5J2UB

Tubulin-mmaf complex
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Basis of Microtubule Destabilization by Potent Auristatin Anti-Mitotics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 160
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5j2uB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5j2uB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5j2uB01
1W59A 5JVDA 4O2AB 4WBNB 5EYPA 3JAKA 1SA0B 1RQ7A 2VAMA 3WGMA 4X1KA 4FFBB 5JCOA 4TV8A 4X20A 4ZI7A 4I50B 3E22B 2GVIA 3HKBA 3VO9A 4O2BB 3JATA 5EZYA 5CB4A 4O4IB 5BMVA 3JAWB 5LOVA 5CA0B 4I4TB 4TUYA 3WGLA 4U39A 4O4HB 4DRXA 5KX5A 3JASA 4IIJB 2RHHA 1OFUA 2RHJA 5ITZB 5KMGA 5LYJB 4IHJB 2BTQB 5C8YA 5JCOC 3CB2A 2R6R1 5IYZB 3ZBQA 4TV9A 5IJ0B 3R4VA 3VOBA 5JH7A 3JALB 3HKEB 4U3JA 4ZOLB 3M8KA 4YJ3A 1W5AA 4O4JB 4O4LA 5JVDB 5JQGA 2VAWA 1Z5VA 4X1YB 1TUBB 4YJ2B 5EYPB 5FNVB 3RYHB 3RYIB 5LP6A 3JAKB 2R751 4KWEA 4EB6A 3VPAA 4X1KB 3UT5A 4TV8B 3N2GB 3RB8A 5J2UA 4I55B 1JFFA 4ZHQA 5LXTB 3HKBB 3M89A 4F6RA 5CB4B 3HKDA 2VXYA 2XKBA 5CA1B 3WGNA 3N2KB 4TUYB 5LA6B 3RYFA 1W5EA 1FFXB 4O2AA 4WBNA 5J2TB 1RLUA 4DRXB 4HNAB 3JASB 1SA0A 1Z5WA 4FFBA 1TVKB 1W5BA 4E6EA 4EI8A 3HKCB 3E22A 5IJ9B 4X1IA 4LNUB 4O2BA 1W581 5JH7B 4O4IA 4U3JB 2Q1YA 3JAWA 5CA0A 4YJ3B 3V3TA 5JQGB 3RYCA 4X20B 4ZI7B 5M7EA 4B46A 5ITZA 3ZIDA 5LYJA 4IHJA 5GONA 2BTQA 3JATB 5EZYB 3JARA 5IYZA 2VAPA 2XKAA 5BMVB 5LOVB 3VOAA 3JALA 3VO8A 3HKEA 2RHLA 4ZOLA 5KX5B 4M8IA 4O4JA 3RYFB 5MN4A 5LP6C 4X1YA 5FNVA 1TUBA 3RYHA 3RYIA 5KMGB 4YJ2A 3ZBPA 4I50A 5MN6A 2BTOA 3WGKA 5C8YB 2Q1XA 1RQ2A 4TV9B 3N2GA 4I55A 5LXTA 4X1IB 5MN5A 4EI7A 4I4TA 3WGJA 4O4LB 4O4HA 5CA1A 5LP6B 3N2KA 4IIJA 5LA6A 1W5FA 4B45A 4DXDA 1FFXA 4XCQA 4EB6B 5J2TA 3UT5B 4HNAA 3RYCB 5J2UB 2RHOA 3C8LA 1JFFB 1TVKA 5EIBD 4ZHQB 5IJ0A 3HKCA 5GONB 5IJ9A 4F6RB 1FSZA 3JARB 5EIBC 4LNUA 4EI9A 3HKDB
chains in the Genus database with same CATH superfamily
5BN3A 3GJ4A 4KGXA 4N5DA 2AMYA 3CCEF 2CD7A 5LQJA 2PKCA 4AZWA 3KEQA 2WSSA 2OGUA 4IIJB 4WGFA 1J8VA 1T2VA 1WXXA 721PA 3IH5A 3D3IA 4GXRA 3I9FA 4AP6A 4B3DA 2J6CA 3V8NA 3G9UA 1W0JD 3A26A 1H2RS 2BR3A 1F3LA 3THXB 2IU3A 3HC7A 2NSJA 2XB6A 5FBVB 1NNI1 4R8LA 3U37A 3VZBA 1KE1A 5BWMA 3K0EA 4HNUA 3PNQA 4WNIA 3RBXA 1TGOA 3K9HA 3DHNA 3Q12A 4UEJA 2J3KA 3OF2A 3BVPA 4TYYA 1D4FA 4PZCA 5KX5B 3GLHE 2JHFA 1AB5A 4EHJA 4LYAA 4PINA 3LHKA 5FPQA 1P0CA 2W6ID 5HKOA 4R1PA 1VI6A 2GN8A 1Z13A 3U39A 4Z5XA 1N2CE 3AUSA 2QJOA 2ZBDA 5A2GA 2ZRKA 2VQEB 3CX7A 4E2LA 1SK9A 4KUHA 2ASEA 3I6QA 4E51A 2A9PA 1CUAA 5KVSA 3ZGOA 1VHQA 1GPDG 2VWJA 3EXG1 4C8EA 1OXKB 4ZAZA 2Q6KA 7MHTA 1N8SA 3MNFA 3E8MA 3D64A 5CB4B 5J59A 2HD4A 4P9OA 4IJQA 3TW0A 3RYFA 4F4JA 5LQNA 5GONF 4U5QA 3K6SA 3ZZ1A 3SDZA 1LDGA 5K3SA 3U2QA 4K9OA 4RPKA 4FJ0A 4DXAA 3QEMB 3VSEA 3IHKA 2BGGA 3LCMA 5D87A 4F9GA 3O38A 3LX8A 2E4ZA 1W0KA 1XWWA 4TT3G 4CQMA 3ILXA 3PPVA 2HF2A 3EOZA 1RABA 1MZFA 2JEYA 5AFSA 4YAKA 1ORQC 2VBGA 1RXCA 3BMQB 3JSNA 1JHDA 2RAPA 2OV8A 3ZWNA 1TZ2A 4Q9LA 4ILEA 3CE9A 3CR8A 1DAMA 4B4DA 5A5DA 3UY4A 5BMVA 4LOJA 4D7TA 3ANYB 3AG6A 3CB2A 1UPBA 4MQ5A 2JGUA 3DO6A 4CNBA 2C9CA 1V7ZA 3BTOA 3K8ZA 4N7BA 4KX3A 3H0KA 1ZUQA 4MWBA 1UM9A 3FJOA 1CDDA 4YYZA 1R3DA 2PMKA 1MTZA 3KFVA 1AR1B 2CFOA 1RKXA 2ESRA 3V4VB 3QYAA 3CPQA 5BUQA 4FFBA 3V4SA 1G16A 3TO5A 4OGWA 2OXIA 1Q0PA 2GDJA 5E3HA 1VQKV 1EZ1A 3VCZA 4D3YA 2ZIGA 4Q3DA 1CY8A 2IZ0A 1PUIA 2XT6A 4L4ZA 2J0SA 4E07A 3KAJA 5EXTA 3NH6A 1MMMA 3EGEA 1KQGA 4OB8A 5TPZD 1V55C 2HA4A 3AERB 2OBNA 2Y27A 4UFNA 1GTOA 1KNJA 3ZH2A 2HV8A 5M29A 2WLSA 4XFDA 3KLBA 1XTZA 2AJ8A 2AZ0A 1TI7A 1RMTA 2WQZA 3ABLC 1UBMS 3T94A 1PQ4A 2VYCA 1NHGA 2HOQA 3VR3D 2IHUA 2HJDA 4F8EA 1R0ZA 4FR0A 5DEDA 1XQ1A 5HIAA 3EA0A 1ZDMA 2OK7A 4EF6A 1GKFA 3LDEA 1S8AA 4XB2A 4PFKA 4D41A 3JPYA 5TJHA 2F43G 3NPMA 2P90A 4B73A 5P8WA 3AG4C 2HH9A 1ZNQO 2R9VA 3QVVA 4RKRA 2ACEA 1E92A 4J0JA 4JSYA 1C9KA 5GJBA 2JLRA 4P7GA 1MA3A 2HY7A 1MXFA 4V2IA 4DNPA 3SPHA 1W88A 4BFLA 2VHWA 5K3BA 5D01A 1K9SA 3NP7A 3QKRA 1NVKA 3L40A 2IW3A 3MELA 3AHHA 4QG7A 5FUWA 3T3IA 4LC9A 4C2AA 1OBHA 2CWWA 4Z9BA 5BPHA 1DTSA 2JBAA 2AGVA 3OURA 2Z98A 4D9KA 1JLSA 2W8ZA 2V7WA 5DPMA 4IDBA 4Q9DA 5KSWB 5KTTA 1A9OA 1SURA 2ZE6A 4WDRA 3R7AA 1IWPB 5IT9N 2P6UA 4LH6A 4HY3A 5F51A 1ZRHA 2WE7A 3LWOC 1HUQA 4KWTA 5NLLA 5JZMA 2Y05A 1BHO1 1PZXA 3QYJA 2PF4E 1T2DA 4DEXA 3TPZA 1CJTC 1ADBA 3FOEC 3N9IA 1CE8B 2C92A 1QV9A 2FMFA 5TR9A 2E4AA 4GKVA 1D8TA 3IUYA 4BT2A 3ZW8A 3K09A 4CM8B 4QATA 4V0QA 2UXDO 2VZ0A 2GK6A 2B37A 4J2HA 1QDEA 4ZVLA 1KU6A 3A1NA 3OY7A 4YMIA 2YIAA 1GADO 1MX3A 3LX5A 1GCUA 4E33A 2QSUA 1SUDA 1SOVA 2A3NA 4BZWA 2FNAA 4BO8A 5CT4A 1NG1A 2FW9A 1NW5A 3HLYA 4EZBA 1RI5A 2ACWA 1B42A 2QUHA 1U4NA 2CK3D 1JN1A 3ID6C 1O2DA 2V7GA 3R65A 4LOHA 3ESQA 4Q1VA 2K7FA 4PPYA 5DBGA 2ZBGA 2EAUA 3H2ZA 1TCAA 4AIRA 2R96A 1YTLA 3Q4GA 3WLAA 5CB6A 5DM70 3GWKC 1XF1A 2NR5A 3E03A 2N74A 4HX2A 4OB7A 3PQ5A 2JJQA 3HB7A 3HB5X 1EYZA 4CQNA 3WYAA 3AF6A 5CH8A 3SQDA 4YECA 3FAVA 3FRIA 1MLDA 3L4KA 1RKVA 1UFYA 2IHKA 4EA6A 5EBWC 4ABTA 2Q3EA 3IVRA 4GKJO 1PTKA 4MP6A 2DY1A 2I22A 4HNRA 4QRIA 1IXYA 4RKWA 3SJBA 4TYQA 1K34A 5I5GA 3RAGA 2EW8A 2BBSA 