINB 4V3BA 2GJKA 3EF0A 3EVBA 1ECJA 4UU1A 4C81A 2ZIAA 4F56A 1OXKB 1DRKA 5IXYA 3T94A 4LDJA 3GRFA 4JSYA 2GCOB 2QMYA 3JAKA 1NVXQ 4C0JA 3B7GA 2YV3A 3GY0A 2NQTA 1JL3A 4MCAA 4DLZA 4LF5B 1T0IA 2F64A 4YLGA 5DN6A 3T7DA 5AO9A 1SUBA 2A0XA 3ZV3A 4XWOA 5KNCA 1T4CB 3F8TA 3IAHA 2WKQA 1WW3A 4RUEA 2X6QA 2AOUB 4OSPA 3P9ZA 4Z3DA 4XLZA 3QI2A 2G7ZA 4YJFB 3MTQA 1YKFA 2ZJ2A 2HI0A 2WJPA 1OREA 2W6ZA 4UD6A 4ZC1A 3WK8A 3ILXA 3F97A 2WSIA 4O4HA 2GBCA 3R9XA 1J20A 3O8RA 1TZBA 4QGPA 5K20A 2E48A 5FFNA 2HIHA 2W37A 5BSGA 2DQ4A 5JJ5A 2JVIA 2H7XA 3IESA 1ANKA 2FH5B 5L3ZA 3ZWMA 2QVBA 1DX6A 4N7RA 1Q22A 1AHHA 2CYBA 4ZEMA 3ZVMA 3K0CC 4L5JA 2PCJA 4D02A 3QFRA 5AI0A 3VV3A 4AJ2A 4I9HA 3RN4A 3DQZA 3CM0A 4QUGA 4IVRA 5D51S 3STWA 3LRPA 3OQHA 1PDOA 4P2ZA 3PF8A 2IS6A 4GI2A 1PJLA 3FMVA 1YRBA 2Q1XA 4QQ8A 4QYXA 4N9QA 1FDUA 4JP3A 3ANMA 3R6DA 2BM9A 2IL1A 2G1PA 3LLSA 3RIHA 3RA6A 4D4KA 2AN4A 3T3IA 1T1IA 3OE1A 4EHJA 1NF8A 4XYEA 2WHQA 1KTVA 4C4OA 1AQJA 3CUTA 4G86A 1J7KA 5HRCA 1HKHA 1WRBA 4QTYA 4BO8A 3B9BA 4W4LA 3QVLA 3LW7A 4RWUA 2YMQA 1OROA 1VLZA 3W2EA 2TRSB 1V2HE 2FAXA 1KI2A 3IQGX 2AG6A 3X2SA 3K5NA 1M6YA 3X3HA 3T7TA 3VI3B 4K6KA 1VLJA 1ST3A 1NU1H 4X41A 1GGKA 3CPQA 1OWNA 1F2TB 3IEKA 1N6IA 2O5RA 1ZITA 3DL0A 3V2IA 1BDMA 2XCOA 2Y1FA 3F5TA 1AD2A 5IWAB 2E4WA 3UMGA 3AT1A 4U00A 1ODLA 4MEJA 3OZFA 3LECA 4N21A 4DRXB 1XZLA 3ZU4A 2PDAA 2L35A 5DJ5A 4DLNA 4JYBA 3IQZA 5IT5A 1G63A 2R48A 3HDVA 5J4YA 1U7OA 1E3QA 4BNUA 1R4MB 5J2UB 4NG4A 4CH6A 3K0AB 3JCZA 1Y48E 4HAMA 1WU8A 5J2UF 3TD3A 1VQ8F 3KZVA 3K0GA 4OAPA 3BD9A 2FPGA 3H5IA 2A59A 2HFEC 1XCPA 2XZOA 3ZQ4A 3D36C 2LBPA 3W6OA 3IKLA 1JOYA 4XQ9A 1AVMA 1KOJA 3ZGYA 2WIKA 5ALSA 1QYRA 5IAGA 4KODA 3W06A 2GI4A 3WRXC 2ECOA 5K4GA 1V95A 5CIYA 1N3IA 1QSGA 4KU4A 3LO5A 3E7WA 1JIUA 3JD2A 1ZTEA 4JJEA 1QHTA 4E14A 1Z22A 4BC1A 3IT3A 5CVTA 2AMJA 3V2HA 2BBOA 3HB5X 1QRDA 1NJGA 5AM4A 3HMQA 2XYRA 3AR7A 4KO8A 3ABSB 3U4QB 1XOUA 1NR7A 3W78A 2OO7A 1Z6QA 1M8PA 3KKNA 1VL1A 1ETUA 5A04A 1WIWA 1NMYA 4JBGA 5HEKA 1GZ3A 4R50A 3RO7A 1B1AA 2GD1O 5IZ4A 2J9YB 4XA8A 1CR4A 3ORFA 2GUGA 1ATIA 4J9ZB 2ZWAA 1T8YA 1DQSA 5FNVB 3KO8A 1DUIA 4HGRA 1PUIA 2JIQA 3QMPA 5FNVF 4E51A 1XXHE 1R12A 2PU7A 1XLVA 