5J2UB

Tubulin-mmaf complex
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Basis of Microtubule Destabilization by Potent Auristatin Anti-Mitotics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 160
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5j2uB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5j2uB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5j2uB01
5CA1A 4O2BA 4F6RA 3JATB 4XCQA 4X1IA 2XKBA 1TVKA 4ZHQA 5CA0A 5MN5A 2BTQB 3RYIA 5J2TB 5FNVA 1W5BA 3JAWB 4EI7A 5MN6A 5KX5A 3JASA 4I50B 5LP6B 4TUYA 5J2UA 3HKBB 3N2GA 2RHJA 3UT5A 5JH7A 5EZYA 1TUBA 4I55A 3M89A 2VAMA 5EIBC 3VO8A 3M8KA 3CB2A 4U3JB 5EYPB 1Z5VA 1Z5WA 3VPAA 5ITZB 2BTQA 5GONB 5J2TA 4O2AA 3JAWA 4B45A 5M7EA 3HKCB 4I50A 5LP6A 2R6R1 3WGKA 3HKBA 4KWEA 4HNAB 4EI9A 4TV8B 4DRXB 1W581 4E6EA 3RYCB 3VOAA 4I4TA 5ITZA 3WGMA 3R4VA 5GONA 5IJ9B 4EB6B 3VOBA 3HKCA 3RYFA 2BTOA 5LOVB 4LNUB 4ZI7A 5BMVB 4HNAA 3E22B 5C8YB 3JARB 5MN4A 1OFUA 4X1KB 4TV8A 5IYZB 3RYCA 3JATA 5CB4B 1W5EA 3WGNA 4EB6A 5JQGB 5LOVA 1RQ7A 1W5AA 4LNUA 5BMVA 2XKAA 5LYJB 3JAKB 3E22A 4O4IB 5C8YA 2GVIA 3ZBPA 1W5FA 4X1KA 5JCOA 5IYZA 5EIBD 4YJ3B 2VAPA 5KMGB 4TV9B 3RYHB 4U3JA 5EYPA 3JALB 5JQGA 3C8LA 4X1YB 5LP6C 5LYJA 4O4IA 5LXTB 5CA1B 5JVDB 3N2KB 4IHJB 3RB8A 4O4LB 3V3TA 4YJ3A 5KMGA 4DXDA 4DRXA 4TV9A 3RYHA 3RYIB 3JALA 5IJ0B 1JFFB 2Q1XA 1RQ2A 2R751 5IJ9A 4U39A 4X1YA 4B46A 1SA0B 4IIJB 4O4JB 4O4HB 3UT5B 5JH7B 5EZYB 4I55B 1TUBB 5JVDA 3N2KA 3JARA 4IHJA 1FFXB 4O4LA 4ZOLB 2RHOA 4FFBB 2VXYA 3HKDB 3WGLA 5LA6B 5CB4A 5IJ0A 1JFFA 4O2AB 1RLUA 2RHLA 2RHHA 3ZIDA 1W59A 4WBNB 3ZBQA 3HKEB 4YJ2B 1SA0A 4IIJA 4O4JA 4O4HA 3WGJA 2Q1YA 4X20B 3JAKA 5JCOC 1FFXA 4O2BB 4ZOLA 4F6RB 4FFBA 3HKDA 4X1IB 5LA6A 4I4TB 3VO9A 1TVKB 4ZHQB 5CA0B 1FSZA 2VAWA 3RYFB 5FNVB 4WBNA 3HKEA 5KX5B 4YJ2A 3JASB 4ZI7B 4EI8A 4TUYB 5J2UB 3N2GB 4X20A 4M8IA 5LXTA
chains in the Genus database with same CATH superfamily
3ZXSA 3NDJA 2OHGA 4OQEA 3VR0A 3HN7A 4JP2A 3UATA 3AVTA 1GLGA 1UPTA 1VE5A 2GNAA 3QYAA 1WDKA 2ACKA 1BH6A 4L5YA 3FR8A 4BRZA 5AMXA 4G5SA 3P0EA 4ZOCA 4KBFA 4MR8B 1P8JA 3K0EA 3LX4A 3X44A 3CC2F 4GSKA 3U10A 3DDCA 1RQNA 4W9NA 2GSDA 1BKSB 4M1MA 5REQB 3ZW8A 3EWNA 2Z58A 1ZH6A 2YVKA 1V9CA 4PSKA 3NVKI 4JEHA 5K0LA 2QD2A 1I24A 3LSSA 1NI3A 4DUZB 2VJKA 3W7AA 4QBHA 1FVOA 1PK9A 1NPDA 5K45A 1PNRA 3R5XA 3JU3A 2ZYWX 1GFWA 3FGNA 4UUMA 4NZYA 1NMYA 3B8HA 1L5KA 3AIKA 3VNRA 4ABYA 3UO8B 3N2GB 1XA4A 5KOIA 1Z5PA 1KJZA 1OZHA 3LUTB 3LFTA 3DM9B 3DZCA 2FLKA 2YL2A 4PIVA 4MYRA 4GOLD 5LLTA 4EKEA 4D0RA 2Y2UA 2XSZA 4OK3A 4ZZIA 5E9QA 4JS0A 4H1WA 3FYHA 1RWKA 4HN2A 5KBYA 5JZSA 2GK6A 4ZV7A 2FW6A 4U02A 3E22A 3FNQA 5CM8B 5TY0A 3AKDA 4RW0A 2QTVA 2VJBA 3RD5A 4V24A 3EVCA 4B81A 3WISA 4DM7A 1NXQA 3A0RA 2GJ4A 3U26A 1J8YF 1R0SA 1DJPA 4NP6A 4RH1A 3SJ7A 2DBVO 1ZX3A 1A9PA 3SC4A 4QD3A 2AVNA 4XUGB 3H1FA 3NJRA 3T7AA 3PN1A 2ATKC 1TLLA 2CDBA 3PNQA 3PE4A 3UOGA 3K20A 5AK6A 1M34B 1IBSA 4UVCA 4YRIA 1A8IA 5JYDA 4K6MA 2ZR9A 4TS1A 4PXSA 3ABQB 4YJFB 4M99A 3FXAA 3HXQA 1ZN9A 1ZA2A 5LA6F 1YJNV 3SC2B 2Q5OA 1Z17A 2VHVA 1UMDA 5F2EA 4R16A 4D41A 5DM70 1WDTA 4OYLA 1PJAA 3VKVA 3EZGA 2QAJA 1UC4B 2PSHA 1E2IA 4MROA 4BX0A 1CF9A 4NICA 4OB8A 2PSEA 2YUTA 3TEJA 5ALWA 4KSYA 2AV6A 3NIBA 4J9VA 1RFYA 3IUBA 3BA8A 2CEKA 3N4ZA 1DCKA 4N76A 4UNQA 3TNJA 4E21A 2GYUA 4YR9A 2OTLV 3PFIA 4MWBA 1IURA 3OCWA 4PAQA 5LZ9A 2A3QA 4LF9O 1AJQA 2JRLA 1ZK2A 2VDOB 1M2FA 3JWHA 2IJKA 5GGYA 2C8VA 2OHVA 1EWYA 3JWPA 5EERA 3UH1A 3WIVA 1GRJA 2CNDA 4I9HA 1Y89A 1QR2A 4XJSA 1NI5A 2HDHA 5JMTA 4MPJA 2Q5QA 5DNVA 1Q0PA 1BHAA 5I3CA 2O5EA 3U7EB 5DHAA 3S7ZA 2MU1A 1K2VN 3RHFA 1TGYA 1BJRE 2A3NA 3N8IA 1EFPB 2IOYA 4NARA 3IQXA 2CDRA 1VLQA 5HCIA 1Y8AA 1MJ5A 3LYUA 3V4VB 2WHRA 1CJMA 4HUQB 4C5AA 2NXEA 2OIEA 1R4ZA 4EKDA 4M55A 4IRMA 1DTWA 4ZMBA 1ZUQA 2A1UB 2AC4A 4XWAA 3HNPA 3GT7A 5LP6C 1DKUA 3VX3A 1PZEA 3NTXA 2JNWA 2QR5A 3TKLA 3OQ6A 3WAJA 1T0BA 1WG8A 4OJTA 4G85A 4JAAA 5I9BA 1UR5A 2GD2A 3RKRA 3AI2A 3WP0A 1TW3A 4JF3A 1ADGA 4EJSB 4K87A 1AKVA 1MX1A 2V5AA 2ZQYA 3V4DA 4O2RA 4AO6A 3AESB 2Y1DA 3RUAA 5LYJF 3IPLA 1SB8A 3UMCA 4HV4A 4F56A 1OBHA 2XE7A 1ZJYA 4CDRA 3QWIA 4JITA 2J32A 1X3LA 3RQIA 1OYVA 2D00A 2IX9A 1HMPA 1FNBA 1YWGO 4G4YA 2VDWA 1K7EB 4REQA 4D92A 2XB4A 3CN7A 2VJMB 1Y74B 2KJQA 2RK6A 4Z51A 3O2SB 5F1KA 2ZCEA 2ZAOA 5A9SB 3LUPA 3HABA 2WPDG 3KLBA 1SERA 3RN4A 4HNVA 2O3QA 3DDSA 3SXPA 2H18A 5DNDA 1SEPA 2DLCX 2OV6A 1ORWA 1YBAA 4HZIA 3G71V 2JGLA 3K92A 1QX4A 2DU8A 4A8JB 1G5HA 1WDWB 4IIFA 4KLCA 2I76A 1K9MW 3G2IA 2Q2OA 1OZ0A 2LGWA 4Z3DA 3U2QA 1BEZA 3KDAA 3VZSA 2IRWA 5I9TA 4E5SA 1W2GA 1UBRS 3B70A 4H3HB 4XPIB 2DQYA 3SPIA 3RUCA 5HP8A 4XR9A 3VZBA 2X14A 4F91B 3F3SA 5JCXA 2AFHA 1HQCA 1YK1A 1FBNA 1A0OA 3ZK9A 5B1BC 3DBRA 3H04A 2AIRA 4Q7EA 2PAFA 5K9ZA 4J3FA 4WEOA 2H06A 1OCZB 2WLLB 1OC2A 3WJ7A 3SPGA 1CUEA 3QEJA 1QCYA 3IT2A 5DK4A 1QNFA 3T4EA 2JCSA 4CDGA 4GR4A 3DOUA 3IPXA 2IPMA 3Q7TA 3EQZA 3AR3A 2GPBA 3FNHA 3RJTA 1KEVA 2VRCA 2FCRA 3CRNA 1NT2B 3WY9A 4JI1O 2OWOA 1AKYA 4R9RA 4EJMA 2C5SA 3SIWA 1VQLF 1KJQA 1YZGA 4X62O 2CLOB 2GJAA 4YIHA 1VC2A 1U8FO 2P7HA 4KQFA 4R1MA 3VJMA 4X92A 4IMPA 5I8PA 1W93A 