3KUDA 5B4VA 3T5PA 1TA9A 1Z15A 2VKTA 2GD0A 4MQBA 3EOAI 4JI8O 2QAGC 3IOBA 5JQGA 1V95A 4UTZA 4BNFA 2BFWA 4MVXA 1QSGA 3M6WA 1E1RA 3DZDA 2PDAA 1Q90D 1D1SA 3SBEA 3UJ6A 1I10A 1GKKA 2ZIWB 1JYFA 1KEEB 1LRJA 1HM5A 3M5DA 2C00A 4B6OA 3NHRA 4LXTA 2ZT9B 1DKRA 1M56C 1XCJA 1H2XA 5K8UA 1CNFA 3STUA 2WI8A 4DUZO 3RN4A 2CNDA 3BORA 3MGKA 4OSOA 3PITA 3AZOA 5MN6A 3Q6IA 4MUAA 3FTCA 2P9QA 2VI5A 2Q7DA 3B77A 1KR5A 3AJ9A 1H94A 2OL4A 3ZK8A 3IEUA 3V7FA 3KL4A 2I1QA 4HCJA 4XUEA 1VQ8V 2C83A 1OVMA 3OC6A 4Y0VA 2YUAA 3DEKA 3Q3GE 1CS0B 2FQYA 3WGYA 4GR4A 1WDKA 3D7NA 1FXKB 2J6BA 4FYVA 2B9ZA 1STOA 1T43A 1HDIA 5LOVF 2J3IA 2H8CA 4E1BA 1QJCA 4D8UA 3N2GB 4XD7A 3ELDA 1EIZA 2HPVA 5C52B 4S24A 8OHMA 1U8FO 4JENA 2VA9A 3IB6A 1SKYB 4BJ5A 3PEWA 2GZ2A 1FDWA 3OPNA 2FWJA 4RYDA 4I4TF 5I6DA 2WIFA 2FSVC 4IP0A 3I1YA 3QHAA 3Q41A 4H0CA 2PZ8A 4G81A 1MOPA 1YRHA 4V24A 5JDIA 4C0QC 4HYEA 3DB2A 4JQZA 4R6ZA 4E88A 3QOXA 3OLVA 5F78A 5I47A 4E5SA 4LGMA 5L3VA 4E09A 3WGMA 3ICPA 4EJFA 3UHJA 4B4KA 1H47A 4ASUD 2HF8A 3QVNA 1WU8A 2REQA 4V0OA 1H5NA 1OTYA 2W83A 2BGTA 4OGGA 2XHZA 1I2AA 2C2GA 4MW2A 3CVVA 1QX4A 3IDQA 4HF7A 1L1FA 3A31A 1B23P 3R5FA 1JFFA 1QFZA 2XUKA 1XEAA 5GV8A 2DECA 1C9YA 1W5TA 4W5QA 1FUUA 4C8IA 2BE3A 1OTXA 5UKDA 3IMKA 4RD6A 4RPLA 3IT3A 4FSDA 4V1CI 5EE1A 3WG9A 3BIXA 3HO8A 5GJVC 1RPRA 1Q91A 2QIOA 1UDWA 4YJFA 3R6LA 1YJWF 3IAM1 3A28A 1QAHA 4KCGA 1SD1A 3TDNA 2YY7A 4LW8A 5LA6A 1LDNA 2XZOA 4G67A 1Z0KA 4HEA1 3H9GA 4B7XA 4BQRA 2FMTA 3U44B 9GPBA 3I62A 4JB0A 4R1UA 4BE9A 2PKEA 5KYWB 1GNQA 1YONA 4J0CA 2YIMA 4FHFA 2JFHA 2PHNA 1L4BA 3RVOA 3HR7A 5I7AA 3ZQ4A 5EGNA 4NULA 1MJNA 1C2YA 2WNIA 2WA1A 4Y2XA 1IVYA 2D2EA 4IJKA 3EFOA 2Q6IA 2Q4PA 3FUWA 4RPGA 4U7PB 1E3MA 3S81A 4RVNA 5HVNA 3SVZA 2J87A 1KJ8A 1HYQA 1OWNA 2WU0A 1Q0SA 3V2GA 2RMKB 4R7TA 4ZOLA 4A0GA 2Z01A 1BS9A 1CEEA 2VDNB 4YJHA 1CCWA 4FC6A 2C1EA 4A0FA 3TQQA 2I2FA 2FPLA 1R6AA 3WLKX 4G8BA 4TZTA 1NS1A 2H1CA 5KAPA 4DG9A 4QOIA 3TR0A 1GFZA 4QC2A 3T34A 4DHWA 4OJTA 3OGIB 1I32A 2YTZA 3EZGA 1H4VB 3PI6A 1O6ZA 2QV0A 3O90A 3ILSA 1N33O 2MYTA 4DCJA 4HQFA 3BXPA 3NETA 3WGTA 5D5QA 2B8EA 2Y3IA 4MV3A 3LYBA 4IJMA 4JHXA 1CK4A 1T0UA 4MVRA 4B3HA 4HSEA 2X13A 2JATA 2HRRA 3AW8A 1YIOA 5ALWA 4ZVQA 3U0OA 1ZWKA 5ADWA 2VC2B 3MWLA 1OI2A 3H7IA 4ZO8A 4FE4A 4N0EA 4TTSA 3DNFA 1Q77A 2A5GA 1DCFA 3EVCA 3FFTA 4JFRA 4M9RA 3CEHA 4ILKA 3R7WB 3USES 1YAHA 1VIBA 4MT8A 3I04M 4TLDA 1A8QA 5U4XA 1U65A 1TE2A 5IULC 1P0FA 1PT7A 4OFXA 3DDOA 3DTUB 2XVXA 6ADHA 3E9CA 3JQAD 1CYEA 1X1CA 5AW0A 3RYIA 2P2LA 3EGIA 2ONKA 1VQMF 3NATA 4NBVA 2HXGA 1O95A 4J7JA 3I9OA 2P1RA 3WSTA 4IYHA 1RLJA 3ZC3A 4CUZA 1GO1A 3PDJA 5JW6A 4L72A 4K9QA 3DLPX 3TIXB 5I9TA 4I0WB 4UE2A 1BS3A 3SIUA 3VPXA 3NT4A 3SLRA 4LHXA 5FUXA 5TF4A 4CC5A 4OO3A 5DLPA 3T9AA 1Z6QA 4EG3A 1NU6A 2DT5A 1TC2A 1DC8A 4UMDA 5ESXA 4Y98A 4WESB 2I2BA 3BB3A 4C14A 4HAWA 4IQGA 2C8VA 3OUUA 3VAAA 5AVJA 4LWOA 2ZROA 1LI5A 1M66A 1TO1E 2JH3A 1L5YA 3EA4A 3NLLA 1M1NA 4QA9A 3A1CA 1JQ3A 2HQBA 5IJ9B 4W1QA 4NOJA 5PNTA 1V96A 3LBIA 4IF6A 2G17A 4HSGA 4KQJA 4L5CA 1VBKA 1XF9A 5TDHA 1C0KA 3TFWA 3N7UA 1EFTA 4M76B 1TU0A 1D2MA 5JJCA 3VAZA 1N7HA 2RHLA 4WXYB 4RMGA 1ORDA 7ADHA 2HCRA 1JAIA 3F6RA 3KSBC 5EFOA 2FXVA 1WXQA 3WB9A 2OSBA 4JT2A 1C30B 1N9ZA 1H3FA 1LJ8A 3OJEA 3ZE7A 3I04A 5KAMA 3GJQA 1X80B 1BSMA 1EP1B 5FL7D 3VO9A 2ZUUA 1FFYA 3HPRA 1VE3A 1GNPA 3CCCA 3AY7A 4CDNA 3LGSA 1OYYA 2V6IA 3JQFC 1N5IA 4F3CA 3QFRA 4I99A 5KTNA 1Y7IA 4JI3O 1F20A 4I1RA 1IY2A 3BTUA 3RYHB 4BBJA 3NOVA 3STXA 4AZTA 3FB8C 4G1UC 1SCJA 1CZKA 1PKXA 4RE5A 3CY6A 1J1IA 1MO6A 1AN0A 1T9ZA 2V9PA 1U5CA 4MGHA 1DAHA 1D2CA 4DCUA 2CV2A 1YE5A 3C6MA 3DD1A 3TQHA 1LLDA 4GWGA 3N8IA 1P62B 2V4UA 1DEKA 1UODA 4NPAA 1Z29A 3HVKA 3WHIA 2VDMB 3IEXA 1J06A 1ZP6A 5EWJA 1ZBDA 5E7JA 1EZZA 4G8DA 2PNFA 1LB1B 1OAKA 1SS3A 3DA8A 1UJNA 2DBVO 2QJTA 2J67A 4C05A 4M1KA 4EPVA 2YMPA 1XBIA 4PX9A 5DNWA 1MC5A 5AM1A 3ORQA 3WLPA 3B8EA 4HPXB 3BEOA 3GRFA 3LY5A 3I2IA 4L73A 4M1MA 4MAMA 1YQTA 3LM8A 2C88A 1UDAA 3UWKA 1DG9A 2HVKC 2J3QA 3T9BA 4NBRA 1VC2A 4MR7A 3HCFA 4EY5A 2YV2A 1ID1A 4OAOA 4IWNA 4R6XA 2VAVA 4YMVA 3TIFA 3UAZA 1GPBA 4K26A 2WJPA 2OK8A 3O1IC 4ZOEA 3MD0A 1HYGA 4LQ4A 1IBMB 1ZUWA 4C4SA 4ARCA 1R1DA 1DQRA 3R9WA 3Q8LA 3AGPA 2PIAA 4LYEA 3VMFA 1Q0UA 1LCIA 1A27A 1QPBA 2LWIA 3I58A 1PVDA 2CZQA 4LY3A 1E6LA 2PKQP 1Y1TA 2O5EA 4EAQA 2YSUB 3GNSA 4YHHB 1ZM3A 3DT9A 3IMEA 3QJ5A 2VYVD 3D8TA 2WLIA 3L0SA 2DWUA 2C5HA 5A6SA 1QV6A 1T0PA 2BGMA 4DV3O 4B6JA 1D0IA 3A2LA 3OPVA 1YH3A 2L6LA 4NZYA 4X54A 2V5AA 1GA1A 4A6XA 4I55B 1KA9H 1RJWA 3WU2Z 3WBJA 2D2CB 1JXQA 3PG5A 1FTNA 2ONCA 3B1KA 3UV3A 1X3SA 1AIPA 4YEDA 2QT9A 2UUBB 3VDNB 2ZTMA 3K53A 3FMIA 3LWRC 3NHWA 2OC4A 4KR6A 1KP2A 1Z16A 2WWWA 2W4MA 2CYBA 2HVJC 2OFPA 4C03A 4QT4A 1YK0A 3G0IA 1C3OB 1NQVA 2YV4A 5EKSA 1I08A 5E1MA 4YR9A 2WHQA 1H38A 4ITVA 3LYAA 4BTEA 4PVDA 2W6MA 1FXKC 1K7YA 2O8BB 1RFGE 3SR0A 1V8BA 4GKBA 4U2BA 5KJ6A 3DLIA 3KUUA 3QELA 1MOSA 3CZPA 3NIGB 4OXQA 3I3FA 4JUDX 2AEJA 4YMLA 3OEHG 2M98A 1U7HA 3IP1A 1PS0A 3W3AD 1JZQA 3BZBA 4X97A 4EABA 5CH3A 4D80A 1XTQA 4O2LA 4IJ6A 1US6A 5F5XA 1YQDA 1KEPA 2C9OA 2QI9F 2WG1A 1NW9B 4NNPA 2VHXA 1YI2V 4DT1A 