5J2UB

Tubulin-mmaf complex
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Microtubule Destabilization by Potent Auristatin Anti-Mitotics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 160
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5j2uB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5j2uB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5j2uB01
3HKDB 3JASB 5CA1A 4O4HA 4X1KA 4ZOLA 1RLUA 3WGJA 3WGNA 3E22B 5MN4A 2XKBA 5LOVB 4KWEA 1RQ2A 3M89A 4EB6B 1JFFB 3HKBA 4X1YA 4ZI7A 4IIJB 5GONB 5LYJA 1SA0A 5CA1B 4TUYA 3RYIA 4O4JA 2BTQB 4B46A 2Q1XA 1W5AA 3JATA 4O2BB 5LXTA 3M8KA 4LNUA 5BMVB 1W5EA 4O2AA 4X1KB 3C8LA 3VOAA 4FFBB 5FNVA 1W5BA 3N2GB 3JALA 1W5FA 3JAWA 1TUBB 3HKEB 4E6EA 1TVKA 5J2TA 5KX5B 5KMGA 4U39A 1SA0B 3ZBPA 1W581 4IIJA 5GONA 3JAKB 4ZI7B 1JFFA 4O4IB 4X1YB 3RYIB 4ZHQA 5IJ0A 4EI8A 2VAMA 4I55B 2VAPA 3WGMA 5MN6A 3RB8A 4EI9A 5CA0B 2RHHA 3RYCA 4ZOLB 3HKCA 5EYPB 4O4IA 4EB6A 4O4LB 4F6RB 4WBNB 3JASA 3RYHA 2GVIA 3HKDA 5J2TB 1TVKB 4DXDA 3HKEA 4X1IB 5JQGA 2RHLA 2VXYA 2R751 1FFXA 5CB4A 3R4VA 3ZBQA 4TV8A 1Z5VA 4O4JB 5JH7B 4HNAA 3HKCB 5EYPA 5ITZA 5EZYA 4B45A 4O4LA 5MN5A 3HKBB 5CA0A 4X20B 5JCOA 4YJ2B 3RYCB 4I4TB 3ZIDA 2BTQA 4ZHQB 3RYFB 3E22A 2RHJA 5LP6C 3WGKA 5C8YA 4YJ3B 5J2UA 5KMGB 5LP6B 2RHOA 4EI7A 4U3JA 5BMVA 3JAKA 4XCQA 1OFUA 3N2KB 4TV9A 5IYZB 1RQ7A 3V3TA 3VPAA 5EZYB 4F6RA 4O2AB 4FFBA 5FNVB 5LA6B 5JCOC 4DRXB 3UT5B 4I50A 3VOBA 4LNUB 3N2KA 3JATB 1FFXB 5LXTB 5JVDB 2BTOA 4TV9B 1FSZA 4TUYB 3RYHB 3JARB 4WBNA 2XKAA 4YJ3A 5C8YB 3VO8A 4IHJA 2VAWA 2Q1YA 1Z5WA 5LP6A 1W59A 3CB2A 5J2UB 5M7EA 5LYJB 4I4TA 4YJ2A 5IJ9A 3JARA 5KX5A 3RYFA 3WGLA 5IJ9B 5LOVA 4I55A 3JAWB 3JALB 3N2GA 4X20A 5IJ0B 3UT5A 4DRXA 4IHJB 4TV8B 5LA6A 5JH7A 4O4HB 5CB4B 5ITZB 4M8IA 4HNAB 3VO9A 5EIBC 5IYZA 5JVDA 4O2BA 1TUBA 4X1IA 5JQGB 2R6R1 5EIBD 4I50B 4U3JB