1LQTA 2FWNA 2HWYA 4LBVA 1KJJA 2ZB4A 1WDLA 3Q7IA 2ZR8A 1T2FA 3WB2A 2A1IA 1EAYA 3FCSB 1KBHA 3IERA 4CMCA 1S2GA 5GW7A 4Y1FA 2C5LA 3VHXA 4OEHA 3ENZA 3FWHA 5SYAA 4YCBA 2Q5EA 3GQBB 3QEAZ 5DI3A 5IP5A 4IMIB 1XAHA 5E2IA 2A57A 3QW2A 1VCNA 3D6VA 3JQCA 2QRHA 2XHBA 4KAXA 3ROKA 4JT2A 2J3HA 4H3VA 1MVOA 4QATA 4QOIA 2BTOA 1N6PA 2GEDA 5B3JA 4YAGA 2XEDA 4I9GA 2NU7B 4JX9A 4B9AA 1ST2A 3ZCVA 2HGSA 2GSWA 2VTVA 1KNJA 2QVXX 2IDJA 3K5IA 1RSZA 3J81N 5JI3E 1PP4A 2P7IA 5HP7A 2AYYA 5DX0A 3JALA 3ORQA 1GGJA 4NU5A 2VDLB 3N4YA 3BMOA 4IS3A 4L15A 5F52A 1PGOA 1U1FA 3OZGA 4L28A 4Q3NA 3L70H 2GVNA 3LWNA 1PLKA 4PM4A 4FR2A 2Y67A 1D9XA 1N0WA 2PT7A 3FNIA 4BZXA 2B6HA 4LI3X 4F2HA 1PKEA 5T4EA 1XN1A 2JEOA 1FFTB 2C00A 3MGAA 3A6EA 1GNPA 2F7SA 2HA3A 1QUEA 4HXEB 4QU5A 1MQSA 2WSIA 3VNVA 2CXQA 1S8OA 4JBNA 3O47A 1AQIA 2HRCA 2XBUA 5FJJA 2BM8A 2SKCA 3ETHA 4HXGA 3HDQA 3EJWA 4YCAA 3DAHA 4N9WA 3SVZA 5KB3A 4O4IB 1ZL0A 4GSYA 3MGCA 3MA0A 5BP7A 4QUHA 1IQPA 2VDPB 3OJOA 4Q9LA 1UBLS 4L9RA 2CK3G 2V55B 3VQVA 2WYHA 3NKLA 3RC3A 3TF5A 3FHLA 4JLOA 5HKKA 1H2SB 3E81A 2V1DA 3CZ5A 3PPIA 4RSRA 3AERA 2GBLA 1L4KA 3SR3A 3NHAA 4HLQB 1T35A 3N70A 3BRWA 4Z0NA 4FKMA 2D7JA 1TIKA 1UOEA 1J25A 2CWJA 4RULA 2ZTLA 3OT7A 1C7JA 2X2EA 3G1TA 1FLAA 1SQVH 4EGJA 3QJ5A 8LDHA 3CC7F 3ZHYA 4B80A 1JIQA 1FIUA 1KQPA 4FOPA 1NJ2A 3GUVA 4WLFA 3LFOA 3SK0A 3LSQA 1BMDA 5IU6A 3KETA 5F9MA 3SZMA 3O1HB 1WUJS 1LDYA 2QE6A 2JFFA 4MVXA 2W0FC 1SXJC 2I33A 3GDOA 1W41A 1Y1KE 1R0RE 1GCGA 5CMUA 3S29A 3CLUD 1I4OA 4XD7D 4U9IS 4C2UA 3SE7A 1P5ZB 3A3YA 1SKVA 2E6UX 4BDTA 4UATA 1Y3IA 3EPHA 3B1JA 1NN5A 3SKXA 4BXOA 1CR6A 1RHRA 4I46A 1QTNA 4QGPA 4FFOA 3UAZA 3SJBC 2CZWA 3RYFB 4DM4A 2O8CB 3QA3E 3D81A 3GTZA 2B69A 1VSUA 1JOYA 1SQSA 1H0HA 4X7PA 4W5TA 2ZJ7A 5JH7A 1C1XA 4GE0A 2PS9A 2NIPA 4R83A 2FPGA 1EFCA 2ZYUX 5F21A 1AUVA 2KKWA 1WCWA 3F46A 2BW0A 5FP0A 3RV3A 1Q1QA 4PNZA 4YHBA 3VDMA 4ZT6A 4P4LA 4V3CA 5GJVC 2IY8A 1DX6A 2AFVA 2L82A 2GT1A 3Q0EA 4FM0A 4Y6QA 5F5XA 3STZC 2FUEA 5E1MA 4IYRA 2HUNA 1P0FA 3TW8B 5EJ2A 2ZT5A 4J9YB 3B13B 1VG8A 3KEGA 1JEQB 2Y3IA 4EPYA 4A26A 1Z4IA 1EFUA 1Q12A 2GMWA 3H1AA 4GG1A 3FWKA 2DZDA 7MDHA 2GPJA 2DCUA 5I48A 4FFMA 4UTVA 5FH9A 4EUNA 1MABB 2VAWA 3R3SA 3GW8A 2B0JA 1GGVA 1CZKA 3D6HA 5E1AC 1NZFA 5DYGA 5DW3A 3FOWA 4LYFA 4M8SA 3RUFA 4LHSA 2Q2WA 3GDHA 1PRYA 1Q2XA 4AP5A 5A1JA 3BWCA 1HEUA 1UBCA 3HL0A 2IYZA 1FP7A 1T9AA 4QQKA 3MOGA 4PC3A 2ZB3A 4QC2A 4DN6A 3D1JA 5ADVA 4HMQA 2YFQA 3NYQA 2WQ6A 5M04A 1EZJA 4KL8S 9ATCA 1USIA 2NZXA 1EUQA 4K0KB 3L4SO 1KI7A 2M6LA 3EQ7A 1RHMA 4LDPA 2C83A 3GLFB 3CFYA 1VQ7V 1CP2A 4YAUA 2F8TA 3OTHA 2B9VA 2DH5A 4OV6B 4MRAA 1UIMA 1RBYA 3MWJA 2JD2A 3A6JA 1KF0A 4D4HA 4DLWA 3SC6A 5K6TA 4RA9B 2DWEC 1VFNA 3MS4A 2EBWA 1UXHA 3AUXA 2DTDA 2VA8A 4OFZA 5CW2A 4AZVA 2B8WA 1SKMA 2GF2A 3LPAA 4S1OA 3TJMA 3D3KA 3MS2A 4CUJA 1MIHA 5BSMA 5DNWA 2FMFA 4UM5A 2FKAA 5B1BB 2GX6A 3R41A 1WQ4A 1HLDA 2PNFA 3BIXA 4R6WA 1PDWA 3PDUA 1VK3A 4U7TB 1RJ9B 3CBGA 3W6NA 3EPKA 4TUYF 3Q5DA 3CUYA 2O8EA 3BEDA 2C5HA 4BFUA 3K04A 1Z5NA 1J0BA 4AG6A 1Z4PX 1NUTA 3ZCPA 3EIUA 5FBZA 4R9VA 3OJFA 4X8AA 4OAQA 4UNPA 4LFBO 4LY3A 4WLNA 4RWUA 5AOBA 4DQLA 3P10A 5FL7G 1R0LA 1XBLA 2PZMA 4G2TA 1FRVA 3HADA 2XAQA 2WTBA 1GV0A 5AVTA 2DQ3A 3D3QA 5BXYA 4DVJA 1ZJJA 3F0TA 1YD7A 4ZT3A 4MAFA 4FNGA 4GM0A 2ZIVB 5DULA 1V71A 1BFKA 1QB7A 2ZDHA 3AJEA 1RYDA 3N76A 3T1TA 1FMJA 4A7PA 4P98A 4XLZA 4P5PA 3GLHE 4ALJA 1VL1A 1NONA 2IWRA 3KTAB 4W5JA 3HPLC 1FSPA 3KFLA 3W9SA 1Y4UA 3D2CA 4L5CA 5EZYF 3IKMB 4PANA 2FQXA 4PC7A 2RGBA 4PRZA 4B3CA 5B12A 2XE4A 3PC3A 4ZO4A 5CEFA 3AHCA 3AC0A 3NEPX 5L6LB 4UV9A 3L7DA 4C78A 1XX6A 4D9GA 1SXHA 1Y6GA 4TL8A 1XR3A 1E3JA 3Q8HA 3GR6A 2FWJA 3JR3A 2RHHA 1HPLA 4DW1A 3HXOA 4QBGB 5BV1A 3K4QA 4UVGA 3QXHA 1EQ2A 2RIRA 4IYHA 3NIFB 2EZUA 2YINC 4M1ZA 4H4DA 1CQZA 1FRQA 5HQJA 2C07A 2QZZA 2ZRCA 3W2GA 4ER7A 1P33A 1W47A 1U2QA 3I4LA 1O0SA 3GT3A 2XAHA 4ZYVA 3UQ8A 3AFOA 4M0DA 4LYAA 3M3DA 1VLLA 3F8TA 3GLIE 3RAPR 3F2IA 3DLCA 4RS4A 3CLTD 1FZQA 1ZICA 1I4EB 2P41A 4PHZA 1TZJA 3D4BA 1T0AA 3FIJA 4ZJUA 5TPWB 2PBRA 1KARA 4FLWA 1EGQA 1R0YA 4WJKB 4Y9SA 3P9KA 1E6LA 4EJ6A 3ASZA 1DI0A 2EEPA 4IDDA 1U7UA 4QSMA 2GCOB 1A7JA 2BOVA 2PIAA 3T5PA 4EF4A 1O94C 2OPBA 1UM9A 3KKPA 1XAGA 5FUBA 1ZTEA 4JI2O 1UDRA 4KQXA 2FR0A 4ZALA 4MS1B 3KKEA 1EBUA 3RC1A 3A04A 1PFUA 3R3VA 3AY0A 5HY1A 1U96A 4KIWA 4K35A 5JPIA 4CE6A 1QHXA 5JQWA 3OMXA 3GRKA 3CVUA 5P21A 1G4YB 4X9QA 3FYEB 4A2WA 2REQA 3H1JH 1UCFA 2Z56A 3X43A 4O33A 2FR8A 5MHTA 5JAQA 2QR4A 2AEJA 1XHZA 4V03A 4LHVA 3AR9A 2AR7A 2R8ZA 3CSXA 1QZ3A 1TC2A 5A5EA 1P8AA 3DHEA 3L1KA 3FZYA 4ITVA 4CKEB 2HF8A 1H5UA 3I42A 3T95A 2JEUA 1V47A 3N05A 1VZ3A 4Q02A 5I7WA 2RARA 2D4HA 1FFHA 4G23A 5TARA 1OROA 3L0PA 1I10A 3RTAA 3LFHA 3L7IA 1K73W 1SXJB 2A4MA 1YQNA 3TSZA 3AL3A 3C3SA 3IDOA 4MWZA 4CDNA 4JGGA 2X8AA 3QBEA 4X6XA 1C3XA 1FS5A 3LYHA 5LBIA 2CLFB 3FMGA 1XMQO 1C3JA 2AH5A 4HAOA 3CPWU 4GICA 3E0QA 3UG6A 1M1NB 4IUYA 1AQYA 4JYAB 4YIOA 1DU4A 3RW9A 1S9DA 5EJFA 3C8MA 1ST3A 2UZ3A 5AW9A 5TLSA 3IBTA 5HP4A 4PR3A 3V4FA 2GEUA 3S55A 3H18A 1WULS 3IKLA 4J6FA 4BAZA 4U2GA 4AULA 2R87A 1X1AA 1LCIA 4HLCA 3IMCA 4U7PB 5DCLA 4CCYA 