1PTJA 3LI2A 5ECDA 1G3IA 1RAHA 1D9ZA 1L2TA 2OMEA 5BRNA 3UAWA 1VZ3A 1KSGA 4V1CA 4IDNA 4TVSA 4TQ9A 1D6SA 3WBBA 2QRVA 1TTHA 4HLQB 1XTIA 4PG8A 2Q28A 5ALOA 5L4SA 2CYCA 1TW2A 4H4CA 4AKHA 1WKBA 3JD2A 1QCDA 2OHFA 3K9LA 4L5IA 3HLKA 1BMQA 1ONPA 1S0VA 4LXUA 1XTSA 3ONDA 1USKA 1GQRA 4YXWG 4MYDA 4OKSA 3MAAC 4JLSA 3MJDA 3YASA 4G97A 4V0LA 1XZCA 2X6CA 3F67A 2G88A 2QUKA 3DE4X 5T5QA 1Z8FA 2O8DB 1E4EA 5HY4A 3RF6A 4RH1A 3CYFA 1P73A 1JX9A 3WIOA 1XHLA 4GZLA 3B12A 2IYVA 2VUHB 1YO6A 1K66A 1EMDA 2P9YA 3NTXA 4FZ0A 4PX5A 4YJ2A 4I8XA 1LUAA 4AJNA 1K8AH 3QPCA 4CMBA 2BDTA 4GX2A 1C80A 3MMXA 2ZRNA 1XWIA 3CUWA 5I4BA 3RC1A 3DQQA 1C50A 1NUPA 2V8BA 2H31A 1P74A 3I5AA 3A9VA 3CT6A 3W8EA 4FIZA 1U2TA 1MVLA 3R3UA 1Q3HA 3JQAB 3AKDA 2DKOA 4LZZA 1QYCA 4QUGA 1AQJA 4AG6A 3CH5A 5EE0A 4B9EA 1QFMA 5DWVA 1XRPA 3AHEA 3UC9A 2W7TA 3RIGA 2UUAO 2FFQA 4AJ4A 1NXWA 4LHVA 3ZI0A 2FOIA 1D7OA 2V59A 1M1KH 2IV2X 1BCRA 3B1WA 1U8XX 1L0NH 1VFNA 1XXLA 1ZESA 3KJJA 4FFKA 3W5BA 4ZHSA 2N1MA 2EJTA 3V80A 1LPSA 1YU6A 3TW6A 4JYAB 1VQ6V 1G8SA 1XKQA 2W4QA 3HGQA 5BUCA 4NFLA 3GFVA 2R5FA 3GA0A 4CPDA 1P19A 5IUNC 3R1IA 4UBOA 3N86A 4DDWA 1WOMA 5YASA 1C9DB 3VI4B 3ZXYA 2C3PA 1UK7A 3PICA 1VQ8F 4FMCF 3AX6A 1BMFD 5IYZB 2Z08A 4P3NA 4HAYA 4LYGA 4C43A 3HI4A 5EJ4A 2EEZA 2Z43A 2YZMA 1JMKC 3C3SA 4WVFA 3ABUA 5BR1A 3TLZA 5B5SA 3AHGA 3E1GA 2XNKA 5FF9A 2RJZA 4TKUA 1FA9A 3NRJA 1EQAA 3MRSA 4LJKA 1XVVA 4AICA 4AZVA 3CTPA 1ORVA 1DUVG 1Q74A 3BWBA 1TA8A 4RDXA 3BE6A 3EMBA 1JSCA 4ENWA 3H9CA 4A8JA 1XG5A 1MG0A 2ZB2A 4U6QA 4AT1A 2QWXA 4C0WA 4C0XA 4QUHA 3OQNA 3KSMA 3HKBA 4NYKA 3E4DA 4KAAA 3RUDA 3N87A 4II3A 3TTWA 1L5KA 2Q2QA 3HR4A 2KLHA 2FY8A 4OQXA 4F2PA 1SZJG 2MR6A 2YUIA 5C37A 2WF6A 5E4YA 1NVGA 3RKSA 2R00C 3GNQA 4MJLA 5ECWA 2F9MA 1LWOA 1T0BA 4DSZA 3UUEA 4NOKA 4PAWA 3QVUA 1T34A 3O5AA 4AP9A 4YP7A 4UCVA 1VZ2A 4M8SA 4U2EA 3IQWA 1ZX1A 1T4CA 1SZPA 5KO2A 4JITA 1YDMA 2QENA 1Q5PA 1AXRA 2EIXA 5I8PA 1O0SA 1G18A 2XB9A 4IHQA 4YV1A 4G26A 2IZ5A 4JBYA 3CEIA 5INTA 5F9HA 3GHYA 5JLAA 1H9CA 1LJLA 1W8DA 1GQFA 4BIIA 1TQ2A 1FLVA 3KJGA 2XNDD 2ZT7A 3B13B 5J1TB 1KDVA 2R6JA 1HORA 2G08A 4HDCA 5CTJA 2V9ZA 2LR0A 1FIUA 1QGYA 2X2OA 4KUMA 5CLIA 5ALIA 2BTQB 3QO7A 1EM8B 1QUEA 5GADl 4MKRA 2XASA 3ROZA 4PA6A 1IOVA 1HT2E 3TAUA 2H8GA 2XUZA 3JCMM 5L7WA 3TD6A 2GSDA 2GBFA 3F9CA 4QWWA 2D3TA 2P6RA 4J07A 2BHLA 2FZ4A 3VPGA 1RLTA 1WW2A 2C4TA 4DCOA 2PO5A 4F7DA 4KDEA 2ZF8A 3HABA 5CA0F 4RETA 1P5FA 1E2HA 5JWPA 3TDMA 1AB3A 3GLGB 2EU8A 3IP8A 1HL7A 4HNTA 3K8QA 1JHVA 4IMPA 2CDNA 2F9LA 4B3XA 1SDSA 2GHRA 3CLTD 2ODMA 1PJBA 1QR2A 3L07A 1ZH6A 4Y0AA 1PQUA 1O9BA 4WK0B 4EHHA 5LHIA 4OJMX 1FP4B 3TFOA 1PLLA 1UJ4A 3SJQC 2WLMA 5AJYA 3A70A 3F5FA 3BH0A 5AXBA 2VEDA 3ZZMA 4J4HA 2CXHA 3HV0A 1TIPA 3GNTA 2COEA 2EQAA 3N1UA 1H0RA 4YPFA 4TQAA 3JAKB 4I5GA 3MJCA 2ATCA 1ZHFA 3MTQA 4G0VA 3LDUA 3R6TA 3KUKA 2ZSHA 3EUEA 4ZPXA 3QVKA 4WJLA 3R0XA 3OM0A 5BNZA 5IM4F 3R5HA 3CJHA 2YYZA 5JAMA 3UH1A 3Q72A 4DLAA 1BGWA 4QYXA 1XMOO 3ZS9A 2Q2NA 2FFAA 3VTKA 3ND9A 1IAQA 4V0SA 4NG4A 4HDSA 4ZEOA 3QLJA 4DW0A 1D4ZA 4PNZA 3GLHA 5JPDA 3JRWA 3KWMA 1LPAB 1VCHA 2P6MA 2RHMA 4JC4A 2NQ8A 4BGEA 1H42A 3QUAA 3I5YA 3RTCA 1KEUA 5K45A 3BE5A 3GZJA 3F7MA 2F1RA 4MO9A 3ILHA 4KVAA 5EJ9A 4HR7A 1JDTA 4DDUA 3MJ4A 2E1RA 2EKBA 1Z3IX 1HE3A 1W9HA 1UC4B 3SZ3A 2C5AA 2YJ6A 1UQTA 4G41A 2FRDC 4MVJF 1OFVA 4O2BF 3ZKWA 2A33A 4C2BA 4BB0A 3ZV6A 2O2HA 4ZCSA 3ZZ0A 3JQRA 2HCFA 2HHAA 3CO0S 1PCXA 3O0TA 3FJYA 4HO1X 4BYGA 4RA6B 2M6RA 3BJRA 4Y67A 1DJNA 2CTWA 3HDYA 3S2SA 5HCUA 1IV2A 1GR0A 3L77A 3KRTA 5JPIA 4Y6SA 4MA0A 1UQUA 2C8KA 1L0BA 1ZGBA 1R3JC 3JD3A 3M49A 2VJNA 821PA 2R8BA 1LBEA 5TQJA 1P4RA 4JI4O 5JR3A 3QUCA 1GUYA 1YOVA 5L6MB 4RSRA 1DBWA 1ZLYA 4HLUA 2J45A 4KQXA 5JAIA 1B8VA 3U4QB 4G0MA 4KBFA 5AVWA 1FOEB 1GA6A 5T8KC 2AW3A 4TTQA 4XJXA 2YOFA 3FDZB 5FB3A 3ED1A 1QO0A 2VDQB 4ZVRA 1K6JA 1NC3A 4ESHA 1UDRA 3CX5F 3EBPA 4ND6A 2FPXA 4W6ZA 4D9CA 1C3JA 2Y93A 2PZEA 2P41A 4FHCA 3K12A 1QB8A 2H4YA 1G5TA 1DAPA 4K86A 4CV0A 2YC2C 5CVEA 4ARZB 1HE2A 2PUEA 4D26A 4AKGA 4C2UA 2WSYB 3WK6A 1EUCB 3GUVA 2OGSA 3R4CA 1XPRA 1P7GA 3D4OA 3I5DA 4CMKA 3WIVA 2GXAA 4UU8A 1Y5IA 1X38A 1Z2OX 2Q6OA 5EJGA 5FA8A 4NABA 4B09A 2O5CA 2GDSA 3LUPA 4G1BA 3WLNA 4GPEA 1WHTB 1K3UB 3VFDA 3S8YA 2CLMB 3DAOA 4U5XA 2BRUC 1K1EA 1BVHA 3QPDA 3KJIA 2GM4A 4BNUA 1YS4A 3Q5DA 1W55A 3FI9A 3G68A 4BB6A 3ROMA 4Z4GA 5AKZA 3AK4A 1IV1A 2R8YA 3ITNA 1NLMA 2VDWA 3R3HA 2R87A 4JQOA 5FUMA 2IYQA 621PA 3BWEA 1VF7A 1XNRO 4EA8A 1O6GA 2A59A 3EDCA 2R6GA 1WLYA 4EA7A 1XV2A 1GXSA 2Q6AA 1PIWA 1AZTA 2O8CB 3TMKA 1RVDA 4G3XA 2DXIA 5GGXA 4ZC8A 3ZOKA 4R83A 1NAHA 2IYRA 3AOGA 4JTAB 2GNAA 3FD8A 3W34A 2QQ0A 5FDFA 1GG5A 1SCBA 5HTKA 2A88A 3ZCSA 4B40A 1I94O 2J5XA 4YAWA 3C6QA 1MG5A 1O89A 1XAGA 2MYUA 1EBBA 1Z62A 2QQGA 3EZ7A 1V16A 4DA7A 4XI9A 3CUKA 1USVA 4JJGA 1KMQA 2QHXA 4BB9A 3E9ZA 3FMOB 1X7WA 4OSPA 3UJAA 2UYCA 4JKYA 5FLEX 1PZFA 3T7SA 4CM4B 3VC7A 4MIYA 4JMPA 3T4XA 4CMIB 3PXBA 3SZUA 1T8RA 1W5EA 2CDRA 2ZUFA 5IWAO 2J0UB 2Y1OA 4L85A 2NSLA 1P1FA 4BNLA 2HJSA 2AE1A 1ND5A 3NONA 2VRCA 2XV1A 3RSFA 3O91A 3QKSA 3G0BA 3ZWDA 2FAXA 3DGEA 3KETA 4PG6A 1I4LD 3P9ZA 3KKNA 1IM5A 1EFKA 