3SC6A 5DTEA 3LX5A 5AVYA 3ELCA 2R79A 1O6CA 2V7QA 5AJWA 3VMFA 1OAAA 5EOVA 5EIBD 3L0BA 1HYHA 1TUIA 3T41A 4AY5A 2RAPA 3I2HA 5I6DA 1NLFA 1COWA 4IHKA 3AEKB 3L4SO 2XUGA 1PZNA 3SXJA 1DAIA 4B73A 4EHAA 2GERA 4ENTA 3N4ZA 2NU9A 1JHQA 1H2LA 4DLYA 2ZIUB 4EHFA 1U6IA 2B9VA 4NU6A 2DW4A 1FAFA 2JZCA 1EDDA 4R01A 5DIFA 2FOXA 3TSWA 1E79G 4FFMA 3OD5A 3VU0A 3GB9A 4J9VA 1Q3KA 4I55A 5ALMA 3DP7A 6PFKA 1BG6A 4RK7A 4UQPA 2OBFA 2OCAA 1VE6A 4OHZA 1VMEA 3WSTA 2B1QA 3C3SA 4GOMD 5IY5B 4UBOA 3ADBA 3GLUA 2FYTA 2YR0A 2F4NA 2JFHA 3SBDA 1BJKA 1KRHA 1Z82A 4MNTA 2D5CA 1Q7CA 3B1FA 4X54A 2XOKG 4X66B 1V5EA 2QTFA 1GM5A 2I99A 1WJZA 4FCVA 1Q6IA 1ZGBA 4A8PA 4LI0A 4U6NA 3UMYA 3D3IA 3PPXA 2HEPA 4DNOA 2EFCB 1YDWA 3UWPA 2N1BA 4TYPA 3V8QA 1OLXA 4MKFA 1I13A 4LYHA 2C4KA 5BO5A 1Q82H 5KTSA 4KXWA 1IYZA 4JAUA 5D6OA 2HQBA 6CHYA 1CLEA 4B83A 4KL8S 3RS9A 2H8EA 2WLNA 2ZIFA 3DOEA 1IV1A 3VYVA 3AVWA 1NVTA 2NWQA 4C8IA 5FLXM 2I2CA 4EARA 3ZXYA 1P1JA 4CF6A 3S3WA 1Z6YA 4IOLA 1GG2A 4F5WA 3RJTA 1U0TA 2E4ZA 1YAHA 4UZSA 2VJAA 3FI9A 1ISSA 1SUWA 1ZWLA 3RS5A 2FUG1 5LYYA 3K16A 4PI0A 3FHOA 2XIJA 4QXOA 1LZLA 1MJHA 2A3QA 4KGVA 4LRWA 2FB5A 2YWGA 2XTAA 1HE5A 3TM4A 3JRWA 3HGTA 4MV5A 4R0NA 1NQXA 4TQ9A 2ZAMA 1KPIA 2Q3DA 2CL6X 2WU4A 3TMYA 1DO2A 1XMXA 2Y67A 1U8XX 4KIGA 3ZZUA 3A6GA 4AL4A 2ZFUA 1X1SA 1RAIA 2I22A 1Y6ZA 1FYWA 2C0QA 5E7IA 1TYBE 4TVOA 3O8QA 4DQKA 1UBRS 1KDPA 4MEBA 1YQNA 1JZTA 1MEJA 3ICCA 3M6IA 3U80A 2J5BA 1RADA 3P0HA 4JUAA 3PENA 4AW9A 4ZRNA 4LJKA 4BPRA 1EXVA 4U7DA 4M1WA 4IJWA 2X0FA 3MG9A 4YJ3A 5BQOA 3DOIA 3KVYA 3T38A 1RQGA 3I37X 2UXCB 1A77A 3E5MA 2BV3A 3VM6A 4PLYA 4L8YA 3VU3A 1S0VA 1N5OX 5C51B 1PYGA 4PGFA 4GP6A 1E9FA 3UT6A 3OQBA 1LX6A 1RYMA 3HR0A 3WBFA 5A9RA 721PA 1VQ5F 1GO3F 4OHCA 3G5AA 3PD7A 1PVDA 2PANA 1TDJA 2XMGA 4QPPA 3GMDA 1HG0A 1TZKA 2QAGC 4C5AA 2D00A 3OPYB 1IQPA 1QTQA 2INGX 3DB2A 4JOCA 1TYZA 3KHNA 3QHQA 1YI0A 5DEIA 1M73E 2LGWA 1QIEA 4IEFB 1U81A 2XNSA 3L0OA 4GE0A 3HBLA 2WHPA 1P39A 2BFEB 1EINA 1S2MA 3ZLTA 1FQJA 2ZUDA 2VXBA 1RHJA 1Z36A 4PIPA 4QQRA 4IIXA 1GPLA 4L0QA 5ARBA 4UU0A 4RAOA 1NUQA 5FOXA 2Q5HA 1XRJA 4P9PA 4II7A 2AOXA 3GVXA 3DE5X 3RFXA 4GZLA 4QYWA 1A8PA 1N7GA 1DWQA 3MJCA 1LUVA 3BK2A 