1XT6A 2VQFB 3I58A 1D04A 4JOSA 4LQLA 1YRQA 1I9CA 2PT9A 3NDRA 3A6ZA 3H9CA 4BFTA 4LNAA 1ZWZA 2XIJA 1S0UA 4DUGD 5L3RA 4ROSA 5ERXA 2OAGA 1H6BA 2YOFA 1W40A 3BMNA 2ZIEA 1XNRB 4J9UE 1AJEA 1KQOA 1X14A 4BNKA 4RETA 4YP7A 2ZRBA 3FFTA 3H1GA 3HI4A 1Q15A 1H2MA 2HR1A 4KO1S 1V1MB 2IYTA 5DH9A 3IELA 4PDVA 2F1RA 5MFZA 1IMOA 5NULA 2ZI3A 3PE3A 8ATCA 2J9YB 2OP1A 4IFIA 3DE7X 4CMKA 1PUJA 3KZKA 2NNLD 2R6GA 3PVCA 2WF9A 3TGWA 2A88A 1NVUQ 2J7PD 1QK4A 3ZH9B 4PDMA 4G0UA 1PK7A 2XOKD 4Y2UA 4IDHA 4R7GA 1YBHA 1J9EA 4TV8A 1T1GA 4KR2A 1KSJA 4NOKA 4HWPA 4HQRA 2DKFA 5TJHA 3PKZA 3MWLA 2DFNA 4H31A 3GJTA 3EFHA 5IAOA 4GVLA 3U17A 2XPCA 5F64A 3I64A 3ABIA 3O90A 4KR9A 1TF5A 2QDOA 1H1DA 1LTHR 1R1DA 2H17A 3HFGA 1E3SA 4WKBA 3U80A 1K68A 8OHMA 2G9QA 4Z54A 1YFKA 4JL5A 1EDDA 1XF9A 3MD9A 5AXDA 4BIZA 3CQ9A 1S5LZ 4OQPA 4D7TA 3WX0A 1AO0A 3CLUC 2C03A 3RU9A 2AXTZ 2QT1A 4IH1A 1ZNWA 2HF7A 2J3LA 3I4FA 4G84A 4WZAE 3FETA 5IT5A 1S3IA 1Q7GA 4CS2A 3DVSX 4UUOA 1B41A 3O74A 1SCJA 2QRUA 4NNOA 3BGWA 2IS4A 4C4ZA 3WU2Z 3CYFA 5CX4A 3OE4A 2PGDA 2B4KA 1IZ7A 3JS5A 4HDQB 1DBPA 4HFNA 5ISMA 4ZEWA 1B2RA 1JX9A 2HPZA 2HUPA 1S7GA 4X0EA 1XHOA 2IBSA 2C57A 2PJZA 2PX4A 2BPOA 2JDID 4NULA 3AHDA 4II2A 1R9MA 1VMIA 2I22A 1AUOA 5JRJA 4C0QC 3VR2D 1QONA 3RVLA 3RYTC 4BS9A 5EP3A 2Q5CA 2QENA 4YIPA 1QE0A 2LP4Y 3RVBA 2RK4A 4EKWA 4NRDA 4EDFA 3ZGOA 1QR6A 4YT4A 3KQWA 1U8ZA 2QEQA 5FUXA 4MVJM 1VGVA 4BT5A 3EEQA 4FE7A 2QJOA 1U2EA 3VSEA 1J33A 1K7CA 1L5FA 1EE2A 5DRTA 4FMDB 5FBRB 4HS9A 3IMPA 4BAYA 3G6KA 3Q6MA 3KQNA 3TD2A 4JKIA 1RLJA 3CG0A 2V7QA 5KHGA 1H6DA 4XTRA 4MW9A 1FF9A 3EXHA 1L1EA 3O4RA 2Q9BA 5BV7A 2PMBA 2VAPA 1KMQA 4S35A 4CGYA 3EC2A 1XEFA 3KKLA 2BEUB 1UWVA 5CW1A 4ZVSA 1E94E 5ICFA 1SCNE 4AQDA 2YVAA 2ODBA 3Q2KA 3RVJA 1R0WA 4NYMR 1DAOA 3D1LA 2X6QA 4D6TH 4HSEA 2MDTA 2FTKA 2PEZA 3GMDA 5DV9A 1N77A 7GPBA 1PNVA 2VYVA 3VZDA 4LF6O 1GAWA 1ZGHA 3D7RA 4CL3A 1RWOA 2VUUA 1Y1PA 3I2JA 4QQNA 4D98A 1IVYA 1E2FA 2OZVA 3BMCB 5CFQA 2C97A 4OI4A 3OU6A 2O20A 2P6MA 3KPWA 4C4TA 4HPJB 3WWDA 1E3QA 5A1TA 4PFQA 5KWJA 2J9GA 3CR7A 1N0NA 2EJTA 1NN0A 2I8LA 3WLSA 3HE3A 1GQYA 3MJTA 1P7GA 1IHUA 4MNTA 2HJDA 4I5SA 4YDQA 4LZZA 4AZ3B 3T54A 4OQFA 1VIDA 3BA1A 1YRLA 2DOSA 4O08A 2AUNA 5MFPA 4RK6A 1BWSA 4TM8A 3WDSA 3H1BA 2GZRA 2HQOA 1HYQA 3N07A 4R9NA 2O07A 3ZIAG 1KERA 5ERYA 5EMLA 4QPNA 1VQ8V 1Y48E 1R5BA 1DJLA 4L7QA 3IESA 1XC7A 4JD5A 3JPWA 3K9LA 4RQUA 5J63A 1PGPA 2O2HA 2IZOA 3EW7A 1S1CA 4P2ZA 1DGQA 1RI5A 2ZQMA 2JLXA 4MA0A 3J81k 3ZYZA 1BGYH 1B23P 2PSSA 4IGAA 1YJNF 3LGXA 3OUTA 2ODTX 4KUEA 4L9AA 4WECA 3E9QA 1D0IA 3MINB 4PG7A 3TBKA 1Z33A 3U5ZB 2VNAA 2W5UA 1BCSB 3VGJA 2R6JA 3PHIA 4ZVVA 2FWAA 3MTDA 3TDMA 1G2OA 2LGJA 2O6LA 1NJFA 1BEUB 4ZOBA 4HFJA 3AGKA 3C8LA 1P1BA 2W6ID 1WNSA 3QFFA 4DV4B 1KJWA 3LPCA 2Q4TA 1QRUA 1SHJA 5TNXA 4N1AA 3WL5A 4LSZA 4CKCA 4KODA 1QH8A 5B5EZ 1UMCB 1ZHHA 2O0LA 3A1NA 1JKIA 1R4MB 1ULHA 4C30A 3FF1A 2G9NA 3N2YA 2HD4A 1JIIA 1U3VA 4Y2HA 4G01B 3D54A 3LQKA 4BLRA 4U7WA 2FFBA 4BFSA 4KN6A 4H16A 3VVCA 3U0ZA 3ZS8C 1KMNA 5B6JA 2ZVPX 3NH9A 2QRGA 1KZ4A 2V45A 5H0IA 4MCIA 5FD8A 1VDMA 1WHSA 1ZI6A 1QK5A 1UKAA 4ZVTA 1HDYA 1IIRA 3T5TA 3JQ8B 3A58B 3UCXA 5ALRA 4MW2A 3IQFA 2IAFA 3NYWA 2QQGA 2GARA 1O95A 3HDTA 4II3A 4PZYA 3TFQA 2HBRA 4NZ9A 5KNLA 4MUXA 5KDLA 2J7KA 2YASA 4NDNE 4A0GA 2JI7A 3O5AA 1O6CA 3SS7X 3OQBA 1K97A 3C74A 3PUYA 3ISJA 4B34A 4LZJA 4CQLA 3SSMA 1FTWA 3TS1A 1P0QA 2ZIUB 1WA8B 4NBSA 3SX4A 4BVFA 2Y9PB 2QE7A 2X4IA 2CW5A 3CZPA 1M2OA 3OUUA 2O2CA 1D3AA 2O6HA 1RD4A 10MHA 3CLTC 3BHIA 3C6QA 1LLUA 1F1JA 2GCEA 4KACA 5F5LA 3DW1X 1SZCA 1VBKA 2A86A 1RXEA 1P3DA 2PJDA 2HP0B 5B66Z 3C5CA 5EE0A 3RFUA 4JA0A 2BY4A 2AEMA 5FWXB 3TECE 1AKWA 4J7ZA 2WHEA 3AIMA 4FYHA 3L6OO 4QEDA 1YCHA 4YJ2F 3M4SA 1UT5A 2PM8A 3S99A 1ZHFA 5JAPA 2QPAA 1PD3A 3D6AA 3GN1A 5FI1B 2QRNA 1AK2A 1P17A 4AP6A 2QDXA 3G71F 1DQPA 3H3XA 4U2CA 2GN9A 3L7BA 2EWMA 5DLYA 3N2EA 2GCNA 4FQ5A 1W46A 2OXEA 3PLNA 1GNVA 1QR9A 5EUBA 4IIUA 3EZNA 2AE1A 4I4LA 2OGZA 3OPQA 3VJKA 5KSZA 2I2XB 2DSTA 3P32A 4PTLA 3ZEIA 3AP1A 4UHDA 4M2LA 3CCVF 1XLUA 1S9HA 5HCNA 2BE9A 5GM1A 3ZKAA 2W93A 3AB8A 1URPA 3NPMA 3O8QB 1ZJ6A 1TVKB 5ALEA 1Z6XA 1NVGA 3AK3A 1YB7A 3KQKA 3MD0A 4HB2A 2QUKA 5ESWA 4QSHA 3O94A 4HB3A 2A0FA 5AOAA 4ZP1A 2EX0A 1PYDA 4TX1A 2XCSB 5B6IA 1LQ2A 2QA5A 5TJ9A 4XE5A 1P7CA 4MJXA 1ZFNA 3UAGA 2TRSB 2C9CA 3EZ6A 1GZ7A 2IYRA 3H65A 4WCFC 1L4BA 3LSUA 4BV2A 2EX1A 4BVJA 4JBXA 2GN8A 3PUJA 1XPOA 4BNJA 5F4BA 3B6MA 4DR6B 4JB3A 1B6RA 2HRUA 2VWJA 1LS1A 4FJ1A 1H48A 3U11A 1POXA 5B2ZA 3VPGA 4BIIA 4ZJZA 1F6DA 2R9VA 1CY8A 2CMFA 2SBTA 3ZCCA 4B3BA 3UMGA 1FUIA 4JLSA 3BDVA 1DC5A 4Q03A 4V02A 1JSXA 2GETA 4ZDWA 3LWQC 4TWBA 1ECJA 5BT9A 1Y76A 3AOEA 3F71A 2WAMA 5CB4F 2B1RA 1OB5A 2PGLA 3EJ6A 4BEBA 2BFNA 4XEHA 1FVXA 3TZKA 2QQEA 4MVSA 3LKBA 4JQSA 1PX2A 4ITUA 5JJNB 1IN6A 3W3AD 3CGWA 2JL1A 1YGPA 2XVYA 3P4UA 2IHTA 2JFUA 2PL5A 1E9VA 2XOXA 9LDTA 5GIPC 3K9SA 4Y6PA 2OTMA 3BYZA 2BBSA 5JVDB 4ZGBA 4P7FA 1YZNA 1P9NA 1J5EO 5B55A 3WWYA 1V7PC 1GUBA 2W70A 3I0ZA 3C5VA 1WLSA 5C1IA 4BBAA 3JZFA 4NTZA 1E4VA 4ZZ0A 4FJ0A 4G5XA 4POAA 821PA 4OP1A 3Q6IA 4D8UA 1FNJA 1Q19A 2QGZA 2PKYX 3OMIB 4Q9AA 1CUSA 