1KAOA 4M4SA 4HTFB 3DEZA 1OC4A 4I08A 4MDHA 3TZEA 2R6AA 4ZHQB 3PNVA 3K9AA 1RCTE 1AT1A 1SCUA 2PRIA 3ZHCA 1CZRA 4ZYVA 3EIUA 3RUPA 2H06A 1UAAA 2XMCA 2ZPUA 4LEIA 1XA4A 3JATA 2C2OA 4WOKA 4HDOB 1Y9JA 3T7KA 2GUZA 2O14A 1S76D 3ZJ4A 1P6QA 3EH1A 4PV7A 3CA8A 3ZWMA 1UUFA 3KQYA 3D01A 3DV0A 4URYR 4HDRB 1A8HA 1QJ4A 1Q1BA 1REQA 1P8JA 1LNZA 3DZGA 4NE2A 4FC7A 1AQYA 2RAUA 4H31A 2EHDA 2R7AA 4TS1A 3L0OA 1K7CA 2QL7A 5DRYA 2OAGA 2XYRA 4MVJH 2NUPA 4V02A 1FQJA 3FJ1A 2P9FA 4OPAA 3T3GA 3CPJB 3G2JA 1GP2A 1YI2F 1PR9A 4ZO7A 2VT6A 5B36A 3EF0A 1Z0AA 4JFAA 5C2JB 4OQYA 2A9QA 3MS2A 4PN7A 1BDBA 3EG5A 2BM8A 3T1QA 4LNAA 5K1XA 3EEQA 5DCUA 1OGJA 4RZSA 2CVOA 2VUSA 1SUSA 3QEOA 1U28C 1HLFA 3OKCA 2B2NA 3G4SF 1ODLA 1HWYA 4AHCA 4YRZA 1NR1A 2PAAA 3SAJA 2I4OA 4F9TA 1BZYA 1KH2A 5AVYA 2P2CA 1N4AA 3G2OA 5I7HA 2QBYA 2QM4A 4J3FA 1Z17A 4DPMA 4F5DA 1ZNWA 1IPFA 5IVDA 2Y0IA 3SJ7A 1N5MA 2OWEA 3ZIUA 2XHEA 4TVBA 2BGUA 4BVHA 2AZ2A 3CLRC 1VHTA 4NARA 4DV0B 1ULHA 1S3IA 3W1EA 4U7HA 4R71A 3DZJA 3FNGA 4B0OA 5CXXA 4AQ7A 4NBLA 5KVVA 1ZIPA 1PR2A 3E7PA 1W0JG 1E96A 2F4VO 1IRIA 1E99A 3BB1A 3I5MA 1MX9A 3CC2V 4ARVA 1L6RA 2LPMA 4GQIA 3ZWKA 3ZHUA 4XIIA 2V1UA 3APQA 3VYRB 2JKZA 3DM5A 4DIKA 3RSGA 4FYYA 2FZCA 4LUCA 4AI8A 2I3BA 5L4NA 5K3AA 1E1YA 2HT6A 1E98A 1ZJ5A 3TE6A 4TPKA 2NYAA 2DT8A 2W6IG 3NBXX 3S3XA 1JPVA 2X3YA 4X1IB 3B60A 3OZUA 2W2MA 4HAOA 2YHAA 4B43A 3MJHA 3TS1A 4KKVA 1C9MA 4Q7EA 3I6YA 2QPLA 4ZMBA 1SXJC 1XDBA 2X6RA 5BP7A 1XHOA 4PNPA 3AR3A 4ZI7A 1VQ6F 2DC1A 1NF2A 3HFRA 3WPWA 1VE9A 2PUHA 4B3FX 2CFCA 3ZEIA 3RT3C 1DKMA 4X7BA 4MS4B 1NVTA 5EJ6A 2XDWA 4IYJA 3MLBA 1JYSA 1XI1A 1HG0A 4UAUA 1JQJC 2ZXUA 1T3GA 1LC3A 3SY8A 1M75A 4XLZA 3MIZA 4QICA 2AS0A 2R1TB 2FPRA 5C31A 1PP9H 4M46A 4MYCA 4RIIA 2FPOA 5DNEA 5KOHB 4DJEC 1DX9A 5THKA 3IYLW 2HMWA 1N32O 3W5JA 4A10A 1WF3A 1N0IA 3CF4G 4BVRA 1VKZA 4LX8A 2PBLA 4F4UA 4DNOA 2WFLB 2ZUBA 4KYUA 3DEFA 5KTMA 4C8GA 1QHGA 4OK6A 5HKKA 2J4CA 1M74A 2PL1A 2L18A 4W5JA 2RI0A 1XVIA 3PJDA 4P58A 1W94A 5AUOB 1RSZA 2PJDA 1RC0A 3PUZA 4ZCLA 3RWRD 5ALYA 3L7QA 3DLAA 3VHQA 1RM4A 1X92A 4N39A 4QEZA 4G0YA 2FWPA 4XX1A 2FGJA 3WICA 1CEXA 3ZX5A 2H2GA 3GYQA 3GDFA 4RHCA 1TZJA 4MS3A 2GCEA 3GBSA 3OECA 3FZQA 1DF5A 1F4VA 3TXQA 3CVXA 2NXCA 3CIOA 1KGSA 4Y2PA 1JJVA 1UZAA 2ZXEA 1YJ5A 3SD7A 2QR2A 3EY9A 2V9CA 3CH7A 3LXMA 2JLZA 5B1OA 4RQOA 2BFDA 3O4GA 3THWA 2QNIA 4DV2O 1SCAA 4FQ7A 3PB3A 2CN1A 2O2JA 4FLMA 3CS5A 2HV9A 3OQ6A 3G7UA 1QQ5A 4P2BA 4LOLA 3L0BA 4PDRA 1KYYA 4AZ3B 2YVQA 4WK6A 4UV8A 4K8ZA 3JQ7A 1IJKA 3KZKA 2QEXV 1GSAA 3MWYW 2OWDA 2RGXA 1GD1O 1VFPA 3GX1A 4FI3F 4G84A 2ZAGA 4YH1A 1WOYA 5IVHA 1KKCA 1OZAA 1IIBA 5K6AC 4G25A 5AW1A 4I4NA 4I4CA 1E1KA 2ZCJA 5K4AA 4HZUB 3Q9NA 2QDKA 4B4UA 2Z1NA 4WBNF 3UHFA 3OQVA 4EBFA 3C3EA 3X1JA 4R8CA 3LWDA 2FE1A 2NP7A 4LJ8A 1IONA 1E2KA 1M5IA 1R2QA 2HQOA 3PNMA 3KEOA 3K8YA 5TEVA 2ID8A 3SS8A 5JJLA 2JK5C 1PWZA 2BMAA 3G5LA 4W9NA 2JEXA 4JGGA 4CEIB 5KU1A 1NJGA 3I61A 3KP1A 1K8XB 1IUOA 4B3JA 2O07A 4JJIA 2HMTA 3RVSA 4ZQIA 3IEKA 5KNDA 3ZTWA 3HUUA 1TPYA 4AG5A 2ZODA 1E2QA 1ULZA 1P9WA 1R0BA 4UDXX 1JBKA 4BDTA 3ETCA 3AHFA 5KA5A 1JMYA 2TMYA 1B74A 4P32A 4REQA 1J99A 1G0OA 3HY4A 2WICA 2JNBA 1E3EA 2W0XA 4OUDA 2R5WA 1UWLA 2V3VA 2ZR7A 4ZKIA 1GDDA 3B2QA 4TWJA 1WCIA 4C4PA 1GQ2A 4CIBA 1XYGA 4YMHA 4NC9A 1CDZA 5JAPA 4BNIA 1NUHA 3EWSA 1U11A 2HAEA 5DHRA 4KQ1A 4RLHA 1B3RA 4ZEXA 3SQXA 3CVUA 2Q3DA 3NDPA 1NSYA 5HS6A 3PLAC 3P9IA 3HP7A 3LQ2A 1W2BF 3PIIA 4MW3A 4KXQA 1RCFA 3QE9Y 2JFXA 2CMHA 4ZQFA 1FTSA 1U99A 3MRXA 5FLKA 1C8VB 3RYTC 3TGPA 1O0BA 5H0IA 1OZ0A 1L4UA 3GU3A 4G27B 1NY5A 4KN5A 1HMPA 4C0AC 4IDEA 1EK5A 2C54A 1U3TA 2FLKA 1GZ7A 3WZ2A 3D3KA 2M6SA 1WF6A 2Y8EA 1J5XA 2ZVPX 3O4IA 3V1KA 1BU5A 1JV2B 1EM1A 4KE7A 2HMAA 2RN9A 4KBYA 3ZLBA 4FHEA 1V9PA 4BYMA 2QUIA 1K6XA 3QIAA 4MCIA 4I1PA 3BIJA 5JO9A 1WMFA 4PLTA 4PW0A 2YEVA 4X62O 1DKUA 4GPBA 5FX2A 8ATCA 4OQPA 1YIJV 2CK3G 3GTZA 1E7QA 4CCYA 1BSVA 2R1UA 4DDTA 2RHCA 4M49A 1GFIA 4K35A 5CA1B 4X66O 1WXHA 2RGDA 1NI3A 3A9SA 3TTTA 5U4QA 4UCRA 5MGNA 5AHOA 5ECYA 4O4IA 3E89A 5L51A 4HWOA 3OCUA 1FS6A 3FA2A 1TA0A 1WMSA 2I55A 3Q40A 1DIRA 2AJCA 4B2YA 2HSZA 2ZXWC 5K0TA 4CI0B 4HWSA 1AOXA 1P84F 3LNNA 3FHCB 5K6TA 3PUWA 4U3FH 4P2GA 3WLHA 1FCJA 4X65O 1OA1A 2O0JA 3OBIA 3D5QA 1BHBA 5JWHA 4MULA 5BR7A 2OV3A 4M60A 1JIQA 4ERXA 4MW8A 2QN9A 2GZDA 2AHYA 4BLWA 3CR7A 4Z9XA 5J4HA 1Y76B 1AKQA 1ZI8A 4CIWA 3RAEC 4HUQB 3LNTA 3ECSA 3F7NA 4L9AA 5A9GA 2FMUA 3OX1A 3DZBA 4CEHB 1XU9A 1FBNA 1V3QE 3SX2A 4K3AA 4BVQA 4MOWA 1XVUA 2D6FA 4DLKA 2BMWA 3EXHB 2CXXA 3E83A 3W0LB 4CF5A 4DN6A 4ZJPA 4YS6A 1MNGA 1J0DA 3HRHA 2XE7A 1MAUA 4CVNA 4NV0A 4MICA 1G4HA 4CZ2A 1T10A 3AUKA 2XCLA 3ZJ5A 2DULA 3KTOA 4JDUA 4MV8A 4KZKA 3QGMA 1NQXA 2HX0A 1CJMA 2AMJA 3R8FA 3OM8A 2NYUA 1IZ9A 4X91A 3IIJA 2OQ2A 3M5CA 2JJ2D 3UEOA 4D0SA 4CGZA 4UBJA 5B6IA 4U7GA 4X8AA 1C7IA 1JG7A 3BA9A 3BZWA 4HADA 1PR1A 3C48A 5C0OE 1KYZA 4CM9A 1Y6RA 3QNMA 4I46A 5D7BA 3VDQA 3N0RA 5TQVA 2DFNA 1R4MA 1P1JA 4NE7A 1Z75A 3L6UA 4PNHA 2IY7A 2FN4A 3DB1A 1RHJA 2KX7A 3O85A 3RHSA 3WISA 2YASA 3G8YA 3TLAA 4H3VA 2QY6A 1TYAE 3JYCA 2PZFA 3MCTA 3QHPA 2ZYSA 2HF7A 2AMFA 3J7AC 4D0RA 3DKRA 