4CKXA 3CNHA 3HXLA 4WD3A 2QRZA 3BB1A 1VEWA 2ARKA 4URHA 4C76A 4LF5O 2VZLA 5EXDA 2VJNA 2BFAA 1IXSB 1L1RA 5HFNA 4GZMA 1YB7A 3ANNA 4I46A 3MTAA 1DAMA 4DIDA 2IELA 1U3PA 5A2QN 1B0AA 2G5TA 2O50A 4BW0B 1BQZA 2LCFA 3CLTD 2A0LA 3DEHA 1XQ1A 2O07A 1ZJ4A 1GCAA 1SEPA 2YWJA 5K01A 3EUFA 4MUHA 1K27A 3EDOA 4QREA 3CEJA 3ETDA 1B93A 2EATA 4GRIA 2F43B 5HBRA 2P4QA 2IZ0A 3GJ5A 1QU2A 2X5KO 1CD5A 1OCCB 3PEUA 2NU7B 2P0EA 2OP1A 4FFNA 4NBWA 1QIJA 4YGYA 4ARZA 1TT5B 4X1IB 3L6EA 1K1EA 5KOHA 5THXA 3VTAA 2ECKA 3OR6C 1XRSB 5CH8A 4FJ2A 1ZH2A 3T7KA 3GJ3A 3DTUB 1VTKA 1YHNA 3A4VA 1U8CB 5T8KC 4Z49A 5KNDH 2FSUA 1P1FA 1E3EA 1S72V 2OILA 1JFRA 4HNSA 3EZ9A 3B82A 4PG4A 1EU1A 2D6FA 1UDRA 2WIJA 2H16A 5EKXA 1AF7A 3MMZA 3QBVA 5FIUA 1Y1KE 3BJZA 1W9HA 4XM0A 2ZJ0A 3IV9A 2JNWA 4LBWA 4URXR 1L5NA 1F6BA 1VF6C 2WAYA 1YA4A 2YY6A 4C1BA 4Z1MD 3ADDA 3C6QA 4YRTA 1ZR2A 2G1UA 3WLMA 2WICA 3D9QX 1Y6QA 1IU9A 2NNWB 2C1XA 3GP3A 1XTRA 1M56C 5MDHA 3FIUA 4FLFA 2IT1A 4XRGA 2QUZA 1P9LA 4XAQA 4X7RA 2AKEA 3FPJA 3TVYA 1KC8H 4ZYUA 2BMWA 1O0CA 1CE8A 3ECCA 4UCWA 4Y6GB 2PLFA 1RR6A 4CH3A 1KF0A 3KSMA 1W4RA 2GJ9A 1DQZA 1KY3A 5CAEA 2WJVA 1ZUWA 3I05A 3SS9X 1NJFA 4M7RA 5K0BA 3SYLA 4J07A 3RV3A 3RUEA 3C2QA 1HKUA 2BGRA 5IS2A 4EF5A 3H6GA 5JSUA 2DT5A 1UIRA 2HY7A 4ZHVA 3FF4A 5LLSA 5DX1A 4REMA 4P7KA 2BHRA 3MJEA 3W7BA 4UB8Z 2VDUE 2Q3BA 4XEHA 4P3OA 2IU4A 5EGSA 5IM5A 4TT3D 3F6PA 5I9TA 1PX2A 2LBXA 2VNKA 2DPMA 2NUAA 1ZVQA 1I5RA 7ADHA 4UMVA 1ONPA 1ZGZA 4OXQA 4ROSA 2ZB8A 1Y74A 1NC1A 3L40A 2WSSA 2JA1A 1T0BA 2RN9A 1YU6A 4AJJA 2VCYA 3I9JA 1J9GA 1EGHA 1ZLZA 4EJMA 3OM3B 2R68A 3QXJA 4JBWA 2QLMA 5FRDA 3ZCXA 2OV2A 1VHAA 1AVTA 4E4TA 3WB1A 4A03A 1TEXA 3TSCA 1Z9BA 1H93A 1VQOF 3AM1A 5KYYB 3AFMA 3G4SF 1QB7A 1RJDA 3NKVA 4CLDA 1J7HA 3RIYA 2JJMA 1ID1A 1PK9A 5AM5A 1O0SA 2PX4A 2K87A 4JP8A 3RC8A 4EJFA 4WAUA 3QUCA 5KYXB 4MUBA 4M53A 3PGA1 2BI7A 3BK7A 2F55A 2JJ2D 1JHPA 3ELYA 3ZDEA 1GZ4A 4JI3B 1U0FA 1DCKA 5A4DA 4KIFA 4KXRA 4YRJA 4KIUA 2IYWA 3P9KA 3OFJA 4V0NA 2AX3A 4E09A 4RZHA 3OE4A 7REQB 2WYVA 1BVUA 1R0RE 4G65A 4GM4A 4RSMA 1FJXA 1UXOA 1S01A 2BJWA 2K7FA 3VTFA 1NBAA 1E99A 3FFXA 2ZSFA 5DNAA 4WXEA 4OQEA 5TLSA 2CHEA 1NVWQ 2PF4E 1HRKA 3NBZC 2PM8A 