4TYWA 1G3RA 3DCYA 1M6VB 1U5BB 2AL7A 1NQVA 3U3MA 1JRLA 5KAMA 4R2KA 4TT3D 2FCAA 1Z35A 2P06A 4PHHA 3ANYB 2H9IA 4UNIA 3WV4A 3AR4A 1NVKA 5KCZA 5HF6A 3TRKA 221PA 2H31A 4ZJYA 3WMRA 1XWFA 1JLMA 2E74B 2XKKA 3IE0A 1K6MA 3JATA 4PX5A 1NDUA 2ZRGA 2OLKA 3I52A 3SPJA 1X0XA 2FVXA 4LC0A 2PX2A 3W7BA 4XDZA 1DZIA 2UKDA 3SF8A 2ZBGA 4DW8A 4D9HA 3NM6B 4X3CA 3W6UA 1UI9A 5FI0B 4KAAA 2ZIGA 1G5QA 4EHHA 1KTIA 3C90A 1FLVA 2BUCA 1Y80A 4IEFB 1XVIA 1WUHS 5EJ9A 5AK5A 5JDCA 2EKZA 3OEYA 3OW2U 3EULA 3HDYA 4I4TB 3NBQA 1K8XB 5L3QA 2HS3A 4WBNA 2X58A 3I6MA 1Q3KA 1HNWO 1H2FA 3IQWA 3C5WP 4YAEA 2XNJA 5IVHA 2JAQA 2GM3A 3HRIA 1IUNA 3FOZA 3H87A 3U7QA 5IEBA 1U94A 2AZXA 1KP3A 3AV3A 4DQXA 3KYJB 2ZJ8A 4RTOA 2C88A 4DSUA 1Y1SA 1E7WA 1AB5A 2JA2A 1X52A 5EUMA 2A14A 3ENWA 3QELB 3VBCA 4RUEA 3STYA 4Y1RA 4XIFA 1FU7A 5I7OA 1CUHA 3N8GA 1LLCA 4QUIA 2BM1A 3CPQA 4PQFA 4G5GA 5JS1A 4DGSA 4OPHA 2YR0A 3KUKA 3F5MA 2ZTUA 5JV5A 4YGYA 2V7EA 2ZWAA 1FDRA 4INAA 2J1LA 1VBNA 1Z6YA 2V0NA 4LDAA 5IZCA 3CWZA 4CUKA 2I03A 2NV0A 1WBJB 1PFGA 3BF8A 3K9GA 4PSUA 3Q7PA 1PLLA 1E18A 2QTGA 2MMCA 1UMKA 2WYOA 1XVTA 3MCAA 2OYSA 4IEIA 4W99A 4R54A 2HV9A 3I28A 3UJ8A 5KDDA 3F7NA 4L0QA 4AYWA 4M54A 4JMLA 4WK2B 4XUDA 4JB8A 1ZYUA 3H7IA 4W6ZA 1BTOA 1U1CA 1IY9A 4GKVA 3FUWA 4YJHB 2IF0A 2BBTA 4R01A 4AAYA 2Z2XA 1XZCA 1RCFA 4DCCA 1WHTA 2IHNA 1RQPA 3VSBA 3UYKA 4OF4A 1J4AA 4CGZA 4V0RA 2WUFA 5EFZA 4YRGA 2QP9X 4YAJA 4RXMA 5ALYA 2I7VA 4V0MA 4LOHA 2P3LA 3R5HA 4LC9A 3ZWKA 2AOUB 4LAFA 2L35A 2DN9A 2QQFA 4MLDA 3NBUA 5E1DA 4RL6A 5DE3A 5FI3A 2B2XA 2JS7A 1NR1A 2Q8VA 4KEAA 4I50B 1LD3A 2P2ZA 1G55A 1FLNA 3PEEA 3JYNA 1H2XA 2ALJA 1KK3A 2OM6A 3PPWA 4BLVA 3GNTA 1X7YB 3ZXIA 1RAAA 1Y5RA 4HVLA 1HV8A 1ORTA 2NZ2A 1YRWA 2K6GA 1WM1A 1XKTA 5D00A 1UANA 4PWYA 1DK1A 1BXRA 1GZ5A 5JCJD 3C3DA 3ID6C 5DGXA 3BZBA 1CQIA 1G21A 3KPUA 5G4VC 1YB5A 1YB6A 1Q16A 4PGAA 4WFQA 1JQBA 4TZZA 3AEQA 4FYVA 3UKDA 3E9YA 3VU9A 4L8FA 2HRDA 4Z7OB 3V1TC 2C9YA 1XU9A 2AHZA 4TKUA 1L5MA 4BNVA 1NBMA 4B7XA 3SQDA 2BYTA 3RSGA 3CT6A 2B34A 3CRMA 4JBYA 2ZYAA 4FD2A 1OB2A 1DADA 4JLMA 1AK1A 3G5LA 1KD1H 3T7TA 4DCNA 4YCNA 5JAZA 3F0DA 3P9SA 4JQCA 4C7OB 2PGGA 4B4OA 1KK2A 3Q8MA 4CS3A 4RPKA 4RZSA 2W22A 2Q69A 2ZROA 2IVZA 5B2EA 4I8XA 4ZYLA 2IPNA 2EFHB 3L8EA 1KA9H 2UVPB 2HF9A 1XMXA 1K7XB 5IT0A 2J9XB 3G0GA 1PBNA 3Q98A 4WCFB 1F06A 1Q1BA 1XG5A 3Q4HB 3E23A 1CR1A 2WAOA 2J6BA 4Y67A 1IONA 3Q9SA 4IDAA 1FMFA 1JJOA 5F7XA 1Z4JA 2AI2A 1Q82W 2BTUA 5DN9A 4F46A 1NE7A 3PNOA 1WB7A 4F5DA 2QTBA 1NE2A 3JYHA 3RWMB 2W0SA 1TZCA 4M0FA 4K05A 5G0VA 4MW1A 5K3AA 3VC3A 2AC7A 2UXDO 4E4EA 3K0KA 5EJ7A 1JHRA 4EHJA 4F3NA 3IVXA 1IQRA 4FOOA 3PFHA 3LNTA 3RC8A 3NHLA 3A4TA 4DCUA 1BX0A 1IJKA 1HEYA 1N34O 4G4ZA 2YQ4A 3R74A 1YVRA 1QYXA 2FHPA 2Y68A 2C20A 5FUMA 2VYQA 1J2EA 1NLUA 2WUGA 4I2VA 5JROA 2PZLA 3ZHQA 1KDTA 3L9XA 3FD8A 3UEOA 5LOVA 3LDDA 3ZY4A 1ZH4A 3RVSA 2FK7A 1MXFA 1QFZA 3HNRA 2PTMA 1KI8A 2OXTA 4YXFA 2REOA 3N75A 4HG2A 1BW9A 3UQYS 3VTKA 4YV2A 1VMAA 5EIEA 3V7YA 1E1RG 3QYJA 4MWEA 3IEXA 3WL7A 4N3GA 4ZYTA 2QUBA 4IICA 3GROA 4BTVA 2GQ0A 4TLBA 5J2UB 2JS5A 1VQKV 1V8BA 2QGNA 1WPQA 1CCWA 2VTDA 1BXZA 4W1QA 3EDRA 4YLGA 2ASEA 3ND6A 3SNKA 4KR3A 1VF6A 3AVOA 4MP8A 4TKZA 3TKAA 4J7XA 2H1LA 4U8GA 4RVOA 1A8PA 5L9AA 3K09C 1G6Q1 3D7LA 3H75A 2R47A 2FEPA 3ZZNA 3HWSA 3IVCA 1WLYA 3EAGA 2YX1A 2XAJA 1QUFA 2OHJA 1ODTC 2PR2A 1O94D 1EMDA 3DXRA 1S4QA 4AILC 2N0SA 4J90A 3ITDA 5TQ0B 5DCUA 1NM5A 1TFRA 4GKBA 1JEYB 3CE6A 3TZQA 4RSGA 4B7EA 4H1UA 2X9QA 1D4AA 3E7DA 1I4TD 4ICGA 4GYCB 4YONB 1QANA 4I4CA 2CDCA 4OQYA 1IHDA 1SUWA 6CHYA 5L3SA 1EDZA 4C9BA 1IOLA 4M86A 4G09A 1MNQA 1WB5A 4RQFA 4OPMA 4U5XA 3E3NA 4UEJA 1V5GA 3OEWA 4MQMA 2D1QA 1YIJV 4WZAB 1JE1A 4JY7A 1Q6ZA 4QTTB 1L5NA 3L7QA 3V2HA 2YV5A 1Q86H 2VLIA 4UMEA 4AKHA 1R3KC 3FBWA 4KN8A 4HWGA 3COPA 4CG1A 1HO3A 4ARIA 3DFIA 4TLLB 1L7QA 4BKMA 4LGVA 3TCUA 5BQ5A 1A69A 1OJLA 2NZVG 4WA7A 3U1BA 5LXTA 3S2ZA 5G40A 3BFJA 3L1IA 1JJ2F 2LW1A 3SJCC 1AT1A 4BO4A 2BFBB 1QO9A 2VHYA 2BSXA 4TQAA 4PHFA 3IEWA 2CEAA 4QGSA 5JO9A 5D85A 1T3TA 3DCJA 2VPQA 1XTUA 4P4UA 8AT1A 2VSXA 1RLGA 1VPVA 4DOMA 1A4IA 1OW3B 2WIJA 1X1SA 4DLZA 1VKJA 5FULA 4AUEA 3GWKC 2A5GA 4EO9A 1QH0A 1JNXX 1N2XA 3MWGA 3DR5A 1H8HA 4P4GA 4WFHA 2ROQA 4BNHA 4MUAA 3RSZA 3BH0A 1E9EA 2I4IA 3FPLA 2MOKA 4UCUA 3K05A 4AYTA 3M33A 3NBYC 4QUBA 4JASA 1R66A 4BGDA 2I6DA 3PNBA 2FPIA 1LTQA 1EESA 1F0PA 3CCRF 4GPAA 1VQ6V 2D5BA 3TDKA 2RKBA 3PC2A 3VHQA 4QOJA 3ESBA 3OETA 5CT4A 2HCJB 1OGIA 1CV2A 4B8WA 4CIBA 3DD1A 4WFFA 2DQ4A 1Z12A 4AKTA 4B62A 2ZOVA 1HQKA 1K8QA 5J2TA 3MRVA 1Z39A 2AJBA 4PNPA 3R66A 4ZK7A 2YH2A 2NP6A 3L05A 4ZANA 5JD4A 3O4HA 5WRFA 3HWUA 1KEZA 1IBCA 2H51A 1AXEA 1YTLA 4NKRA 1KPHA 4LHWA 2OZLA 3R7SA 4AX4A 1XCMA 3GFQA 3GEGA 1W88A 1IOZA 4TWJA 5L51A 5B1DA 3CZ9A 2H63A 3E18A 5AKIA 3I9FA 5DTQA 3VNBA 4HDNB 2Z6AA 3CO0S 2JG3A 2WR8A 1P1JA 4WADA 3X1YA 1AMUA 5GTDA 3NK7A 1UUFA 2JBHA 1J5XA 4PPYA 4NG4A 3AEUA 4OUDA 1GUYA 2XVXA 4JCCA 3PPVA 3MWYW 3HHEA 2Z09A 2FRDA 2Y1XA 3WK4A 5AW3A 3OMAB 4JFAA 1JJ7A 2BD0A 4EZEA 1VJ0A 5DHQA 3ZZ1A 4DC0A 2QN6A 4HX9A 5AICA 2Y6UA 2ZFUA 2R66A 4CMGA 4P5EA 2W71A 4ACBA 3Q3EA 4EAAA 2H7XA 2O52A 