3L49A 2KW5A 4F4LA 5IP5A 2WHPB 4BVEA 1AI4A 2JKVA 4QU9A 5DTMA 4K8RB 3W3ZB 2ORYA 2H5EA 2Q99A 2DPYA 3JWIA 4DR6B 1A76A 3PVZA 1FQOA 1O96B 2E5WA 5J2TF 2HEPA 1EDBA 4QHYA 3GOQA 4DAEA 1ZGJA 4ASUG 2LXNA 3FSGA 3TM4A 2YC0A 1ISSA 3C9SA 3EIQA 1ZZEA 2CCGA 1XVTA 1CUHA 1M8KA 2JFGA 1EPUA 4EG0A 2X0NA 1UJBA 1HNXO 1TK2A 3EVZA 5B7QA 3WY9A 4D8XA 1M8PA 4TXJA 2CB0A 4KL1A 3B1FA 2O20A 1H5UA 4S0XA 3HL4A 1WPXA 2NPOA 2HS3A 3A6PC 4XEHA 5IBCA 3MTEA 1PL0A 3MB5A 3C3MA 1QUFA 2PXAA 2XSZD 2Y4TA 3DFUA 3FPJA 2JLXA 2A0FA 3A4LA 1NZ6A 1DX4A 4K88A 1TQ6A 3AIOA 1JX6A 5IJXA 3LSUA 3OZGA 2NV6A 2ZB3A 2J32A 1G8MA 3BHJA 3CVOA 3ISVA 3D8HA 2RSLA 4C4XA 3K0CC 3OCZA 5BQXA 4CR6A 2NT3A 4KDFA 5HE9A 2G9ZA 1WPRA 2WLLB 2P91A 2KMLA 1H4QA 1AGRA 3GGJA 4WK4B 5B58C 3T3HA 4E5UA 1XEFA 3K9BA 4ER5A 2LKDA 4HGQA 3EDYA 3DMDA 1DDIA 3HJAA 3NBYC 1M2EA 1RBZA 5IKPA 4Q4JB 1DJQA 2ZSAA 2V98A 4NDAA 5JY1A 1VQVA 4ONEA 2UU9B 5CR9A 4QVIA 3EASA 5JFTA 2ZTVA 1T5BA 2IC5A 3DF7A 3MSCA 3NT5A 4P9PA 5AO9A 3R7LA 4F6LA 4G37A 4Z2AA 2OHGA 3MCQA 1ZAKA 4TYPA 5HXZA 2Z57A 1CRWG 1SCIA 5DM4A 2IELA 4RELA 1FDOA 3PTLA 3OI7A 4RMNA 4QUEA 4RTSA 2D5CA 5LZ7A 1HGXA 4JTDB 4MRNA 5G2OA 4J76A 4URHA 5BSGA 2CHQA 1QH0A 4JP1A 4LZAA 4I36A 4TWBA 2AK2A 2BFEB 1GGHA 5J2UA 1CUZA 1BDJA 2MW2B 3RVMA 2PH5A 1QLWA 2Q0HA 4GSKA 3COVA 2OQVA 1DLIA 4XIYA 1DBQA 1T1SA 1Y4MA 1OMOA 5JH7B 3PRKE 4J94A 1PJAA 1XPOA 3B1ZA 2HSGA 2J4FA 2ZB7A 3L7IA 1CEYA 4KHPB 4I14A 4RCYA 3H11A 3MWGA 3TLEA 1O57A 1YZQA 1AG9A 1ZJZA 4UCTA 1T2EA 3QU9A 4I50A 5ILOA 1NBMD 1VPWA 1W87A 2HCTA 3Q3EA 1GO3F 4KR2A 4MGYR 3K1ZA 4BMVA 2E48A 3RS5A 5GP1A 3U4GA 1L5FA 3BDIA 1MRSA 2R2GA 3BL8A 4YI5A 3CZ5A 5IAEA 3CINA 1JQKA 3VV3A 1OU4A 4XASA 3GPLA 5JJEB 5ENZA 3U31A 3E4CA 1ZN8A 4D0GA 2Z2JA 4H15A 2EFEB 1GIAA 3R9XB 4ZVPA 3K1YA 1H2AS 2FJUA 3F5QA 2Q5JA 3KQKA 3A9TA 1AUVA 1TT5A 5C81A 4X1YB 4QOJA 1IG0A 2IJKA 5TPWA 4PRZA 5CG2A 4HQRA 3HUFA 2GPSA 1R12A 1NNSA 1P9OA 1CK2A 3CC2F 3P2OA 5TRTA 1UFOA 3PFHA 3MPUA 1U6JA 4PA7A 3AESA 2XVZA 4BX9A 2V4ZA 2QMZA 3T3OA 1S0UA 3VQWA 3HJGA 4PFJA 4OU5A 1VI2A 3C8MA 3UT5B 2UV8A 3PX2A 3PHIA 5LDHA 4D96A 1NXOA 4QPCA 1ZQ1A 3HCAA 4RZIA 5FL7G 2Y4UA 5TMPA 4OIFA 2WKRA 5B57C 1Z4NA 3B9PA 2D1YA 1JWLA 2X22A 4XVQA 5LZ2A 1VK3A 3QFFA 4FW8A 3PGVA 1YKSA 2XRMA 4MK4A 4IIBA 1L5ZA 3VH4A 3QNEA 4HVAA 1U2QA 1YKFA 4ESVA 3V97A 5IBQA 4TWKA 1C1YA 1X3LA 2X9GA 2FFBA 4ALNA 4UCQA 4L9WA 5KPDA 4R3UC 4K1XA 2QNBA 1VQKF 2AOTB 3W8NA 4TLEA 2W2LA 3CMEV 5TS2A 3D7MA 1ZVVA 3I3OA 4RD3A 2CH7B 1NJFA 3R5XA 4LZWA 3OT4A 3L73H 2V3CC 4M0EA 1JFLA 3WNBA 5KQSA 1HDRA 4DK1A 1P2FA 1I2DA 1RSOB 3TKAA 2GO7A 2HYIC 1VIYA 1AI6A 2VPYA 3QWHA 3G79A 3DMFA 2YVLA 5K0FA 2Q3JA 2IBMA 3ZEDA 3OH8A 2DX7A 3THYA 4JLVA 5LBQA 2PO7A 3FLBA 2IBZH 2YQZA 1V35A 3D0RA 2R8EA 4RMHA 3FWPA 3GFSA 3LSSA 2WZDA 3KZNA 1AF7A 3F2VA 4YRAA 4AXXA 2RAFA 1JEYA 4Q3KA 2A57A 5IYBO 1B0AA 4NU0A 5JBIA 1W2WB 3V8EA 1T9CA 4WCFB 3A58B 1QHNA 5AKIA 5G4UC 1DMRA 3NYWA 1BCCH 5DKFA 5KZMB 1GZSA 1SKAA 5AI9A 3E53A 2PUVA 2FZGA 2RCNA 1LEHA 4MH0R 4RIEA 3UMSA 1E63A 3RSOA 1U1IA 2QMHA 2WJHA 5FPOA 4A1OA 2FK8A 2H4WA 3NVAA 3KQSA 5JZVA 1K3EA 4B7KA 3GY0A 4UTPA 1ISJA 3KOYA 4M21A 1QNLA 1JR4A 1Q8RA 2QSZA 4UCXA 1ZOSA 2VDLB 1S5LZ 3RJTA 1IOLA 5MFZA 3RU9A 5KHOC 5ICGA 2QEXF 5J43A 3OP4A 4PI2A 1UWKA 4XPIA 5BMVF 4FLZA 4YAOA 2PJRA 4HYOA 2R2AA 2RGBA 3E7FA 3NBFA 3R09A 2M1XA 3DDHA 3BC1A 4NMLA 1QVFU 1GKLA 3DTVA 5WRFA 4PR0A 1OILA 3QYFA 3ANNA 3BIFA 4NKGB 1XELA 1L5HB 3AQIA 3AUUA 4DQ0A 3UJHA 2SCUB 1DPGA 2Y92A 2O59A 1PU2A 2PRKA 2CZCA 1G21B 4ZDKA 3EVAA 3K06A 3MCZA 4FS3A 3BCSA 1BVUA 1C9EA 2NP6A 1JQEA 1XHZA 2VK1A 5GQSA 1IZYA 5JVDA 3UAVA 3CCUV 5DX1A 1R6DA 3NH9A 4P35A 1VQNV 2VK8A 1G66A 2V4MA 4MRPA 4UQLA 3QQ5A 4J9VA 3KKPA 4A2WA 2H2FA 5EMJA 2QTPA 2YFKA 2Y1CA 3EDOA 2XE8A 2I67A 3NTUA 5I4CA 3ZI7A 2I1VB 1WZEA 4QUIA 2OLJA 4J7CA 2BGKA 3B36A 4G5OA 3NM4A 1GG8A 3NEJA 3LNCA 1JU4A 1CVLA 5DXJA 3DZFA 4D9IA 3R24A 3LPDA 2Z1UA 1RYBA 2Q3BA 4M0FA 4ZFNA 3FG9A 2Q0SA 3NBMA 4DV4B 3JALA 2CJYA 2GYUA 5KYKA 3QPBA 3LLVA 2OP1A 2PZLA 1RHQA 4N9QA 1QH8A 1C0EA 5IY5B 4EFDA 1NL3A 1GN8A 1Q3KA 3NEPX 1WAZA 2Q46A 1EUDB 3AIKA 1VBFA 1XN1A 2M1ZA 4RAOA 4NCAA 1QX3A 3BY6A 3KE9A 4RQEA 2DQSA 1N0HA 5FBZA 3U4IA 2BFPA 4I1IA 1FRNA 5CBGA 2Q5OA 1KI3A 3AVTA 1OX4B 1P4GA 2BLLA 5HOEA 4G36A 2FZEA 1YIJF 2ZYTX 5DHUA 1QLNA 2WLNA 1UFVA 3BD7A 2V6FA 5IF3A 5K05A 3RK1A 2FEMA 4NECA 1R4NA 1YA4A 1S02A 4K7JA 1XRSB 1QKKA 4OGFA 4UTOA 2CXRA 4UJ3A 4MWGA 5L95A 1FP6A 2WT4A 3IBYA 1A71A 1KKLA 3PNPA 2WWTA 2R6DA 2YFHA 1HTBA 2WA2A 5CB8A 1Q6ZA 3WMEA 3S8EA 1G9TA 2XXJA 4QDJA 1N6LA 3HEBA 1K5HA 2VT7A 3BIWA 3EARA 4FJ1A 1TUGA 3IE1A 3HB9A 1NKDA 2B4KA 4IH9A 3HJUA 1L9XA 1DWQA 3C7AA 1LGYA 4GM0A 1QGAA 1XZHA 2D06A 2IYWA 1Y7HA 3TX6A 1U2DA 2GLXA 5ARDA 3ZJUA 2BWJA 4N3NA 3C1AA 2BKEA 4I1UA 1N77A 2WPDD 4I7EA 1X9HA 4ND7A 4MKHA 4OMFG 2C77A 4MAAA 3GLUA 4PZYA 2A67A 3RVQA 1IEVA 4US0R 4MI9A 1HLGA 1G17A 1NLYA 2W2PA 4DSOA 3WMXA 1M34E 2J5KA 5LBIA 3C5VA 2QLMA 4QGSA 2B5VA 5CXUA 5IXSA 2JIMA 2XT9A 3ESJA 3OEED 4PA3A 3EXFA 3E48A 5C5EA 2SKEA 2XYPA 3KEMA 1Z26A 1Z2DA 1OFIA 2ZJ7A 1L5WA 1JKMA 2YZNA 1NMXA 2NO7A 5DM2A 4YP1A 5IU6A 4LX0A 1BMFG 4P3OA 