3WGGA 1K8AH 1M57B 2ZJ4A 5HP4A 2LP7A 4X45A 4CPDA 3CVJA 4RH1A 5DM70 1GPUA 9GPBA 3MT0A 1JR3A 3ZG6A 1LPPA 3P2EA 5AWFC 4YAUA 4Q20A 3T12A 1CCWA 2PUTA 1HNWO 3K5IA 4MRSA 1H0HA 1G8HA 2LFRA 2UU9B 1F60A 3AG4B 1JG4A 3OSUA 2QR4A 3I2GA 4EITA 13PKA 3G8AA 3STZC 5IN5A 2WPDG 3FAVA 4V0SA 1I33A 4MLCA 2NXEA 2RCVA 3EFOB 5JFTA 1A9YA 3B13B 1DI0A 4U1RA 2Q5EA 5EJIA 3L8FA 4F60A 2MQEA 1S76D 1ZN8A 3PTZA 3BFKA 1ULHA 4X66O 1R74A 2BCEA 4B85A 1OHHA 4XWKA 5B3KA 2IZ7A 1YFZA 5JAQA 1TC1A 3TFWA 1NURA 1GRJA 3AF3A 4B82A 4L87A 4MRPA 4G5YA 1U0RA 1B76A 3UYLA 2ASVA 2V4UA 2FR8A 4E21A 2RHGB 4B71A 3VYSC 2B5UA 4PC2A 3C41J 1A3CA 1WBDA 4JB8A 4Q6BA 1YNOA 4W9MC 3CW9A 1RXCA 1QUEA 3BF7A 2XWBF 4AMYA 4QQKA 2D0IA 1MXHA 3CJTA 4NTYA 1FYVA 2C2ZA 5F5XA 5TPZD 2XAGA 1YIJV 1KD1H 3JAMN 5DSTA 3L41A 4OO3A 1L8XA 1P7WA 4E5NA 3IBCA 3WGOA 2ZB2A 5GY7A 4CF5A 3F9RA 3BD8A 2J3JA 4KMMA 3T8YA 5EIEA 4TPKA 4B6OA 1RLJA 4E3ZA 3IJEB 4YPFA 3K30A 2VPZA 2C7PA 4UTZA 1LSSA 3VOBA 1MVNA 3PNQA 1WZUA 4HWPA 1JSZA 1EYZA 3JQGA 2C04A 5C8XA 4GX0A 1MOFA 2IP2A 1IQUA 2NO9A 3GT0A 2V7TA 3AUFA 8LDHA 2H7YA 2C94A 4HWSA 1TO6A 4ZVTA 5D7NA 1P9NA 2PA0A 4DW0A 4WE3A 4FDAA 4O4JA 3PUVA 1R6AA 4WZAE 4JLJA 1L8DA 1S02A 1X87A 2ZWOA 4NU8X 5CH5A 1UP6A 5G3YA 3LKZA 1DTOA 2F67A 4EFBA 5HM8A 3R7AA 3HRKA 3PYMA 3MHSC 3T9AA 3VQWA 4XDHA 5J4LA 1PG2A 3G9XA 3R76A 4F1JA 3IAUA 3S27A 2BY4A 1B6RA 1HOXA 5DB4A 4KTVE 3LUTB 5CFNA 2FKAA 4DCOA 2UXCO 3VPDA 1FU8A 5EQDA 5JT1A 3AYZB 2G08A 2CFTA 2OORC 4E5DA 1U7WA 1MA1A 2JGDB 4ENVA 1TAEA 2FUKA 3KLPX 2GZLA 3UMVA 4BLSA 5EE5B 4YIPA 1KE2A 2R66A 4PLZA 1XV2A 1JYFA 3NWEA 1K5QA 2YCBA 1F7UA 2W2PA 4G8CA 5JZSA 4I5DA 5HQTA 1Z15A 1Z0SA 2ZIEA 4PDRA 2R4UA 2UXDB 1NJIH 4RLHA 5DULA 4GEKA 2QTLA 3H3XA 3QNWA 5KNDA 3THOA 2PLWA 4HH1A 1TPZA 3PKIA 1GZ7A 3LRTA 2P6MA 4GWLA 4OI2A 2ZJ1A 4UUOA 4IUDS 3LO8A 1M2NA 1WCV1 5TF4A 5IKOA 1MW9X 4MQ4A 3G9ZA 4EVIA 1T4GA 2IUYA 2J3QA 2RH5A 1CQJA 3MEQA 1GN8A 5AK0A 3UZUA 3MBOA 4OKSA 5FTLA 3CH6A 5B2FA 3JYQA 3IC7A 5HA5A 4YB8A 1KKMA 5LGUA 1A9PA 2AFHE 3P4XA 1J8YF 1GU0A 2ZM6B 1PD1A 4D9KA 4L4RA 3RIMA 4LS3A 3JCMM 5KUTA 4HTFA 5BV1A 1QVWA 4MW0A 4Q9HA 2Y1GA 3RC2A 4GP7A 5DDIP 2VAWA 1E64A 1M2GA 5LBIA 1V11A 4I5GA 3ETJA 