4K6CA 3WWEA 2VATA 1PAUA 1QP8A 2PWYA 1WIWA 5DTMA 3B60A 4YCLA 1STOA 4QPKA 3DLPX 2IDZA 2OCAA 4EG7A 1LWOA 1EM6A 4HQ6A 1R1MA 2VI5A 3SXUB 1JQAA 3WAKA 4O4LA 3TLJA 2J07A 3K8YA 4J1QA 3DEJA 4BCDA 4J7UA 3T9CA 2LIVA 2JBWA 5C4MA 3OT1B 1SKAA 3KKOA 1B76A 3GI1A 2VPZA 4L6AA 1SRYA 1W35A 2WFZA 3ETDA 1HT0A 3UYLA 4QTZA 2C61A 4BEWA 5AK4A 1LS6A 2DBQA 5F2OA 3SCZA 1FNKA 2YRFA 3ICPA 1DUVG 3M5PA 4FBGA 3FSGD 2NXWA 4D80A 1E3MA 4C4WC 5D01A 5JU6A 2G1PA 4KPYA 4E6EA 3DPUA 5CK4A 3LUHA 5EKTA 3QTCA 5KQSA 1P18A 4R8MA 2D62A 3FNBA 1OFGA 4QO8A 1QG0A 2V7VA 4DDWA 2KB0A 1TECE 1RADA 2H65A 4MUKA 1MVLA 3Q7EA 2H8KA 4X9XA 4CN9A 3C6MA 1YE3A 4W5OA 2YWHA 5DN6G 5F35A 4LF4O 1MOFA 2VQ6A 2GESA 3S6JA 4DCPA 2QTMA 3ADDA 2YHUA 3MERA 2D06A 4RV5A 3JQRA 3RANA 4JC0A 2WICA 3QVTA 1WN7A 1Z4KA 1C41A 5BWNA 1Z2CA 4I9WA 3M6VA 3BILA 2H5IA 4CC6A 1DCTA 2X0FA 1LPNA 3OAAD 3MGGA 1NX6A 1U2DA 5KAFZ 4HCJA 2A79B 4C0WA 3AB3A 7ADHA 3O2JA 3CNLA 4LV8B 3QVGA 3IPYA 4MR7B 1RYFA 4YUXA 3NONA 1C9EA 3BERA 4CHTA 4URFA 5LHHA 3O73A 1QRTA 4ZK6A 3DEYX 1R12A 5AUOB 1F6BA 5GJCA 1BL8A 1OXMA 3SQWA 4LF5B 4DJFC 2J67A 3BQ9A 3AF6A 3SHFA 2A9VA 2AJLI 3D4IA 2IYAA 3HCDA 1FP2A 5HF5A 5AOCA 2WD8A 2E87A 2VP0A 1K3FA 2HJWA 2P79A 2OZKA 1VE6A 3OZFA 1M1XB 1C7EA 4RXTA 5FHRA 2HL6A 1M3SA 1N6OA 3AJ9A 3I5AA 1XA3A 2MINB 4Y2PA 4BKRA 1AKQA 3K1JA 3P94A 3HXMA 5REQA 3SSNA 3NHWA 2HU2A 3RVPA 3K57A 4F3CA 3W0LB 3IIKA 2VPWA 1RQRA 4JKOA 2QKYA 2RE8A 4K88A 4ZICA 1NVEA 2VJPA 1F8GA 1Y9DA 1UWLA 2ZAMA 1IBLB 3U4IA 4OHZA 2VAVA 1QVGF 4GYWA 5AVXA 1VJ5A 2B94A 3RK4A 5A4MS 2YHSA 3V6MA 4C1NA 4E07A 1I51A 2UVQA 3LOQA 3ZDRA 1VPTA 2OCLA 5I4BA 2IUTA 3ESYA 3MIIA 1QNMA 5ANRB 2PKCA 1CDZA 2JJQA 2QN2A 4MV0A 3TYXA 3ISVA 4PNEA 4GYJA 1TLTA 4Q4AB 3FR7A 1M2GA 3KK0A 4G37A 1Z6TA 2X7XA 2WILA 2HC9A 3KD3A 1E1QA 3RYHA 2KE5A 5AK3A 1DFGA 1Q11A 3AT1A 4CF6A 1V11B 4UXIA 4PZCA 4B3IA 2EIHA 3K8OE 3ZWXA 2GBPA 3EXG1 4MI6A 3OG9A 3MTBA 3DL0A 1SY7A 2Q3BA 1XDWA 1F2UB 4D5GA 3TTVA 4CH5A 4NE9A 1THZA 4LECA 1EN5A 4EG5A 1VH8A 4H6WA 1EDOA 5E6SB 3ZKWB 4C08A 2WA3A 3F1LA 1NU1H 1OZAA 3VH2A 3D8RA 3WHPA 1YC5A 4JP3A 2OECA 4NUTA 3Q1KA 1LW7A 3TLMA 3CZMA 4S05A 3CCUV 3VTZA 1B73A 1F1BA 1Q1EA 2DMRA 5IH7A 4DCMA 2OCXA 1XD9A 3EODA 3EPJA 1JR4A 2Z01A 4XIYA 2NZ8A 1LFAA 2IHKA 1FNDA 3NIWA 5E7JA 4OMCA 3K58A 4TWKA 1V45E 2RJ3A 3DQPA 4DUYO 1SA0A 4J7KA 4U7FA 4KITB 3UBTA 1QKIA 2FSIA 3W6ZA 3P71T 4MVRA 3VSAA 4Y9TA 1VCIA 1DINA 4FGKA 1O5TA 3UUFA 2H1HA 3U9TA 4J4HA 5KQPA 1AKNA 3PIDA 4E4RA 2D2EA 3EF3A 3GFTA 5A0FA 2ZBPA 1P7VA 2HEPA 1LI5A 2YI8A 1I2DA 2IW3A 2QLTA 2VWPA 5AG2A 2IYQA 4FTWA 3WK5A 1SVMA 4LOKA 4NXMB 4K7JA 2QSZA 2VDUE 4DCSA 4JODA 3EXG2 5LSAA 4GX2A 4EP1A 1N32O 4HGYA 2MYPA 1TQ4A 3W7TA 4UM7A 5EHIA 3JAMM 4QHSA 1MJGA 1NA5A 2DWCA 3A9TA 1U6KA 1M8JA 2Q28A 3FCAA 4DCTA 1A9SA 2CE4A 1FYEA 2E5WA 1EFPA 3HDHA 4FGUA 1Z0DA 3PPYA 4Q1AA 1Y3DE 1Z3IX 2EFGA 4WN9A 1G42A 2EQAA 3A6KA 4OH7A 4P7JA 3VV2A 4B82A 4GHWA 4PIMA 1RRCA 2QQ5A 3ZMVA 4Q82A 5C5EA 1OBCA 4ZO9A 4P80A 3K5LA 1YHQV 5FO0A 1QAOA 1L0LH 4MVJG 1GNRA 3SBEA 2QN9A 3GBVA 3IS3A 4Z49A 4UCRA 2P69A 3PIIA 3HDJA 1EFDN 3CG6A 3PA6A 1Q1NA 2R1VA 2CY0A 5EHZA 2L6LA 2P6RA 1BE1A 5HTOA 2R79A 3DW3X 4L8GA 4UCXA 2XMQA 1Q0TA 5HY2A 4PYRA 4MO2A 1KP2A 2ET6A 3TIFA 3NAGA 3DLBA 1IZ9A 3P4XA 5BUQA 3ZRWA 3V2UA 3P2JA 1TK3A 3HZZA 1Y74A 5D3QA 3S3TA 1YI0A 2INGX 3BFRA 1I94O 4CIVA 5KWIA 2LWIA 3E83A 3TLKA 4IP0A 3WFJA 5HFAA 1ZXBA 2YEVA 4KQKA 3U1TA 4CR6A 3PHLA 3Q9LA 3W1VA 4JN6B 1KOFA 3W5VA 1RPJA 4KXVA 3N5KA 5CHYA 4MGHA 4DILA 2GTIA 2FSGA 4IJUA 2H2WA 2Z6VA 3ECAA 3OOWA 4BGEA 2Z2IA 1YFZA 3MAGA 4J3JA 4B75A 4OQQA 1FXHA 3NWJA 4N3BA 1P3JA 3E9NA 4D42A 4DMFA 3N2NA 1QNLA 2XKJE 1EK6A 3ZN0A 1XIVA 2OD2A 2UZ0A 4OBXA 4JI7B 3T0GA 5CCBA 4QAJA 5JLAA 2FN9A 3CVXA 4G4GA 4HWRA 3MGKA 2ZUUA 2HB6A 4MDYA 3DVRX 3ZRSA 1HLFA 3C43A 3H2BA 4H35A 3ZCRA 5AI6A 4LJLA 4RTRA 3WXMB 5IN4A 4ECEA 3RC2A 1XELA 3K73O 2HKOA 4YJ3F 2ZJ4A 2JFPA 1YR3A 3A31A 4FKBA 3ESAA 4WBSA 5EIFA 5C18A 1GO3F 3KSUA 2ZB8A 4JJFA 3ORSA 4EM6A 4JQOA 1JPUA 2FEAA 1NDQA 1AZTA 3IOYA 5TC4A 5G1OA 4RF3A 4FZRA 2WKPA 2QXTA 1POWA 1KH1A 4G36A 2P0YA 1CUBA 2JB9A 4RK1A 1IY0A 3FD6A 1PJSA 3WBJA 2FWBA 3KEFA 5BWMA 1I0ZA 4JAVC 1WS6A 2PZJA 4DFDA 1A9XB 2Q8PA 4UHFA 3S2YA 4XOIA 1N36B 4D0SA 4I9QA 2N75A 4Q4HB 3G0BA 1WMSA 3K96A 5J5CA 5EB0A 3GEHA 2Q3HA 4ED9A 4OX9B 3E8HA 3DVAA 1JG2A 2ON6A 2NU7A 3ACCA 1Y8RB 1QGUB 4CEJB 2WLMA 3CRQA 3D3JA 4KYTA 2WNIA 1Y34E 5H3HA 3OTOB 1Q1ZA 4BQRA 1VLJA 1NI4A 1V1RB 1GZSA 4FN4A 3CPJB 1TTPB 4ZYYA 1C0LA 3EMBA 3P0RA 2ZWVA 2P2NA 3LZ6A 4EEKA 3AX6A 3KSRA 1TM2A 3JYPA 1XGKA 4MP6A 1RVV1 4KRFA 2DJ5A 1FYXA 4Q12A 1M6HA 3BGOS 3OEEG 3G6EV 3P9RA 4UUJC 2WYVA 4Z0TA 3KTDA 1UKVY 4IXDA 3HR4A 4HNAA 1OT3A 3AM5A 3VH3A 3H9VA 1EVKA 3R40A 4XLTA 1ZOPA 1PJQA 5CT9A 3KXPA 4RKQA 4OQXA 2JVJA 2A06H 4OCZA 4Y7DA 1BOFA 2D74A 1T4CA 3EIXA 1GGNA 4BLOA 1VFPA 2P6JA 1BRMA 2QZPA 3KHTA 1VQ4V 2JK0A 4ZOLB 3TW0A 4JFRA 4M9ZA 1CBUA 4TM7A 1S89A 3COSA 2FSFA 3L6BA 4PYMA 4O4HA 3NDIA 3CZCA 1QO0A 4OYYA 1I3LA 1G9SA 4WRRA 2EKBA 3LHDA 1SAYA 1ML3A 4LIPD 4RHYA 3UFXB 1G19A 3CEAA 4NEQA 1MT0A 4HAVA 4ZXFA 3GRCA 1VLHA 3QHDA 2IS2A 2QNIA 4FYJA 3WO1A 1Z5UA 