1DKOA 2BSKA 4HX9A 4GLXA 5LQDA 3TE7A 3KTFA 1MRNA 4R6WA 4MMXB 4L9RA 4JXJA 1OXVA 5BN5B 3ABQB 3A1DA 3HJNA 4ZCIA 3U3DA 3CN7A 3NC0C 3JAWA 3EZ9A 3W5SA 1T6YA 1FQKA 2ZWVA 3ME5A 2JEOA 4DG5A 2IPAB 2ZRAA 2ID9A 3TR5A 5ALSA 1SBZA 4TS9A 5EJAA 5T4FA 4AECA 4M1ZA 5KHHA 3TLGA 4HN4B 5BO5A 1EK1A 3MGAA 2G36A 3QVXA 4FFVA 5DISB 2EVWX 2AW5A 4RESA 2BM1A 4UTVA 3NUGA 1NOIA 2GZRA 3VNUA 4L2IB 3I6IA 4ML3A 3U1TA 2BR4A 3SSNA 3KV1A 1TYDE 1IZZA 5DK4A 3QVWA 1KSFX 3JQCA 4FZ1A 1B00A 2MU1A 2YWFA 3BMOA 2OGZA 3E70C 1QIHA 1I0HA 2QDXA 3EGXB 2CGEA 1D8AA 3RIXA 4YRSA 3K35A 1C29B 3BZUA 1TO6A 1X87A 3PUKA 5TQ2B 1N0WA 4OA5A 1N8NA 1UT6A 4PHFA 5ALEA 3MPOA 1USWA 2MINA 5KTSA 4Q21A 4BC1A 3ZGXA 1X1RA 3I92A 1CUBA 2DR3A 3HR0A 4CCWA 4YRKA 2I4IA 2OY0A 1T0AA 3U17A 1MJHA 5C8YB 3TI9A 2WWVD 1ODEA 3FWHA 1XJ0A 1Q81H 3ZZNA 2I4TA 2AR7A 2AG5A 2XNDG 4FINA 4FMPA 4GMGA 1M6VA 4GD3Q 2WSLA 5EUBA 1KORA 3MWEA 2XCTB 1EWRA 1U0RA 3VPHA 1S8NA 5I48A 4KQIA 4WXPA 3K2BA 2X4IA 2YN4A 1ICEA 5JCJD 1R8XA 1ZCJA 5AXAA 4BBPA 1JG1A 2IGBA 4BDSA 3C7DB 2VF5X 2QRNA 1R3KC 3G2QA 3CRMA 1GPMA 4QECA 3TUJC 5B1NA 1DJLA 3DT8A 2VUUA 1OBCA 3H19A 2IHVA 4RTMA 4ZODA 4R2IA 2V9YA 1I3LA 1Q11A 4LJ9A 3HBAA 1H2LA 2VQ3A 1BOFA 1IPAA 4CIXA 3T1HB 5EIOA 3OLCX 2NZWA 1OI3A 4GGMX 3DSQA 3SQWA 2PWBA 4XLTA 1QCYA 1T25A 1U6IA 5ALKA 1COZA 2ZITA 3VSDA 1HR0O 2OYSA 4AN0A 2ILTA 2NVBA 5LA6F 3WS7A 4WDQA 4KVGA 1JTFA 2ZVDA 3DYBA 5DBOA 4EATA 5HG0A 3F6SA 1EGAA 4KL8S 3VMMA 3FYIB 4NHEA 1P81A 3PZBA 5AK6A 4RVHA 1F2DA 1BXGA 4PM4A 3H6KA 3CKMA 4FXOA 4Z2WA 4GAEA 2OAEA 3WJAA 3SU8A 2GEDA 1I0LA 4WCFC 4JX9A 4OF4A 1NIJA 3F6CA 1KJNA 1K7DA 3EGDA 3GARA 2CVFA 2OPHA 2BH9A 3A7EA 4BQNA 3KB1A 2QTVB 4G0ZA 1WEHA 2A0LA 1GZ4A 1KVUA 2I99A 4DYDA 2F2TA 4X3CA 5B53A 4E31A 3D7RA 4JTCB 4ZOLF 4UU1A 2AUTA 1Z38A 3WRWA 4KPYA 5FPKA 4DJTA 1IN1A 1ZAYA 1BDIA 4JEUA 1ZAUA 1BA2A 3EQ9A 1HYBA 2EP7A 2AFHE 5A5GA 3VYVA 3HN6A 1ENVA 3OM3B 5EK0A 4JYBA 1KERA 1XL0A 3ADBA 3KCQA 1E69A 2QX4A 1E2LA 5KJCA 1I14A 5DM60 4B2IA 4DGSA 3WJ1A 1ZZGA 2QMQA 2F00A 3HLTA 4N40A 5FCDA 4D45A 1JECA 1YS1X 2QLLA 1V26A 3CCMV 2PS0A 4RV4A 1F2VA 2ISSD 1FU4A 3T4ZA 4PYQA 1B8NA 2ZWMA 4LRWA 3COSA 4IVRA 3M6XA 1EH5A 1PFKA 2VJOA 1LBTA 3WWCA 3RRFA 3P2JA 4Q1CA 1AR5A 1XNGA 5AKJA 4ALLA 1UP7A 4S1NA 3Q88A 3F96A 3K1JA 4D8TA 1GMGA 3I8XA 3F7VC 2P2YA 4U1RA 1VLMA 3X2FA 4BV2A 3RVKA 3DBHA 1IWOA 2XGOA 4DR1B 4GH5A 4FMTA 3QPVA 4KSCA 4XFKA 1U63A 3TSCA 4JV5B 4EMBA 5GPBA 1YR6A 2XMDA 1BD3A 2QRQA 4ALKA 2ETVA 4ZK2A 4AL4A 2CJWB 4AJOA 5JSZB 3PC4A 1PNTA 5A9TA 2SECE 2OV6A 4MVJD 5LQUA 2P65A 2DHCA 2GCOB 4N3AA 2HA6A 3FBAA 3TR6A 4HNVA 4NOLA 1F2UB 4K8OA 2VEOA 1DKNA 1OZHA 4QNRA 3VR6H 1WA8A 1SPXA 3NKFA 1Y5MA 2CFIA 3ZGVA 4FUQA 1WHSA 3ASZA 4FFOA 1V45E 4H08A 2Q0XA 3GJZA 1NOJA 2EF1A 2GAOA 5LBTA 1AS0A 4DA9A 1MC8A 1JI0A 5K03A 1R50A 3QNUA 3HZHA 1K0FA 3EPKA 3LP8A 3BGOS 4N3BA 5ALVA 4BP3A 2HNKA 3N8DA 1RQNA 4GP9A 3FTNA 3K0AB 4N1AA 4FNAA 3ADKA 2CXTA 4FFLA 4KXVA 3PP8A 2QSYA 5FWDA 5ALFA 5IY5C 2RI6A 1BE6A 1ROPA 1PT5A 5CT9A 5B7PA 2BEUB 5DEOA 5HX7A 5CMUA 2OBXA 3AFOA 4QQKA 4X3PA 1NSTA 1OKKA 4EYSA 3PJGA 5G0SA 3PDIA 2HQRA 1XZJA 2B34A 2H1IA 4LISA 1C7ZA 2R6CA 2XKJE 3FB1A 2WMYA 4ARAA 4WK2B 3CRRA 3PRJA 4FBLA 4S04A 3PXAA 4AS3A 3HBFA 1RZ3A 4G2KA 5TX7A 3JX9A 4X41A 4Y9DA 3EPHA 4IMJB 1YZLA 2VN8A 4E7PA 2Q3MA 5KKCA 5C4MA 1RT9A 2PKXA 4AG3A 4XVHA 1Y9ZA 3E0QA 2GSMB 4LNUB 1EFVA 5B3SB 2B21A 4PAOA 2EJWA 3I0NA 3K1AB 2JAUA 4KYVA 3L8GA 1H2BA 1XLVA 1RI3A 1HX7A 1C1XB 3DAFA 3D9QX 3I42A 2BKLA 3U7QA 1UOPA 1EVJA 2P9GA 3PFKA 4WECA 1E4VA 2G9NA 2IYUA 2XTNA 1SY7A 1TIKA 1V11A 1XFDA 4GOJA 3V1YA 1QGZA 1DPFA 1XAJA 1AJPA 1KY5A 4I2NA 4JP8A 4BEJA 1SZDA 2FUG6 1JG6A 4DSNA 2CVPA 1MO3A 2V7TA 4X9XA 3CG0A 2OB1A 4KXNA 3OPYI 5CFPA 5ESWA 2IUEA 4BU1A 1MO2A 2IIPA 1E3WA 4N65A 5T57A 3DFMA 1DUSA 3F7TA 3PXCX 4DY4A 4XB1A 3OCCA 3FI0A 3CX8A 3HMKA 2PYJA 2VQSA 3EIOA 3TD3A 1X39A 4KO1S 2WRZA 3I5UA 1Y6FA 3HM9A 1A5AB 5JS2A 3GDGA 4K6MA 2RBEA 5ALUA 4LAFA 4E46A 5IEBA 3N2KA 3PGMA 5IXJA 2Z58A 3Q7EA 4K1LA 4DLBA 4DC0A 1FTWA 2CUNA 2P4QA 3JCUZ 2PCJA 4ZIRA 4CG0A 3W06A 4W5OA 2YHBA 3BGWA 3C7TA 4ANFA 5HFLA 1I6MA 3EIWA 5LZ5A 1RI4A 2Y4OA 2CNLA 1LX6A 4AQYB 2VOJA 2H51A 3H5IA 1IHDA 2QQEA 5A7HA 1VQNF 4PLCA 2OFOA 4DS3A 3D8RA 4EEZA 1PR4A 4EO4A 2DQ4A 3LT0A 4BFZA 3O1JC 1M6HA 5JYDA 1C0PA 3K0SA 4OQLA 2WU1A 1U0OC 3IA2A 3T4UA 1AQ6A 1EVQA 2ODWA 4QBHA 3GRAA 4LBVA 3CYOA 3G59A 2FB9A 4RULA 2F8TA 4B79A 1FSPA 3VR0A 1P91A 3GJYA 4R1LA 5F2EA 4OQMA 5BWCA 4ABYA 4TL7A 1CRQA 2DUWA 3BRSA 2B1JA 3FAZA 4TM8A 2R8PA 3BBLA 2DR2A 2YIDA 3TLYA 1YRBA 4DC1A 4WFHA 4CC6A 3GEDA 1Y8RB 2X8LA 1E1LA 3AR8A 5K2MA 3ESYA 2C84A 1KQOA 1X2BA 3T7TA 5BSFA 3OE7A 3BWVA 3U9LA 3O3MB 3DKIA 1E89A 2ATEA 5LYJB 3B8HA 5CA3A 1Q0LA 1GK9A 2AOWA 2X9LA 3EVFA 3N2YA 4IM7A 1WMBA 3CRNA 5ADUS 3Q7SA 1ITZA 1FFXB 1KYQA 1FLNA 1QVZA 3OQJA 3U3XA 3WMFA 2GD1O 4RCZA 3QXGA 3BFPA 5E2IA 3OPMA 1SC1A 3TCXB 4GM4A 3LWVC 1OBOA 4NAUA 3S99A 3RFRA 4NCHA 3H9VA 4AK9A 4DV1O 1ADYA 4Y6GB 1ZI6A 3HDGA 4D42A 1JS1X 3ZMVA 2FL4A 1ECFA 1HTWA 4UNSA 4EJSA 4EFNA 4PC6A 3KOWA 3ELWA 3GQBA 1F3OA 4UDYX 1RP1A 2LW1A 1ZMBA 4YHBA 4XQ0A 2AUMA 2ANCA 1WMDA 4C04A 1Y3CE 1XZLA 