2ISCA 5B64A 2IPAB 2P9TA 1JSXA 3RGWS 2GTAA 3COSA 5D3MA 1VYHA 5JH7F 1BXZA 3LA6A 3A14A 3P9XA 3IVRA 2ADOA 3H8VA 3CZPA 4XFJA 4HLNA 4S05A 5K45A 3Q5GA 5B6PA 5TT1A 4RY9A 3CCFA 2WZBA 5EYPB 1FUEA 2ZJZA 3HKEB 4KVZA 1I2AA 3OTOB 4TYWA 1KBZA 4AN1A 4KGXA 1XHEA 1WBJB 2NSHA 2HJHA 3V3KA 2ZU6A 1PNQA 1TCCA 1QR9A 4FBGA 1L5RA 1XMOB 3PHBE 1SQVH 3WICA 4CM8A 3FWNA 2BSQA 3FNGA 3CMMA 2G4VA 2HREA 4QUEA 2WIFA 3DMFA 3OKAA 4W1SA 4IEEA 4GXQA 2RH8A 1K9SA 3GYBA 1FYEA 5LCXA 1X7DA 4R9UC 4WKOA 3OT5A 4G88A 2FTKE 3VOUA 2WNIA 3JATA 4C5CA 4EDHA 2MHCA 4MWDA 1BMTA 4BAYA 4ADSG 5G0SA 2WIGA 4OBWA 4C3UA 2QSZA 4IGIA 2A9OA 3LV8A 1N0IA 2AJCA 5REQA 3SGLA 5EAZA 3V2GA 3PQ7A 4DUYB 3D6TB 4A8JC 3OQPA 4UNNA 2JIZD 3LWDA 3LXUX 4U2FA 3EHEA 3L7QA 1J9EA 3SF8B 4Q6WA 4S04A 1RLIA 4ES6A 5KA5A 3P94A 1IL0A 3NXKA 3QPCA 3ZHTA 4E31A 1M6EX 1CUCA 1JLMA 2RAFA 2HK6A 1JNXX 3ZCCA 1U2RA 4INZA 1EFPA 1T26A 2GRJA 4BWYA 2GNPA 3HADA 2A86A 4CEJB 5B1YA 1YMQA 3VNAA 2BDEA 1KUQA 2IE8A 3WL6A 5GTHZ 2H5JA 4GFDA 3BZBA 3CCRV 5B7QA 4WA8A 3BCCH 3ROZA 2O5EA 2PI4A 2LQTA 3M5DA 3HSSA 5AJZA 1G7RA 3CT4A 5FL3A 2HV8A 4JX9A 2FF7A 3R3VA 5LB4A 4ZEVA 4QHTA 5D5PA 1DWUA 4L27A 3B1KA 4A6DA 5DE3A 4BLVA 4F8EA 3F78A 2ISQA 2BSAA 1KZ7B 1CKEA 1P7ZA 1SBZA 3K70D 1ZGHA 1ZU4A 5AHWA 5EMJA 2JLVA 3T4ZA 5B1HA 3OY7A 3WG7C 3W5SA 3SS8A 3KSDO 4MW4A 4DNQA 1ORRA 4TLMB 1QFYA 4WZZA 4JUDX 1RXIA 5C4GB 4R7TA 3V00A 3MWGA 5D6NA 4QLBA 4DA6A 1QM5A 4CMGA 1SOUA 1J2RA 2XYGA 3DHWC 3G6WA 3T1OA 3S06A 1E6CA 2DR3A 2Q21A 3KDSE 1OJHA 2EJUA 5E6UA 3U7QA 3KV1A 5KYWB 3E2MA 1IPAA 1WSDA 1CJSA 1SQPH 2YYZA 4AP6A 5CDFE 4M0MA 4W8HA 3D5QA 1N5IA 1EP9A 4XX0A 3ZD9A 2L19A 3SSNA 1RYZA 3MK31 4HGZA 3JVVA 5BW8A 3AVVA 5BSTA 3ITKA 3D64A 1FS6A 4B47A 1JP7A 4KKVA 3ZTWA 3TUZC 2AF4C 5J2TA 5D85A 2AFRA 4RNCA 4YCLA 2PWZA 4XCVA 1YR7A 3IAYA 3AWDA 3EPPA 5LLTA 2HGSA 4Q3DA 4UCVA 3OC6A 4DG8A 5JG7A 3AR9A 5KA6A 1CUFA 2PLRA 4IRXA 4ANFA 1ZM7A 3SOZA 4QRHA 3LRXA 4TS9A 2PX6A 3EXIA 2VC2B 5KTYA 1YFLA 3BMCA 2A67A 1WXHA 5T3UA 4ZHYB 3I55F 3QUAA 1YE8A 2AW9A 3FHJA 1P9RA 5FWXA 1RYHA 1RMQA 2VP3A 4ZBMA 2BFCA 3RQIA 2DMXA 4J8PA 4AKSA 2QJOA 3K94A 5JW6A 2YV5A 4UVCA 1GADO 2Q5ZA 3QYPA 4JB2A 4OGLA 3IC5A 4IQFA 2QMZA 2Y1WA 