1R4AA 3V7NA 3CVJA 1DHTA 3AB7A 3O9MA 1HNXB 1KKLA 1DBSA 3LP6A 1VRCA 4FZVA 1B26A 2GFQA 1SK9A 2ZE7A 3WBBA 4YUWA 2VUHB 3RVYA 2CW4A 4FLTA 2R85A 4JYPA 1N5LA 2BMEA 4WCDA 1F23A 2XVAA 3CRCA 3EHDA 1DX4A 4MOWA 3E3MA 4NB5A 2WLNA 4AROA 1C0PA 4D4JA 4LPSA 1KMMA 3CNEA 2ACWA 3HV2A 1KP9A 4WY5A 4II7A 1JG7A 4OGWA 2YXZA 4YA6A 3SZ3A 2I2FA 3OQIB 5IJ0A 5C8YF 3R8CA 3FKQA 2J5RA 1YAHA 2VK8A 5LZ4A 2DLDA 1Q7TA 5HVNA 1ZL8A 1ZMBA 2G1JA 1JLHA 3KLOA 1P77A 4B3GA 2G07A 5KNBD 3KT0A 4B7CA 2ZD9A 2ZTSA 1B6GA 5H59A 3BDIA 3EIWA 3I2YX 4GQIA 3S1AB 1ISSA 3S0JA 3K53A 2VRZA 1DKNA 3BWYA 2ZWIA 3J7AR 3PWSA 2BZ1A 1R8XA 4JJGA 3RYFA 5H2FZ 3VDRA 2ZBDA 3HA3A 1HDXA 3DKRA 3E61A 4E12A 4U63A 1C7RA 2VPYA 4GPBA 3BT7A 3TD9A 4LBZA 3PD1A 2W00A 4WBNF 2OL4A 1C4KA 2R70A 4QE3A 3NALA 3E70C 1Z4NA 1MRSA 4TVOA 4TL6A 2QY9A 4CM9D 1B16A 3FMIA 3BABA 1GU7A 2VJLA 2OAP1 1I3NA 5ILGA 5K4HA 4KFMA 4P9PA 1Z8FA 5J4YA 3W5DA 1Z45A 4E22A 3MFYA 1FU4A 2R8PA 4BNMA 1TEXA 1U31A 2H1OA 5I8WA 3A9VA 2VH1A 1JEQA 4G27B 1ZAYA 1AXGA 1O9GA 4IBOA 1KQGA 1AP6A 2JGNA 2ZRPA 3L74H 3OZTA 1ONOA 1SUBA 1UEJA 1YUNA 3FWZA 5EN4A 2LBXA 3SZRA 1E6WA 4MULA 5LP6A 1DG3A 1MABA 4Z3KA 2NNUA 2CVHA 4IWXA 2OTLF 1Q21A 3NVAA 2DBYA 2NVBA 4UZEA 3FUUA 1JZSA 3D0KA 2CJXA 4DLYA 1XZBA 4MITA 2HSZA 2QRLA 3B1KA 3H4VA 4PD4F 4ZARA 4E33A 3E8SA 4OJMX 4BW0B 3OQMA 3P2KA 5JO0A 1GX1A 1RQ2A 1TM7E 2Q6KA 2VJAA 4BLWA 3JCUZ 4NBKA 4GWKA 2HCRA 1D2DA 1APBA 5IMBA 3KAQA 2X9NA 5DGIA 1OH5A 2QWXA 1YZYA 4F21A 1UC5B 1XUOA 1HYHA 2E2WA 4MUEA 1Y7LA 3MQWA 3GLFA 5A5VA 4A23A 1DMSA 3NUZA 1JXOA 3W8NA 2JF0A 2PMFA 5TDHA 1EXMA 1ZK0A 1GILA 2W7TA 3NBMA 1Q22A 1B2LA 1VMKA 3IEQA 1NU8A 1UP4A 5DEDA 3PXDA 3VYTC 5KOYA 2H5EA 5ELMA 1H6AA 4RA9A 1ZGAA 4B6SA 1WMFA 4YRFA 1LBIA 3N8KA 2I71A 1MNAA 1LGYA 3QG1A 5ALHA 4ZU6X 5FORA 1YMQA 1TU3A 1OH8A 1XRGA 2XNDD 5KCMA 3DGEA 3WLAA 4MIYA 3DCIA 1JJFA 4F4FA 4KH0A 5A0VA 4OI0A 2Q1YA 1ZJWA 3KC2A 5D86A 2W2TA 5AUNB 1XXHE 3O0DA 4DMCA 4NF2A 2H00A 1EUYA 1KEUA 3FLBA 4PR0A 1NQ5A 2IHBA 3ET4A 4BZWA 2CXRA 1A9QA 4B3MO 2VF2A 2CWDA 4R3NA 1CF4A 1RPNA 4CKZA 4MT8A 2OOKA 3PKIA 1Z0JA 5K4AA 3WTBA 1ENPA 3HI6A 4WVLA 4N0EA 3E9DA 4JH0A 4J0EA 4TMTA 4Q48A 2JC3A 1EUCB 2A33A 2FV8A 1NNI1 1ZNQO 4P4TA 4ZVLA 5EUCA 4TS3A 1X25A 4Q01A 3VNUA 4OMUA 3E15A 5EJGA 1MX3A 4YNBA 2R8RA 2IEIA 2BMWA 3G6WA 3GFOA 3OF3A 5EJMA 2DWDC 2XE8A 4UUPA 2C5EA 4RC9A 5LMUO 3SX0A 3LKVA 2FW0A 2QM4A 4TSFD 1V2GA 4LJ5A 3RASA 3VNAA 2ZYRA 4G4VA 3P5SA 8ADHA 1UQRA 4G88A 2V65A 4C14A 2H2HA 1SVOA 1R3JC 1TVCA 2PKEA 3DNFA 1AK9A 4CL8A 4UB6Z 3ABMC 4DDTA 4QU8A 3Q7QA 1KI6A 1X7ZB 5CDFE 1XROA 4QWWA 3EBPA 3ABLC 1Z5VA 3DE3X 2WJPA 1QD9A 2FA9A 2YIVX 3SQMA 3ZP4A 3BBPA 1UKZA 3CX5F 2IZ6A 1IBKO 4EPTA 1KJ9A 1LSUA 4BCCA 3NNNA 2IZ1A 4WWHA 2OORA 1XJCA 2F64A 3IBGA 5GOTA 1W0KD 1RZVA 3AF5A 1PTJC 3IUYA 3ELUA 1MRZA 1ETUA 3EUEA 1Q92A 1CLIA 3RTEA 1HBJA 4UFZA 5KJFA 3V1NA 3MCUA 3KLMX 2F00A 2RGXA 2P22C 1TAHA 4QJBA 1E9FA 1P1FA 5K6RA 2GCOA 3NOQA 1YO6A 5DSZA 2ENWA 4U7JA 1GFSA 5T8KC 1B14A 1JDVA 3WGHA 3T3MB 5LQNA 5LOVF 3TFWA 2IOFA 4QUJA 3BEOA 1CERA 1TVMA 3IJEB 1RTTA 4RCVA 3JAWA 5FAXA 1XL6A 3E7WA 2HA7A 2YXNA 1U4SA 2CZCA 4EGFA 1C5KA 4OGFA 4DLSA 1FOEB 4TVKA 3WGZA 1P74A 2CD9A 4OAOA 3E03A 1DRJA 5A2QA 4BP9A 1CE8B 1MIOB 1RXWA 4BVLA 2G67A 5BRNA 4NDAA 5CBHA 3PCTA 2PT6A 5K2OA 2PU5A 4G5OA 3ITNA 3HXPA 4BN0A 2VJQA 2OENG 3LDFA 1P1RA 2RJNA 2E5LO 2ECKA 4QQ8A 1E7RA 1CQJA 3RVQA 5ECWA 1VP3A 4RTKA 4GQAA 2GZLA 1YQQA 1PN3A 2WJ6A 4MA5A 2QVBA 2Q0AA 1BCCH 5FYQA 3FNGA 5HS4A 1G64A 1SXJA 3QHQA 1R50A 4E31A 2KB1A 3KZMA 3K08A 3P1JA 4Y2SA 2OO3A 3TZ6A 1VI2A 2B5WA 1BWPA 2PD6A 3ELWA 3R4VA 3IVRA 3VOBA 5AKKA 5LIRA 4GPTA 5C3MA 1HSOA 5MN4A 4CZ2A 5KSWB 3RTBA 3UGJA 4BMOB 5HFNA 3C3BA 5CLJA 1NTRA 4YC7A 3HEAA 1JFVA 1YKFA 1Y6JA 4MTLA 4IGEA 2F1JA 3U13A 3SJBA 5H5NA 5IBCA 1G60A 2R9RB 3GV0A 1BHQ1 3RUDA 5JW6A 4IGIA 2PD4A 3ZHBA 4MQ6A 1TA4A 3N2ZB 5BR7A 4HAYA 1GRQA 3ZZTA 1ULZA 2QD5A 1GPMA 4KFUA 3S2UA 2XUPA 5CNJA 4RKRA 1JZTA 2Q07A 3HCEA 5CH5A 3VOTA 1MJHA 1PT6A 3VR5D 4LF8B 4DV6O 4YR7A 4PAMA 2X8WA 2MSLA 3E7XA 5FBWB 3PX2A 4NOJA 3RSLA 3ITKA 3RAJA 3L7YA 2UXCB 5IAEA 3GT0A 2RMKA 5LD2C 3BFKA 4LYJA 5JTTA 1V1MA 3ILVA 2AOTA 2ADFA 4OLHA 5ES4B 5DLDA 4JI6O 3WKDA 5KYXB 1VL6A 1X9GA 3CISA 3MAQA 2HT6A 1NURA 2G5CA 5KC8A 2C5GA 2Q8NA 1KVUA 5HDBB 2IM9A 4YS6A 5HRUA 1A7KA 2MIIA 1PJCA 1VQ1A 4UAVA 4DDVA 3QVWA 4MQ5A 1YZHA 4UQPA 3GIWA 4HZGA 2W9XA 1ENZA 2C98A 3OC6A 1Q6UA 1PT8A 3BXHA 1JHPA 1K5GA 1IBMB 3C5HA 2VJDA 3S27A 5J43A 1C8KA 3HDGA 4DA7A 1CDDA 1T8PA 4Z53A 2X22A 2AG6A 4W4LA 4JOQA 1HE2A 2YSUB 1GPAA 2EC5A 1F4PA 3AG6A 1QHGA 1B43A 3FRJA 2JCGA 3ERCA 1XCJA 4MV3A 5JMWA 3H1TA 1MGOA 1FJHA 2PS1A 3EGCA 1USGA 5L3FA 4C0AC 1W73A 3GLHB 3SBXA 3FAZA 4URVR 2PKQO 2PD3A 2PXHA 4C3ZA 2AHOA 2JH9A 2GSMB 2DPXA 3R0VA 3AKCA 3SM3A 3MB8A 1Z13A 5I01A 3SYNA 2GK4A 2C8JA 3OZSA 1RJFA 1RXIA 4IDNA 3RSQA 3HP7A 1GP2A 4TV9B 1ML4A 1MR3F 4R2HA 3U3ZA 3S1LA 3VYTB 5NLLA 2G9VA 5JY1A 4QOFA 4FB5A 1RWMA 3FCCA 5KTPA 1QF7A 1JW9B 1KIMA 3CW8X 5CYPA 3IV6A 1SCIA 2EJBA 5J2TF 2UUAB 2QN1A 3O92A 2WP0A 3SMVA 4HX2A 3IQZA 2WQ7A 2JK5C 4N0QA 3ZI4A 2IOFK 2XASA 2HEIA 1KQSF 1JU4A 2XADA 2UZAA 3ZMZA 2GJ8A 