4HGRA 1NNEA 1YMQA 1Q7EA 4DARA 3WA7A 4JYCA 1IBKO 2AC4A 1WXIA 1D7AA 4OFWA 1XMQB 4QOFA 2JEZA 1F8FA 1SVWA 3JAMN 2PS9A 4DA4A 2BKAA 3L4EA 4LYFA 1T5OA 2H1HA 3AEKA 4NJEA 1UEIA 3CGGA 3SYAA 2UUBO 5KHGA 2P9BA 1TZBA 5CVCA 4IOMA 1UBUS 1Z73A 1GZ0A 3B2NA 4NBSA 3D3EA 1XAHA 3N6RA 4KIWA 2ZCVA 3LMKA 3LD9A 5C93A 2YV5A 4XQEA 2O5VA 3EODA 4DO2A 4YJ2F 2WVHA 2CY0A 1F23A 4UBMA 4LN1A 4KJZA 2XUFA 4H3SA 3JYHA 3N8GA 1WXGA 4YWJA 5CLHA 2EINB 2Q7EA 2ZI5A 4Z4QA 4DZRA 4DMHA 4J4BA 4H7JA 1X1DA 4DIMA 3COPA 3DW3X 2DOKA 4EUSA 2CSUA 1AZWA 2WD7A 5H6RA 1GN9A 1KJQA 1XMXA 1C7JA 1JPXA 5E9AA 2F90A 1GKYA 1OPXA 4PSCA 3ASNB 3KJEA 2YBDA 3GUYA 4A6EA 4AF6A 2ZDHA 5LGUA 4PA4A 2X0EA 4HNGA 4BP9A 3HNOA 4RCVA 3DKPA 4YPVA 4ZO4A 2AYYA 2XLCA 1GTMA 4LKRA 4RW0A 1YQUA 4ZU3A 4AY2A 5JI2E 3ST7A 4EHKA 3G80A 5DASA 3O8DA 3E7DA 3MBIA 2BGNA 1S8FA 3NIBA 2JD2A 3D02A 2C94A 2CHGA 3VKFA 3SC2A 1YDWA 5G40A 4X3LA 3J81N 2ZJYA 5IT5A 3RW0A 3PNOA 4TKVB 4DIEA 3V34A 4OYHA 1I4DD 1NVUQ 2DPXA 1KVTA 3P9KA 2GN2A 4BLQA 1H7MA 4QRDA 3EQ8A 1E2EA 2GTAA 5ITZB 1E2UA 2GV9A 5E6SA 3BFXA 3DXRB 4L1KA 4XWOA 3KAPA 2P8SA 2DFVA 3G0CA 4KXMA 2G1AA 1Z7GA 1EP3B 4WX2B 1MAAA 4LPKA 2AZXA 2VRNA 3WOVA 2BL4A 1IURA 4JI1B 3LFOA 1QGED 2WKWA 2RBKA 4QLBA 1AV7A 4JY7A 2IKQA 4LE1A 5IKOA 1P0PA 3HCWA 4NTWA 1B41A 4EHFA 3GFPA 2LV8A 4QPKA 5FO0A 2B82A 2GPWA 2QXTA 4JUCA 1LQTA 5FQOA 3VNQA 3GJ8A 3PE4A 1ANKA 2GBIA 4PPNA 1YB4A 1GNSA 1QKIA 3KKZA 3TLKA 2FPWA 1U0FA 2WJ3A 4UOEA 4UUAA 4I6EA 1RVV1 3FHOA 5L3DA 4EMTA 1NP3A 3LUAA 3H01A 1KJIA 4YN3A 1LK5A 1N0JA 3UWOA 2CVLA 1E9FA 4EP1A 1YUBA 2ZZKA 1SD5A 1HO3A 4M36A 4HQ0A 3PYXA 5CNKA 3ZDFA 1W1UA 1DT9A 4Q3EA 4AKSA 1K7FB 1Q1NA 3MS7A 4KV7A 3G7NA 5IC6A 1YC2A 1SBYA 5BR8O 3UB4A 2Y6UA 1V1RA 5EWRA 4IV8A 4DRZA 4JSRA 1ML3A 2NUAA 5ARBA 1OXSC 2RJOA 2HSEA 2XY4A 4MPJA 2YZGA 2ZJ3A 1N6NA 3FKJA 9LDBA 4J11A 1UIRA 3WOHA 5JS6A 3EULA 4FLWA 4PN3A 1GGJA 1ISMA 4I5EA 1K86A 1KKMA 1R00A 4U2GA 1RZRD 3DWGA 5DV9A 5BSWA 2I8CA 4W5WA 4G24A 4HS4A 1O58A 1Q1GA 2Z30A 4A3SA 4LR3A 1YQEA 3H9EO 3V6MA 4JVLA 2YCBA 3ZIAA 2WB4A 3NHKA 4JT8A 2FR8A 3OU7A 4Y2JA 1QE5A 5ILGA 4K9SA 4NWOB 1LY1A 1FX1A 1HEYA 5B4TA 3M6UA 3R0IA 4ND5A 2OO5A 1FXSA 2VLBA 1EVIA 2ZUTA 3H0CA 1CB7A 2GKSA 3MQ2A 3P3NA 3U3ZA 2EV9A 3WL5A 1JXOA 1R9NA 2FPGB 3OPYA 3F78A 3TJMA 5KQPA 4UC0A 1M33A 3R4VA 2QRHA 4H0LB 4IXWA 1T5IA 2JS5A 1U6KA 1H69A 3DBRA 2GNPA 1CJCA 4L57A 4WLVA 4PPFA 5EWMB 1ULBA 3OJXA 4C6HA 3ZK7A 1E2PA 4FEYA 1W6UA 4FJ2A 4UW9A 1KDPA 3VU1A 3B4SA 4N6GA 5I9IA 3E7XA 2BIFA 2J09A 3PRYA 1VE6A 3PFWO 2B8JA 3S27A 5HFJA 3C5EA 1CUSA 5EE9A 1R18A 3CPWU 3PLNA 4DR4O 3IHWA 3G17A 1B8PA 1ZWLA 2PYDA 4ROSA 3R0VA 1WD5A 3C3PA 1NU1H 3OX4A 5A9SA 4JGBA 1GWNA 2AEEA 4WFKA 1LS1A 3SC6A 4TQDA 1WULS 3SPXA 3BGVA 2HK7A 3FCEA 2H0RA 4CKCB 4REOA 4J03A 2QJRA 3DBLB 5U1PA 4H13B 1SXPA 5FPTA 2XIJA 3VR2A 3H1EA 1TO2E 1RPJA 1O6CA 3JYNA 4JK3A 2VWHA 3H5TA 3X3HA 4IVPA 1YRYE 5DZSA 3GAZA 3PXEA 4HH0A 4LZPA 3MTIA 3J7AU 5LNK6 4NS4A 4OQNA 4Z4IA 4IHJA 3JARA 3GCZA 1P60A 3GCGA 3AUFA 1JEQA 5ER6A 1WCYA 5CJJA 2XOKA 1NF8A 4BWYA 3FZEA 1BXRA 3DBOB 2Y1DA 4EVIA 1KSHA 2BD0A 2Y71A 3O8BA 5TT0A 3CLTC 4AF8A 4JYZA 2WJJA 1QH1B 3PXUA 1RC1A 4JODA 4R2JA 5DI3B 3RH0A 3C3WA 4KXRA 1PNKA 1F6BA 1NLUA 4G0QA 5KKNB 1EG7A 3IO5A 2Q4TA 4ZAFA 4ZJUA 1YVUA 5AHWA 4LXGA 4TMKA 4I0XA 4X9QA 3G1TA 1ESEA 2O8FB 1FFWA 3H1AA 4HRAA 2X4GA 4L5JA 2G0TA 1FPOA 1YE3A 3JCZA 2GETA 3RVNA 3WLJA 2IQ5A 3PT5A 1ZWZA 2WT8A 2E3JA 2IEGA 3TD5A 1PX0A 4KN8A 3T15A 2VKQA 3VC2A 1ONIA 1SC4A 3R8XA 4BVKA 4Q1AA 1EAYA 5FBKA 2C04A 4NZMA 1IWBB 3VO1A 2NSYA 2JJ2G 2Y2VA 2J6HA 1A04A 3I4FA 4JLDA 4BE7B 1VHJA 1VCIA 3PFCA 4KACA 1SHKA 5GONB 2A0WA 3T7RA 2CD9A 4JLWA 1VRWA 4XWWA 5EWLA 4WNAB 1EBUA 1TC1A 3ZLTA 2HFKA 5IWCA 4J3JA 3K5OA 1QHEA 5H16A 3PWKA 1XHFA 5JNVA 2GPJA 2GKGA 1ZNZA 2H5JA 4DDVA 3F1KA 1VB3A 5BT8A 5BOSA 3O8RA 4G5HA 2WYHA 1I6KA 2ZAIA 3CQ9A 4GEKA 1KS9A 1N4CA 4RFSA 1RQGA 5FOVA 2IEZA 1U80A 2GJSA 3R9IA 3VVCA 2W5UA 1H2KA 1ODKA 4X71A 2V0GA 2WFZA 5HUQA 3LWBA 2E4VA 1GZ5A 3MD9A 3GN2A 4DDKA 4KH1A 5JSUA 4D46A 1JLLB 5DN6D 1UPUA 3EIHA 4D4IA 4LS3A 2PX6A 1U0NA 2XKAA 1J2RA 4PCUA 1LPOA 3DGFC 3FOBA 2FK7A 4ZVUA 1D09A 2E4UA 2IHBA 4IH1A 4XVUA 4KE6A 1UI9A 2CTRA 3WRXC 3OFNA 2COKA 4Z7JA 1WDWB 1NBWB 2VNHA 2FWAA 5DGDA 2Q1SA 1EVYA 2G5PA 3UWPA 1RRVA 3DOIA 4MGKR 3AR9A 5JCOA 2XVYA 2FYTA 2WA3A 3V7WA 3K30A 3TRFA 1QHHA 2WWFA 3NCTA 4QOHA 1Y5NA 3GGCA 3I9NA 3LC7O 3V4OA 1H93A 2X8AA 2KG7A 2Z8XA 3ND8A 1VGQA 4ZVOA 3VYWA 3C3CA 4EHBA 3S1AB 4CYMA 2QF7A 3TRKA 4M0UA 3O4RA 3GF4A 2JDIA 4GSLA 1FXWA 1JNYA 5BURA 3TZBA 3I32A 4RUKA 4BWVA 2ZM6O 1QQTA 3HBJA 3G0HA 3ZU6A 3FB4A 5AVKA 4MRMB 1IXKA 3R5TA 3AG7A 4LY0A 3SHVA 4FYPA 3NGLA 4L16A 4HEQA 1YZTA 4UM9D 4AJIA 3W5IA 1PI3A 4WLEA 3P96A 2V6GA 4YMWA 5T4HA 4E1AA 3IQEA 4EPXA 1TYBE 1PNOA 1DAIA 4D0LB 4DMKA 1HNWO 2R5NA 3HGTA 2GBOA 3HWUA 2B69A 4IEIA 2WSIA 3DZCA 3QWIA 4NSNA 3LSTA 1A69A 2C9DA 4ZCMA 3AVYA 1PDWA 3X1WA 2HF9A 2Q6VA 4HBZA 5LR6A 1MIOA 3SHOA 3VV2A 2Z83A 2JLYA 2H08A 3WQBA 3SIPA 3N2IA 1SQXH 4G28B 1X7ZA 1WAMA 2V96A 2NN4A 3K9GA 4TL6A 2K1EA 2FSPA 1WP4A 3F6YA 3TLBA 2IXEA 3BQNB 1HYEA 4MQEA 4MYTA 1QHTA 2Q1TA 4WE3A 3CNHA 