1ONIA 2HJDA 4ZV4A 4RDHA 3ICOA 4KQHA 4LCBA 4DC9A 4DM4A 1JUDA 4YTEA 4ZO8A 2UU9O 1C0IA 3A9WA 2GN8A 5IRCD 1OT3A 4FJCC 2O8EA 3BE8A 2N46A 3BXHA 4N5MA 5HTOA 5CA1A 4UTNA 1YNSA 2DYRB 5LMZA 1N8SA 4DIKA 3CY6A 4RJJA 3A6EA 1POWA 2NTVA 1L7QA 2FN7A 3LLUA 1BKSB 4JI4O 4B7KA 3VR2D 4WY2A 3HA5A 1Z4JA 5KDOA 4BNZA 3SPHA 3MXOA 4FTWA 5IAJA 3A28A 4NWOB 3QJGA 1QE5A 4LWZA 2F3TA 1UKCA 2FGJA 1ULUA 1E7RA 1TE2A 4P6VF 2JGRA 1SVWA 3FN4A 3KB8A 5DOZA 4OHMA 1VPDA 4MZXA 2ZUCA 3PT5A 4AWXA 3TXXA 2X40A 4ZAYA 1JKMA 2R8ZA 3QG5A 2CVQA 3L6OO 2ZVDA 4QOSA 1NBIA 1LBTA 1REQB 3ORHA 3PUXA 1MH9A 1HWYA 4V3CA 1OI3A 5CURA 1U5CA 3E9CA 4BASA 4FR0A 1KFKB 2I62A 2PZSA 1MIOA 3DG9A 3JQ7B 3EB9A 1AXEA 4W5OA 2EFYA 5IJ9B 4ENQA 2X0DA 4X8MA 3U48A 5K6RA 4GL2A 1Z88A 3TRDA 3F4LA 5LKRA 3WBJA 1PNLA 2ODQA 4YUWA 2QTAA 1X77A 2ZUVA 3UWMA 3MCVA 3FCSB 1E1RD 3F7NA 1TRHA 1WD7A 3FPFA 2GK6A 3WYBA 3N6XA 3X1WA 2Y99A 2WWWA 1VI6A 2GAIA 1UR5A 2FDCA 1T6NA 1NKTA 3WTCA 3GIWA 1N1GA 3Q9UA 4MW8A 1LW6E 2O0MA 5TPWA 2CZCA 1S2NA 4Q12A 3D2LA 3H2SA 1MTZA 1M1NB 4RY2A 1OUMA 2IUUA 3E03A 4C08A 2C4VA 3CVUA 1H94A 2VPYA 3E27A 1QD9A 3UK0A 3RRBA 3UG7A 1XZDA 1M8KA 1QE0A 1RDFA 1IHUA 3MN1A 1RWWA 4ZVMA 1AU9A 1L5GB 1CQWA 5G4KB 4OYRA 4YX9A 5CW1A 5C8ZA 3FZEA 1IM8A 3FYDA 2IJHA 1ZICA 4RMHA 4UC0A 1WN7A 3W7AA 2Z2JA 2VYCA 5DBOA 3I42A 1ZN7A 2HNKA 1YTFB 1U1GA 4G0QA 2FZCA 1XHLA 3NAZA 1NVVR 5FV7A 1CEZA 3OC0A 1TXGA 5JPCA 5HPYB 5FQNA 1U11A 4CGZA 2VGNA 4BO6A 3O7WA 2YYAA 3HFGA 5BYJA 1QO9A 5JISA 1JXQA 1UBSB 3EPRA 3PSAA 1NOIA 4W4TA 4CIYA 3LDHA 4N8EA 3UAOA 4DBLC 5B3SB 3ZGOA 3DL2A 4K9QA 4BS9A 5H2FZ 5LOVA 4L0DA 4AKIA 2BN4A 4NQZA 2KTUA 2HRRA 1W88B 5KC9A 1L9KA 3WB2A 3CCQF 2V9YA 4W9NA 2KB1A 4GPTA 2Q69A 3Q6MA 4QBHA 4QELA 4M49A 3O9OA 3KXLA 3L75H 4NH4A 4LXXA 5D7BA 4RD4A 4KIWA 3OU7A 1XZFA 3QX9A 2CMHA 1ML4A 2WV9A 1D2MA 3C3YA 1LSOA 1EVYA 2BTQA 1VQKV 4PO1A 4ZA2A 2I4TA 4MW2A 1U80A 4NJMB 3RVPA 1T1SA 5FPSA 1BOOA 4KG7A 1O4WA 3L5OA 1XL6A 1OCRB 2WU0A 1PJZA 2WHEA 4RFLA 2W0FC 1WCIB 1CF4A 1VF5B 2CV1A 1KYXA 4F71A 1I4EB 4KV7A 4M9CA 3GLFA 3G67A 4RNDB 3L74H 4UNRA 2ZM6O 3SHQA 2BGKA 5K51A 2VYFA 3GLHA 4IFTA 5IF9A 3EMDA 5JAPA 3D8HA 3GPLA 4PS1A 1ONNA 4V0LA 2OXTA 2Z3YA 4I1VA 