4NU6A 1RIIA 2QLJA 4Y2TA 2FDXA 3CU5A 3T4ZA 3G23A 3WYNA 1NN3A 5JZBA 3VUFA 5AFSA 3GD5A 4BLQA 4ZK2A 1TO2E 1D6JA 3RRFA 4I3FA 2FSSA 3GLIB 2CT8A 3CONA 2O3RA 5DCYA 1MXHA 2GN4A 5B58T 2P1RA 4G1VA 2FX5A 2DRIA 1VQ7F 1J20A 5EMKA 4RZ2A 4P3XA 5KUKA 1CXZB 1N1GA 1XEXB 1DT9A 1AS0A 2P9EA 4MQ4A 5FLXA 4YX9A 2C0QA 1SD1A 3SIPA 5JBIA 4R68A 1QFMA 5EJAA 3SEFA 2W90A 5GVSA 1F2VA 4RL4A 2OE2A 5EC8A 3K6SA 3J80A 5ITWA 5FBHA 1TGVA 5ABPA 3F5FA 2BEJA 1E3WB 5JJJB 2WALA 4K8XA 4XR4A 4JIGA 2QXUA 1XA0A 4EIWA 4LHXA 3WICA 2R6DA 2ZVYA 1U3WA 1KI1A 1R9NA 3B12A 5JXJA 2HDNB 2XCIA 4AJ1A 3WMFA 2O2DA 4D8YA 3UMFA 3ABMB 4QBIA 2O2JA 3AI7A 4WGGA 3NW9A 4MDEA 3ABLB 3F5TA 4J10A 2GH1A 3EVAA 2PRZA 5JH7F 5B4UA 4Q1VA 2V3VA 3K71B 4CMEC 4HDMB 4MXDA 2PKQP 1Q3EA 1YJ5A 4H15A 3DFUA 4KNWA 4HPXB 3R0PA 3OHMA 3S2GA 3TG8A 4XAQA 4BLTA 3TSYA 6LDHA 1I0LA 5GWXA 1HDJA 2WIFA 4N54A 4BIMA 4BT2A 3ZGYA 1TE2A 1RLUA 1D4FA 3RO7A 1P2UA 2Z2JA 3H6KA 3DOOA 3LT2A 4RTMA 2R8BA 2HO4A 5JJ5A 3RVDA 1FYDA 5KJ6A 3PSHA 1ISIA 1YRAA 1J39A 1A5BB 2ZBVA 4CFSA 4AY3A 3TOSA 1FDWA 2F55A 2XNCA 4X6YA 3TW6A 1TT5A 4RD3A 1H4VB 1XRLA 2CNWD 1P2BA 3ICWA 2P2LA 2FSHA 2PUCA 3CNHA 3TUIC 1T4GA 3NVMB 1KL7A 3GCGA 1WTCA 1UBHS 4NYMQ 3ZI0A 2EW2A 4DPKA 2W6PA 3Q8XB 1CKEA 3DQZA 3FBGA 3S2SA 4LRXA 2J3QA 2JGJA 3HLTA 5BVGB 2JNBA 1OLSB 1V5WA 3KQMA 4FYXA 4CEIB 5AIBA 1KDVA 3A4IA 2OYQA 3G80A 3TSWA 3MJVA 1VXOA 1TA0A 3KG2A 5F5NA 4J91A 1FJXA 4TTAA 2C7QA 1YTFB 2DKOA 2IE8A 2JAXA 3RFVA 3MINA 4CTKA 2AFIE 2X0LA 3C1TA 3PQ3A 4G89A 1N78A 5CNMA 4P38A 4YMHA 4B84A 4BNLA 5ALXA 2V4UA 1JP7A 4MRRA 1NMZA 4P0TA 1DIRA 1F60A 3W5UA 2FETA 2L17A 4RA6B 3U1VA 3VTIC 2G28A 2OC9A 2QYSA 1R6KA 5BSEA 1QG2A 1UMCA 2FP4B 3G5MA 3PDIB 4HC4A 3GFPA 3LUFA 4NCHA 1U2TA 2JRCA 2BFMA 2XHZA 4OXRA 2BR5A 5L6MB 1EUZA 1KU9A 5ITZA 1CZRA 1PS8A 3N9IA 1UBOS 2EX4A 4ZKDA 4AJJA 4LWSA 1L8AA 2IUEA 1ITZA 5CVVA 3OLQA 4H44B 2A5LA 3CLSD 4BE4A 3EF1A 4HWOA 2WJJA 4P83A 1GFIA 2H7VA 3QKRB 4BFLA 1JHQA 2R9AA 2PMKA 5DO9A 4XOUA 2G4CA 3CLHA 3QFTA 1Z0FA 4KFTA 5B3LA 3T3NA 1N5RA 4QX6A 1XYVA 3ZX5A 1TD9A 4GOJA 1T5TA 3LMEA 2AQ8A 4YXWG 1FEZA 1QDLB 2CBXA 4AF7A 3DUWA 1K63A 3NK6A 3EFFK 2UYHA 2AZTA 1C1DB 2YZMA 3RT1A 4IGKA 5FWNA 3QW4B 3CR8A 3VQWA 4ND4A 1L9KA 5F9HA 4LW8A 2LBPA 2DQ0A 5DXAA 2PQ0A 2WPNA 3U7RA 3T7SA 1Z63A 3DLIA 3H9QA 5FUYA 4FFKA 2CHFA 4CTNA 3ZMTA 4EJ0A 4JLAA 2O1WA 3ZGLA 2PZAA 4FMBB 4KE6A 1I4LD 5CITA 3F8SA 5LD2B 3OD5A 1LNQA 3TNYA 3KCNA 2ZPUA 1P6QA 1RHQA 2TS1A 2GPNA 2HNAA 4R8LA 2WT9A 3K12A 5DASA 1N3YA 4TZKA 3USZA 4Q0MA 3PFWO 4Q3KA 4CL0A 1NXPA 1P0IA 2PRSA 2ZSUA 2CWWA 3O8NA 2YS6A 3TXQA 2YZGA 4UARA 1JQDA 4L72A 4IL6Z 4IIEA 1B0UA 4HDKB 4X44A 4MARA 1N8RW 1CK4A 1X8XA 1N2EA 2UAGA 4GLBA 3V9PA 2HW8A 2LP7A 1EK5A 3I2GA 1FKAO 3HCBA 1QVFF 2JJ1D 4LEIA 5FKJA 3MSCA 1M1KW 4BMZA 1O1YA 1ZK4A 4GGMX 4FHEA 5HKOA 5KJEA 2GJKA 4TMWA 5HIMA 1ZN7A 1FBTA 2IV2X 2F1HA 4CI9A 4BC0A 2YN4A 1KMHB 1GFZA 3VCZA 3B6ZA 4DLKA 2JGKA 2IPOA 2WNHA 1RVDA 1Z7EA 5CXSA 4UPDA 1KC8W 4CT4B 1BVHA 3SWWA 3QY9A 1YVUA 3H42B 3I83A 3F7TA 1ECCA 1V16A 2PUAA 3GELA 2WD7A 4XX1A 2C58A 1V7ZA 2QMQA 4CF7A 1D0SA 3B3GA 4XD7A 1EVYA 2ZUTA 4L8LA 2HRYA 2UYNA 1ZEJA 2AEEA 5JY6A 1VF7A 1EK0A 1ZIDA 2OFWA 1CDOA 4QXPA 4OHMA 3W9YA 1SOVA 5FNVA 4C7JA 2O3UA 1M75A 4TPKA 4E5NA 2DWOA 2X0NA 4HADA 5INTA 2UV8A 5H1YA 1XEWX 2FDCA 3PI7A 1HKUA 2J85A 4J1SA 1MD9A 1RR6A 2NT4A 2KQXA 4MGEA 4BL5A 3ME5A 2V7BA 2MJLA 4BVHA 3NB0A 3LWPC 3R7AA 4OXNA 2UZHA 3I56V 1ZVMA 2EX3A 3DP7A 4NAUA 3U9LA 1QZUA 4R69A 1WAMA 2QVYX 1E2DA 1BXKA 2YYAA 3ON5A 4F9GA 1P0MA 3PUIA 1CZUA 5IF3A 1K75A 5DMXA 1JEAA 4US1R 2GILA 2Y93A 5H9CA 1M1YE 2J9ZB 3ICOA 5A6SA 4R5MA 1K4DC 3WWOA 2E4AA 4NS1A 2XYVA 4EKYA 3QO8A 1GPH1 4V38A 2FZLA 4ZQBA 4BV8A 4QEZA 4XVHA 3KR2A 1VPDA 3IAS1 5BY1A 2D5LA 5B7QA 3VR3D 3L75H 1K8AH 4M89A 3OKFA 1L3CA 1CUUA 5K0SA 1J7JA 3BQMB 4RDHA 3CXCU 1E9CA 4AUMA 4MAAA 2XITA 1IXYA 1GZ0A 4L5AA 4PA4A 1DIHA 7MHTA 3OLXA 3QVSA 1H8EG 3G6EF 3C15C 3U61B 3BGVA 3V8QA 4EZIA 3FWPA 3BTSA 5BMVB 1XHLA 3OX3A 4NS4A 2QTFA 1KH2A 3TZLA 4J0FA 1GPKA 5T5QA 5IE9A 3GLTA 1L4FA 1M6VA 5GZ3A 1GUAA 2I65A 4YT5A 1JTEA 1DLBA 2RC6A 3HJNA 4BB0A 4S12A 4S2UA 4COOA 3TSAA 4MJLA 1DKQA 5FQNA 1K7DA 4KR7A 3RTDA 4NPAA 1GO0A 5KHKA 3OU7A 4R40A 9LDBA 2P4QA 4B2IA 1EQUA 1WSWA 4IDQA 1KI4A 4U00A 2DULA 5AKXA 1P7PA 2ZVQX 4ZAFA 1BHJA 3APOA 1MQ9A 4LYHA 3HPRA 3DBLB 3EGDA 1MZVA 1W8DA 4MV7A 1W4RA 4NBLA 1R9JA 4FI3C 3T52A 1JU9A 4AQ7A 3F78A 3RJMA 3BN3A 3JQDA 4GUAA 1I5XA 3RWOA 4ZD6A 3KJGA 3SHQA 1KNQA 1DRWA 1KUQA 3VR4D 6NULA 1D2CA 2JGMA 2ZSKA 2B5OA 3WQHA 4I3HA 4TWRA 4Y18A 4I4TA 1L2TA 1YIDA 3ZOKA 1VYTA 3R6GA 3IFXA 3IEUA 2O2GA 3PFGA 4DPMA 3O3CA 5TF0A 1U02A 1W5AA 4WOPA 1TKRA 1DQZA 3T35A 1EG2A 3O21A 5FWDA 1TYAE 1XF1A 5DU2A 3WE7A 1MG0A 2ATVA 4WPGA 1YDGA 5FOQA 4HAUA 4Q9HA 3P9YA 1X7WB 3T4DA 4L4XA 4TV8F 2Y1WA 2QJTA 1C9YA 5F23A 4ZTZB 3RRJA 3GMIA 2KG7A 1BRTA 3KUXA 3UWPA 4UCFA 3RRYA 3MJ4A 3KU4A 4ZO8A 2JLBA 3M34A 5C5DA 2ZRLA 4X6LA 2Y76A 2CVPA 4L57A 2NXNA 1P0CA 3A7DA 1BCRB 421PA 2Z6UA 4NR0A 3WWPA 5F1YA 3QV2A 2OXRA 3P0ZA 4JSRA 3MW8A 5FA8A 3HPQA 3IVMA 4ND2A 1EZZA 1JBQA 3FUXA 4RK7A 2LTAA 2AKYA 2FSVC 3RTGA 1JEOA 1UXKA 