1SOUA 4FN5A 4JJKA 3DVSX 3IP9A 4M9CA 1RE0A 1TAEA 1G63A 2PFKA 2V7PA 4XA8A 3WLFA 1GUZA 1QGUA 2L82A 3BCHA 4CCSA 4PX2A 3K59A 3DOCA 2QR5A 4GI1A 4B6SA 3C3JA 1M2VA 5D5HA 4J1TA 2F48A 3L4SO 5H8WA 3BIOA 4JOBA 1YR8A 1ESMA 4GG1A 2PPLA 4WBNB 1ZJJA 2WJVA 1I8TA 2OCYC 4DF3A 1R16A 4HRYA 4FKZA 4IJ5A 4HWGA 3UG6A 1JKIA 4Z0PA 2B5WA 4KUEA 4GGOA 3C3AA 3L7JA 5DLDA 3OHSX 1E2BA 5GWXA 1X7YA 2C2AA 3AGKA 2C4NA 2JI7A 1T0IA 3SYCA 1VMIA 1F0YA 1A2QA 5GIOE 4F71A 4PWTA 4YK7A 2YKGA 3JQ9A 3CRAA 3LOUA 4GXQA 3H5VA 2C5SA 5B1EA 2H16A 3E58A 2OXCA 4EH1A 1KC8W 1XD9A 2V6BA 1V1MA 1KU0A 2GK7A 2O2GA 1NBMG 4AMYA 2IU4A 3D8BA 1IVNA 2J4DA 2ODQA 2F9ZC 4YAIA 4QQFA 5TARA 3C14C 4TVOA 3E5HA 3IT0A 1Q7YW 5MFPA 2DU8A 1P3Y1 3CF6R 4A92A 2GOYA 2C2BA 4DUGA 3H2HA 1YJBA 2ONYA 4QX6A 1XRGA 3VC1A 1VG0B 1PJZA 5EZYA 1CN7A 1M34A 2IYEA 4F3KA 1M1YB 4K6GA 1TNDA 4NR1A 2Y1FA 4IZHA 3ZNQA 2EYUA 1HQDA 4MR9A 1D5WA 1NJ1A 2HA2A 2IYYA 5AI8A 2R11A 3VR4A 5JMOA 3LBNA 1T36B 5H6QA 4MINA 2G4LA 4YJDA 2G80A 3IO3A 2OC9A 3NR2A 2QTOA 1BVYF 1W34A 5IUJC 1ZM9A 2Z9CA 5EUCA 1WM1A 3OY2A 3SK0A 5DN9A 4RNDB 3EHEA 3K9WA 5C80A 2H1VA 4R5MA 4G2NA 2VL7A 3FTEA 3AEUB 3LF2A 3OF3A 3EGVA 4P6VF 3JTMA 1T2UA 2FWMX 2IYOA 4WBXC 4RUFA 1ECBA 1CRZA 1H0SA 2WV9A 4V3BA 1XQWA 3OKAA 4WY8A 4BWGA 1A88A 3H97A 1G3UA 4V3CA 2EKQA 4C5AA 3KALA 2QE7D 4HAIA 3W1WA 3GLIB 3N0XA 1U9YA 3AILA 4JR2A 4QHSA 1CZNA 1Z5UA 1Z0FA 2XB8A 3ADPA 3GEPA 4LDNA 3ZWOA 3OO0A 3IEQA 4JI5B 1BS2A 1KQFA 2G06A 3BULA 2WTNA 4DIOA 4GYJA 3MTJA 3EXIA 5EJ7A 2EFYA 2QQ5A 2WU4A 4IX1A 1E1QA 3F46A 4BJ3A 1I5YA 1S2OA 3W6ZA 3JQ8A 2XVAA 3L06A 2AI2A 3UKDA 4EW2A 2L0XA 3B82A 4GKKO 4FU0A 1TU4A 5E6UB 3RAJA 1SA0A 1R3LC 3KQLA 4R50A 2CMFA 5IDYA 4B7AA 1XRRA 3UYLA 3RC8A 1N5JA 5K1ZA 3M7MX 4B87A 5LOVB 2BF4A 3K20A 5D6OA 1MIHA 5EKXA 1U2GC 1WTAA 1J4AA 3VZPA 4BMZA 1E6CA 1T6NA 4HFMA 1HFKA 1KQSU 2ZQ5A 4Q1EA 5JZSA 5JZ9A 3EMDA 1QTNA 4NU6A 2C9BA 4EI9A 1ZW6A 1G20B 4HB4A 3EXHC 1P4HA 3N2LA 1XCPA 5C4IA 3MFQA 3GJ0A 1S1MA 1TGYA 2B0JA 1QE0A 4I4TB 4DR2B 1BA3A 4PHZA 3LKZA 4ZI7F 4L8YA 5G02A 4ZAVA 1P1RA 1ZUHA 2J59A 2QLJA 3B38A 3CRW1 2ZIAA 4BUCA 1Q6UA 4UMEA 4PLGA 2O4CA 2I76A 1K5PA 1V3TA 5I7UA 1XXHE 3PD1A 1RNLA 4RGYA 2ZSJA 2YXNA 1VJRA 1AKEA 2O3JA 5AVXA 4QM6A 3HSKA 2EKDA 1NXQA 5J40A 3P71T 2VQEO 1AMOA 5FTJA 2E2WA 2AX3A 3EVNA 2PH7A 2DH6A 2CFTA 1B93A 3QW2A 4UCOA 1IXSB 3PHGA 3Q15C 2P4UA 3RT9A 1J9GA 3RVBA 3WDLA 5ED4A 2IW5A 1QG4A 3FWKA 5KSZA 1GH6A 1NVWQ 3SEAA 2FFHA 3P10A 2HWKA 4WERA 5AW3A 1JKJA 4CQMD 1LNSA 3KZOA 1SRYA 4RD4A 1OD6A 2QVYX 1Q16A 4UHHA 1VLVA 3INRA 1NUAA 1ISGA 1ZITA 4OJQA 2QVGA 3OU2A 3LTEA 1SOWA 2FDCA 2I71A 2VQDA 1ZXBA 2R65A 4F6RA 3B3GA 5FR2A 4FK5C 2HBQA 4HDNB 4PEVA 5FH9A 3KAKA 3SEQA 4DYLA 4Q3CA 1Q6IA 4QEKA 4ND1A 5TIIA 1I30A 1JJIA 3QF4B 4WZ6A 3D3WB 3UM7A 1RKQA 1QRUA 3AMVA 1Y8QA 3NK6A 1Z2NX 3O0DA 2EIKB 2OT3B 3B5EA 2NACA 5KC8A 4GIBA 1AILA 5AJVB 1X1BA 3QITA 1B06A 3SYOA 2R47A 4CV1A 1KO5A 6Q21A 1GU0A 1ILEA 3LXRA 3O73A 3EIXA 5GGYA 4HNHA 4B3TB 2MIIA 4O0MA 4HGYA 3EMVA 1WB4A 4UM9B 2P0EA 3WE7A 2OLEA 1ZTEA 3J80M 3UW1A 4WLNA 1Y4DE 4MGZR 1WA5A 2CUKA 1U5BB 2AFHA 3I05A 2MK3A 3EEFA 3WNCA 5K1PA 2C2XA 5C53B 3O9MA 5C34B 3ENQA 2MJLA 2OCLA 4P34A 2EERA 2A94A 4OHZA 4D57A 2GLZA 2AMVA 4GT1A 1MSDA 4Y30A 4BT5A 4EKIA 1J0XO 2VDRB 2VSXA 1YB2A 1PFUA 1Y9DA 1ST2A 3IUNA 1QCZA 1K5GA 2W6ZA 2J9FA 2J0VA 5K0CA 1KMCA 2OKGA 3HXKA 3QFCA 4HPJB 1NC1A 2ZDIA 6REQA 1GEGA 4KXUA 1JR3E 1CUEA 2BFBB 3HWRA 1SIOA 3QYPA 5TGDA 2L19A 1RRMA 1UXGA 5GJCA 4D8YA 1RQRA 1FVHA 4BO6A 1UQRA 4DXHA 4BASA 3BCRA 2AHOA 3HK2A 4RJTA 4HJXA 4MWDA 2H18A 4PTYA 1NVPD 1OROA 1QBKC 1KIFA 2XA9A 2YX1A 1GRJA 3GMTA 3SS7X 5KAFZ 3U81A 2QR4A 1AUOA 2F1HA 3KU1A 4H16A 4N48A 4Y2HA 2ETNA 1P2TA 2G76A 4OLAA 5DYGA 4MQUA 2VP6A 4RIGA 1OT5A 3F74A 4MW7A 5EZ6B 3J80A 3FPGA 2FTKA 5I3CA 5C1DA 1CF9A 5CAEB 1Q57A 3LH5A 3CX6A 1FFHA 1TQ4A 2E37A 5I7EA 1GQSA 3ZNNA 1JEDA 2J48A 2Z0MA 5DJ5A 4CKBA 1B6RA 1P45A 2ZZNA 1H1LB 3NIFB 4RL4A 1ZD4A 4L0CA 3VOSA 2A0YA 3WBFA 4EARA 2VVTA 4Q39A 1RPTA 2JRIA 5FUYA 5FUQA 3U4DA 2IQIA 3A4VA 3PA8A 4BEWA 5CPBA 1LU9A 4I9UA 2VWGA 3SVLA 3OQIA 5E95A 1NT2A 4UQOA 5JQGF 5AVOA 1NG9A 4IUCS 4IGKA 4TV9A 1JE0A 5JMWA 3B6ZA 3SHFA 4F1KA 4A36A 3D2LA 4RQAA 1TUBB 3FAKA 4OI2A 4YMGA 4IDPA 3AWDA 1FDSA 3U7FB 3C9TA 2YICA 2N0SA 2WPDG 2EWWA 3PUIA 3NWOA 2PLRA 1SU6A 1GNVA 4WRRA 1O3YA 1N7IA 1T1JA 4HDMB 3WFVA 3OFSA 2D3WA 1K06A 5HKLA 4O4IF 5AK5A 1UKBA 2EL9A 2Q7OE 1PBNA 1GZDA 1LTKA 1EFDN 3FFQA 4IF4A 1BGVA 1BE0A 4CM5A 2BJHA 3EBLA 3KYBA 2JD0A 5I01A 3GOHA 3X1YA 2H0AA 2HIAA 2CXNA 3OEEG 1OE0A 2JLSA 5FXMA 1WVGA 4G1MB 3TECE 3QE0A 1OCZB 1ZU4A 4XQCA 1OGYA 2EL7A 3Q6NA 4EHIA 3VZRA 1UIMA 1O0CA 1YC5A 4FLVA 4P33A 3E3MA 4XH9B 4ARSA 1T5LA 1GNLA 4UU7A 3NT2A 5LL6Y 3DE3X 2IX9A 2PCLA 1QGDA 2QEQA 3TQSA 4DCSA 3M0EA 5DOZA 3ZHTA 4KR9A 3D4NA 2VRWA 3KR1A 1CW2B 4PZUA 4ZT5A 4UEQA 1K4YA 2FQWA 2F1JA 1E1RD 3FNRA 3K03A 1EWVA 5E7MA 4TTRA 3BFRA 1RXUA 4FGUA 3ZVNA 5DYYA 5JXJA 4RPJA 2X3UA 1M57B 1WJZA 4J91A 3WB2A 1XRMA 2CL0X 3IBGA 3D6NB 4WJKB 2Z0AA 3WGZA 5A62A 2H94A 3VR1A 4GYKA 1L4YA 2QJWA 4CZZA 1QC5B 2KBFA 4KIUA 3I1IA 2PSEA 2WJ4A 2IH1C 3QXXA 3CMMA 3B6KA 3QG5A 2NUTB