3DKKA 4FYIA 5T64A 3GDWA 4DZZA 2YJ3A 4I4TF 4BT3A 4XQEA 2FPWA 3F5FA 3NUZA 2A35A 2J0VA 2YY7A 3EGXA 3A0UA 2NO0A 3ITDA 3QM1A 2O19A 3UF0A 4QUIA 3WGNA 5FL7A 3I8OA 3EEBA 3P2JA 2REOA 4I1IA 3AP3A 3ZUPA 4KXNA 3VR5A 3KCYA 3N2KA 2GVIA 4EB6B 4XLLA 4BWAA 1QO0D 5DH9A 3Q2KA 4HVTA 1WWKA 1I5YA 1UDCA 4TL9A 2HR3A 5FJ4C 2VK2A 1YBFA 2Q5QA 2XXAA 5DCYA 5LYJA 1H9CA 3OM9A 4CFYA 3ZJZA 4M54A 4DOMA 4QL3A 1U0NA 3DC5A 3KIPA 4ZCQA 2I6GA 4M1OA 4F9GA 5A6VA 3PS9A 2IE0A 3NC0C 1QNMA 3W05A 3P0JA 1B16A 3KUDA 3T0GA 3VDMA 3U49A 3E89A 5COAA 2VDJA 4JC5A 4P3KA 4F84A 2YI8A 2LRHA 3I30X 2D2VA 5FPHA 2EIJC 5DWDA 3ZDQA 1U97A 2OBXA 2MSCB 3LXXA 2DSNA 4H7IA 4A2CA 4PLPA 4YFYA 3W2IA 3D43A 2DKNA 4QOEA 1Y7PA 5EGNA 1JXMA 4P82A 3UCXA 1GCUA 2Q8VA 3ZZNA 3MCAB 3I3SR 5JRDS 4FGZA 2O3RA 2W2MA 1L0BA 1P49A 4B0PA 5FQOA 1JECA 3OOYA 2WTNA 1PJ8A 2XXBA 1FNBA 1EQUA 1WXGA 3CSSA 2JGIA 4PZ9A 4K1XA 3FFMA 2B2CA 1UQUA 5EEGA 3KZNA 5ALEA 1HE8B 3T5PA 2UZ0A 3VR4D 1D2CA 2K1SA 4JQCA 1P2FA 4R7CA 3GUYA 4B76A 1J39A 4PLHA 3EVGA 1S9DA 4IV8A 2DBQA 4KQEA 1GHTA 4WLFA 1SXJA 5K6AA 5L3SB 1WZIA 5FBKA 2O1EA 3CNEA 2ATKC 4HDMA 2IM9A 3LDEA 3GDFA 1U7HA 3LZDA 1RRVA 2CUNA 3EVFA 5JJNB 3SVLA 3ONVA 3BHNA 1QK3A 3HWX1 4EQ6A 4EHHA 3PPYA 1NVMB 2QUHA 4EMSA 4ZQHA 2A3NA 4IYIA 5DHQA 3KQWA 3OMIB 1SCUA 4I8XA 5FI1B 2BFDB 2P9CA 3FVWA 1MQAA 4MW6A 1T2VA 2OUKA 2YQZA 2AIFA 4F3CA 3X2QC 3UMRA 4ENUA 3HJWC 1JT2A 1WOYA 2HXGA 2W58A 1U4NA 1RZVA 2KHZA 4Z4IA 3FVVA 4XYBA 3ENVA 3QEJA 2J0EA 2Z3ZA 1TI7A 1MP0A 3N87A 3R3HA 2Y27A 2PL1A 121PA 5TJHA 5EQJB 1R0LA 2B61A 1OFUX 2VTEA 2IS1A 1RWQA 3IB3A 2QN2A 1L7XA 3ZI0A 3C98A 2ZNIA 5LQDA 3OPYI 1U1IA 4CKBA 5LB2A 1LC0A 2J0UB 4R3WA 3JD1A 1NM5A 2OB1A 2VYNA 2B20A 1NW7A 1TK3A 3GJ8A 1V9SA 5JCPA 1LI4A 3MD9A 3WS7A 4KBGA 1PFWA 4FM2A 5KAPA 5BT8A 3JARA 5L6MB 3N8KA 4IDNA 3SMQA 4NFSA 3KXIA 4ZT6A 5LPNA 1D5AA 3MRXA 1N33O 3G2MA 3F67A 5DMHA 2WF8A 2IPOA 1BXKA 1MN6A 4GM1A 2G09A 4BW5A 1AZLA 3KQSA 2BE7A 4Q9DA 4JJZA 1E6KA 4LV6A 5K3AA 4BLPA 1VC2A 1VJDA 5EK0A 4KXXA 1XRGA 2OV4A 4BV9A 4V0QA 3GP5A 2RIRA 3SFZA 1H2XA 3QPVA 5EWRA 2WFLA 3UH1A 3PN1A 4LNUA 5EMNA 3FYEB 3OX3A 2IHTA 1BVYF 3R7BA 5HZKA 2HHAA 3DOFA 4A1OA 3HCRA 1EA7A 2C7OA 2X5JO 4Z9FA 