1VL2A 4TN1A 4MTFA 3C3AA 3JQ9A 1AV7A 4MR8A 2J41A 3PGLA 2I1QA 5CD1A 1PEDA 2Y05A 4AKIA 3AEZA 4HJXA 3X0DA 1A5TA 2OD9A 1VQ8F 3JQBC 4KXYA 4JQZA 5B4VA 4L0DA 4PVDA 2X8LA 5THXA 4RJIA 2O23A 2NQ8A 2F59A 4A16A 3DG9A 2PUDA 2JI8A 5CFMA 1AB3A 4Z9FA 2ALEA 3OJXA 2XIQA 1W1UA 5T6MA 1YNSA 1U6JA 3PQ7A 3WVNA 3HUFA 3HA7A 1V55B 3KYDB 1DZ3A 2GV9A 1J2YA 5T7BA 4J49A 1G2QA 2WQZA 3N2GA 4YV0A 3O75A 4Z86A 3TZCA 4RU1A 3F0FA 4W8GA 4DV2B 1QYCA 1XMOB 1V8ZA 4J0HA 1CY2A 3FTDA 4J41A 4FEEA 4OLJA 4M22A 1PQ4A 1MA3A 4ZVKA 4NKGB 2B61A 3L7OA 1SPXA 3KFVA 2F9FA 1ZUD1 2P4KA 3BJEA 4O4HF 4BO3A 1ZWIC 2PLNA 4OKSA 7REQB 5ALIA 2GEJA 1JBEA 1DO2A 2YWJA 5JYBA 5HCUA 1BGXT 2VQEB 1RAGA 1QCEA 1ZLZA 4AURA 5B64A 1ZQ9A 1IC6A 1PLJA 2WU8A 2FQWA 3HO6A 4MCAA 1YS9A 2C3UA 5EZ5A 2PSFA 3X2QC 2WUVA 4GVPA 1CZOA 4Q47A 1TMYA 2NNWB 5HJ7A 5L45A 3JRWA 3JX9A 1UK6A 3SYMA 1YCIA 1YQDA 1YZUA 3M6MD 3D01A 3UH0A 4N3AA 1LPSA 1RYBA 4Z4FA 3L0ZA 4QFMA 3V4OA 2FZCA 1D6NA 2MSWA 3MT7A 4G0ZA 2NP7A 1CJBA 1M34A 3AF2A 3R0QA 3L4JA 4OB7A 1II8B 4BUCA 3DT6A 3EIHA 4JZ2A 4V1CB 4R1UA 1UDBA 4UZSA 4ENSA 2C4NA 3CX7A 4NMWA 4EATA 4XVRA 4YJFA 1C4OA 3ZNPA 1TZMA 4JEIA 4Y6LA 4TMVA 1D2AA 2I1WA 3SC2A 2VAXA 4OJQA 4DHEA 4FEGA 3EXFB 1PVOA 2ZLBA 4PQEA 4DNQA 5M2QA 1L5QA 4FIPC 4DLXA 1VXRA 5CDSA 5IMSA 1M2WA 1F9EA 1T25A 1H3EA 4TMYA 5KVQA 2NV6A 1ZMTA 2CHSA 4WOJA 4WW0A 4DIUA 3QTTA 3ZDBA 1KORA 1E9AA 2A0KA 1A8HA 3TH5A 2HHLA 2YMLA 4UDOA 2ZIOA 1M90H 3ASVA 2VQSA 2ZKIA 5I45A 1FPMA 4HEA1 4J42A 3GUCA 1YOVB 1UOOA 2F66C 3N2IA 2UVPA 4BU1A 1K4CC 1S7CA 4OI2A 2UUOA 3I3SR 4BBJA 4MV1A 1P45A 2PFSA 3Q4HA 2JIRA 4ZO6A 4UUAA 2ZEJA 4KP4A 1QYWA 2ZYGA 3DA8A 2OFPA 3PC8C 1NTOA 3LO5A 4JUIA 5GONB 3NVKE 4ZCPA 5HW0A 16PKA 4FM2A 3CLSC 4NOLA 5CDHA 2VHXA 1NXOA 2ILMA 4DEXA 4BMCA 1NPYA 2IXGA 3P2MA 2OZPA 3STVA 1PV4A 5AT1A 2G7ZA 4FZJA 1IN1A 2ZT9B 2ZT6A 3I61A 3ELCA 3WLIA 1KBQA 3ZDXB 3D6MA 3GEMA 3IA2A 4P86A 1RAIA 4XQGA 4HUQA 5IW8A 3W7SA 3OVMA 4YRCA 3LY7A 1XZJA 2A1UA 4XZ3A 3LLCA 2SNIE 2WSSD 4RTNA 3E9CA 2XCQA 3CHYA 1NBHA 1RE0A 1YQ9A 1C30B 4DUGA 4HI0E 4TT8A 3A6DA 1RPOA 2CV0A 1TYCA 3CVWA 4EJSA 3ABZA 1TCVA 3QJGA 1KSHA 2KBEA 3ZCUA 4J94A 3UWKA 2D59A 3AESA 2ERXA 3RW0A 2FOXA 2YHAA 2UU9O 1HFWA 4INPA 4C0HA 3DLAA 1KYZA 3QUQA 3KALA 1QHSA 3ZU5A 2GF0A 3CXUA 3FTEA 2VJMA 2AXQA 1LB1B 4MVMA 3NNSA 3TG2A 5A9SA 4B6JA 2J7PA 1BMTA 3Q10A 4GT1A 2NXCA 4D3SA 2FY8A 2XOKA 5AI0A 3HXTA 1OIXA 3IB3A 4FBMA 2QGFA 1CZHA 4A8JA 2Z0MA 4ESHA 4GD3Q 4TRJA 2GPAA 1YU6A 1GTMA 2VNJA 4ZVQA 3OF5A 3ZZMA 1GDDA 4IQ0A 3LWBA 4G8JA 2V7UA 1N3IA 3AEXA 4FFLA 1NTZH 4XPIA 4JJZA 4K6FA 2P35A 4IUDS 2AA3A 5C5CA 2V8OA 3K5OA 1FNSA 4E2YA 1GKKA 2W42A 2NOAA 3KB6A 5LQDA 4F4UA 3CX4A 2YXYA 3MJRA 3FBAA 1VG0B 2WLLA 3B9PA 1QQTA 4I0XB 1JEYA 2WDZA 3U0BA 4X3OA 3A4MA 3SJQC 3R3XA 5JQGB 1YF2A 1A2QA 3U3RA 1JIJA 1VI5A 1Q81W 2ZM6O 1YTFD 3LX8A 5E3IA 1ABEA 2AQIA 3G6BA 1PT9A 1FVFA 4D9CA 4X1YB 2ONYA 4TN5A 3HRKA 4BFWA 1NT2A 4IDCA 3TN7A 2Y1FA 3PXXA 2A8YA 4OMDA 1YRHA 5IBPA 3HLYA 1GSAA 1BX1A 2W4MA 4L95C 3IODA 2FH5B 3EZLA 5ECDA 5TVGA 1LZLA 3Q3IA 2RBKA 1JUDA 4HYQA 2JDIA 3LGSA 2ENUA 4ZKEA 1BEEA 1XKXA 2ZIXB 3KNZA 3FAVB 3VR2A 3FWNA 3KAJA 3DP9A 4YPOA 5FOUA 1C9JA 3G82C 5KSYA 1RU3A 3PKJA 5SYNA 4D79A 1Z2NX 5LMZA 2WLHA 3VPAA 1SIOA 1WU8A 4G8DA 1UBJS 1K34A 2OTJV 4CL2A 1NVFA 3GQBA 1BD3A 1KTVA 2YFHA 1FNCA 3AUTA 1H2LA 1XZGA 1KFJB 4C1BA 3H3JA 1VF5B 3CEPB 4NMXB 1NUHA 4HZUB 2CVOA 3EG9B 3T1QA 2ZIZA 5C37A 1NYTA 1KAGA 3TRJA 4OQ4A 3KFXA 2BI8A 4IMRA 5SZIA 4FONA 4E5KA 3K8ZA 3TLXA 3JSXA 1A4UA 3K1ZA 1AGNA 1TADA 2W6ZA 3AVUA 5KC9A 4B46A 3DDZX 3I23A 1Y4MA 3SEZA 2HZ7A 2AJDA 2PBLA 1XHFA 1JHMA 1CT9A 1JXMA 4YECA 3EPRA 4UCSA 1DIAA 1V2HE 1FXKB 2H16A 1TXGA 1GGMA 4FXOA 1JE0A 2NVUB 1NJ6A 3PC4A 5TVKA 3GJ5A 1M0TA 4TLMB 2VAMA 3KOUA 4Q9KA 1N3BA 1HTWA 3OD4A 4TVBA 1N2HA 3GPBA 4MB0A 2BCJQ 3FDJA 2JI9A 3DAGA 4RVFA 4J7AA 4KXWA 2OV2A 1BJTA 1E77A 4B4UA 1H7MA 4MVJI 1AQUA 1MDFA 2QP3A 2AJCA 4MI1A 2GO7A 2H54A 4IXTA 4Q20A 4RD6A 1SOAA 3RU3A 2BGRA 3S3WA 4LQ4A 2M1ZA 1I1NA 3LBIA 3PDHA 4KXXA 4O4IA 1NC3A 1UQTA 1V25A 2WIBA 4N9QA 3A70A 2CNKA 5E3JA 2ZU6A 3NBXX 1BE6A 1JDZA 4CRWB 1Z0KA 5LMNB 3TSCA 4LBEC 3LU1A 3TQOA 1OCEA 3LLVA 2ZJFA 1Q14A 1ULBA 3ERNA 1YACA 2JIZG 3CC4V 1G8HA 3THXB 3A1EA 3VC1A 3KCYA 2WLKA 1RI3A 2YVLA 1T36B 3CM0A 5DNAA 3X2QB 1Z62A 2HA6A 2JJ2G 3V8MA 2WM2A 2IH4A 5ICSA 4G28B 1ZESA 3WJ2A 5TGDA 1IZ3A 5K8JB 1OU4A 4Q37A 2H11A 2DFLA 2PIDA 1VHJA 2DPMA 4BEJA 5K0EA 4C89A 4ZCQA 3HH8A 1IH8A 2J0UB 3I8XA 4MRNA 4JUCA 4FU0A 4K8RB 4CFYA 5GMOA 3PQ4A 5EESA 3GHYA 1NS1A 3DDOA 4AJ2A 4H33A 2R8YA 2PJUA 5DISB 3FKJA 1CHNA 1GQRA 2R2GA 5E7IA 3LPLA 3OBWA 3HM2A 5G0TA 2H1FA 4Y6SA 4Q7KA 3SZLA 3PWZA 2PV7A 4EPXA 3CTMA 5TGTA 5EE5B 1DDIA 2WUWE 4LDRA 5EXTA 6ABPA 3TSOA 4JLUA 5DBOA 3T7RA 4ODIA 1FNMA 1COMA 4AY5A 1IN7A 4S0XA 4BDSA 1HDOA 3ADOA 2IYLD 5CEEA 2AFIB 1DOHA 2ZRHA 2RAVA 4UHJA 2PUJA 4DR3B 2O8CA 3DL2A 2G0TA 1Y1QA 5LBTA 1ZY2A 4BYMA 3EORA 2EVWX 4R1SA 3VO8A 3RV4A 3RC9A 3L93A 2PKWA 3C45A 2X5NA 1P1IA 4HEHA 4OTZA 3DLTA 3C3WA 4A82A 1ZRSA 1J2RA 1C7IA 3BIJA 2J6CA 1LK7A 2J3IA 2CL6X 4P0QB 1T8RA 3GJRA 4RO0A 3HU3A 4PLFA 4XQ9A 2LRHA 3E48A 4E08A 1JH8A 1IAVA