4IXNA 3L7OA 3HVUA 4PSDA 2G06A 2XVMA 3FYHA 4PYQA 1Y5LA 1WDTA 2Q0AA 3TLXA 4EAAA 3NVMB 3KB1A 3FLBA 4J2OA 2Z1DA 2B7LA 3J81M 1QZXA 4IIBA 4GOXA 4L8LA 3IB6A 3E3MA 4Q48A 1IB0A 2DG2A 2PZAA 3OCCA 1ZK1A 1VJ1A 2GAFA 3ZX5A 4Y3UA 1F3LA 1O2DA 2YUAA 4MVJD 3DZ8A 4FSXA 2BEVB 2GKGA 1KWGA 1XNQO 1QIDA 1QXSA 2ZYIA 2WKRA 4GUDA 1Q3EA 2DUMA 1TQDA 4H7EA 4MDYA 2QX8A 3OLQA 3JX9A 3BBLA 3B3JA 3FPKA 2PGDA 2W2KA 3QWHA 1ZH4A 4LOAA 3PR3A 1UOQA 3O85A 1F2UA 1GM9A 1DAEA 2D59A 1IUKA 2OGSA 5I7HA 2CCGA 3RUPA 5LDGA 3EVAA 3VU1A 3ABLC 3BWYA 1Z6AA 5EPEA 1GL3A 3E7FA 1Z16A 4KXUA 5EWMA 3IO3A 1TFUA 1Z8FA 1WTAA 4TSFG 3ZTYA 3S0YA 4X90A 4L07A 2WAOA 1AI6A 4Q0MA 1FXKA 3M2PA 4C78A 4YO7A 2Q6LA 5KOJB 2B98A 4Q7EA 3Q40A 3O5AA 3GRAA 5I9MA 1RJGA 2C98A 2NPFA 3B51X 2C8JA 1OI2A 2HTEA 3MWYW 1F5NA 3ZXSA 1KFBB 1XZIA 3P9YA 1Y5RA 2OHFA 2XUMA 2WLTA 4ZQIA 5CNMA 3ERNA 3HXPA 4HNUA 3BMQB 4DMHA 3EDYA 1H47A 4FEGA 2ZR3A 4YRCA 1W34A 4WJKB 1C3XA 4LYAA 2IRWA 2YBEA 1E6EA 1S3GA 3KTAA 3EDRA 4L1KA 4MSWC 4FOLA 5MGNA 3PJEA 1L5KA 2XQFA 4OXYA 1FLDA 3H6HA 3QVNA 2YWCA 1PL8A 1P1HA 3STLC 1ZM4A 2EL7A 2SCUB 4WWHA 4CM7A 2YWFA 1AUVA 1HNWB 1I7LA 4P2BA 4XW2A 3LVRE 4MA5A 2AC4A 3OJ0A 4CHGA 4Q3CA 5D5HA 1THTA 1F1JA 1YVRA 1CF9A 1P1RA 4TWJA 4IFIA 4HMQA 5EE0A 1GQRA 3CLSC 3T7IA 5AUOB 4UDYX 3C5WP 2X0NA 2PY5A 4XYMA 2ZJ8A 4KLCA 3OX1A 4GSKA 2IXTA 3JZIA 4M1KA 2IOFK 1NR1A 1QU9A 2WP0A 3WRYA 5JALA 2FPIA 3SHFA 4JZYA 2ZD9A 3U7HB 5EERA 2CVHA 4YH1A 1V0JA 1Z2GA 1TF2A 4W5TA 1DWOA 3Q3VA 1YJQA 1I7QB 4HS4A 2PE5A 2JANA 1P8AA 1C1YA 1P3JA 4IUBS 1ZAUA 2FMHA 5AIAA 2NW6A 3NASA 1SRRA 1EEHA 1ZLYA 4QUHA 1NZDA 3DTTA 5LGNA 4AX8A 3N2NA 1R00A 1SZQA 1NNI1 2O4CA 2L42A 1U0OC 1N57A 2B8TA 2ZB3A 4BZZA 4KR9A 2AFIE 1CWUA 1C8LA 1EX1A 2J5QA 5I7UA 4P5PA 2Z6UA 4US2R 3X1XA 2PBFA 3OQVA 1OT5A 4B8WA 4X20A 3FYUC 4TXLA 1M8FA 4HADA 4G4VA 1DJOA 1NATA 4FW9A 4XEUA 1VIBA 1QQAA 3Q7RA 4AY3A 3W1WA 3L01A 4Q7QA 4WBSA 2VG8A 4NOKA 1KMHB 3I1FA 4W1PA 2BRUC 2VPTA 4LZJA 3DR3A 1TKCA 5JWHA 2OXCA 1DVRA 5F78A 1Z28A 4RCZA 3CCCA 5H3HA 3N8GA 1KBOA 2D5LA 4LJ8A 1KZGB 1VL2A 5ED0A 1QIGA 1I94O 3ZS8C 5AW9A 2HIAA 1UADA 5F23A 1E2LA 3I4FA 3PLAE 2I5PO 4LFBB 1E3WB 1WUYA 5TQ2A 1N75A 1GUYA 5HQJA 3MGAA