chains in the Genus database with same CATH superfamily
1NIPA 3P19A 1WVIA 4DM3A 4Q4HA 3IEMA 4BX2A 2PSDA 3A37A 4HEA1 1EK2A 1YR8A 1NUAA 3PRKE 4GM1A 4N3AA 4YAFA 3IRUA 2XGGA 3E22B 4FYIA 1VQNV 1CY2A 1SQ6A 1FS0G 1QGUB 1JU9A 1Z0UA 5DPMA 4ALIA 4TT8A 4Y6PA 1WL8A 4EHJA 2ZG6A 2H4ZA 4R81A 2YQ4A 1ZLYA 3M4NA 2X5JO 4IDAA 2PZAA 3ZS8C 2J4DA 5G4UC 2VJYA 4PX3A 3KAJA 2WW8A 4MKXA 1IY0A 5IY5B 1ZZEA 1A3CA 3UCEA 1U43A 3LQFA 4NTYA 5F2NA 1II8B 4RO0A 3VH4A 5A03A 4J7JA 4ICGA 3O1IC 2XODA 3TD9A 2A7XA 1NY6A 2OA0A 3ONEA 5B55A 4MVUA 3KK0A 3TOXA 1IAQA 2HPVA 1JBQA 4LBYA 1ISRA 3QKRB 3VIUA 2EQAA 3N8DA 3P4UA 3CSUA 4QYIA 1ZSYA 1GRJA 1VIBA 2V5UA 4XZ3A 1PT5A 1E1KA 1U8EA 1UOOA 4I8IA 4Z7NB 2E37A 2HHHO 2IYOA 3G6KA 1NNSA 4WN9A 3C6ZA 1X1AA 5EHNA 2Z57A 3HB7A 4Z2YA 3JZFA 4O4IB 2J31A 2RI1A 3PNKA 2P9ZA 5FWXB 1CYEA 3VOUA 2D1SA 5G1OA 2FWBA 1C14A 1QWOA 2AZMA 3ND7A 1LJLA 4D3XA 2I6TA 4LMAA 3RSLA 2FK8A 2D1TA 1JU4A 3H0EA 4DIEA 5DT9A 3UJ9A 4DA4A 3T41A 1G59A 2ZR3A 2DBZA 3IUMA 4I19A 1WBBA 4ZVNA 3BUSA 3CWCA 2VJCA 1R5NA 1U2QA 2J46A 3H84A 3K0DA 4G36A 1W0KD 1DMSA 4RPHA 5AHKA 3C4JA 3F6EX 3P97A 1Y42X 2H5IA 4NR1A 2OR3A 3OJCA 4LBWA 4PYLA 2HHAA 4TN5A 4R98A 4U7FA 1A9TA 2GPTA 2W5UA 3QVWA 4LCEA 5LNK1 4JJAA 1X15A 3AWDA 2HLDA 1L4BA 5DLPA 2OT3B 1MD9A 3I56F 1S8AA 2QA5A 5EPEA 4B45A 1ST3A 2VJAA 2PJDA 4CW7A 3HKBB 2UUCO 1AGRA 1GZ4A 1I30A 1JY8A 2ORED 3P5BA 4GBJA 5AK4A 3VOSA 4DLAA 2W48A 2Q6OA 4CJXA 1DCKA 4CTMA 1SK9A 8AT1A 3P3NA 3PKJA 1VIDA 2ZKLA 2O2SA 4DY6A 3ZQKA 2YQZA 3KEQA 4INZA 2FEPA 3R9XB 1D2AA 2Y1EA 3ZD7A 1N0IA 2TYSB 4UXNA 3T3EA 4MEBA 2HBRA 4GR5A 4OG2A 1SOUA 1IXBA 2L35A 2VHCA 3VZCA 3TFOA 1SETA 1D2GA 2JHAA 3M1YA 1XZHA 4IJUA 2BMDA 4L5BA 4BZPA 3DP9A 2IE8A 1T9BA 1ZPDA 3OOJA 4UUMA 1KEWA 2CW4A 3Q3HA 3P0IA 3D64A 4NULA 1NURA 1FDSA 1OHHA 2Q5QA 3WYCA 1HDJA 3C5EA 4U2KA 4TOIA 1GCOA 1N3LA 2JGUA 1QJCA 2BGRA 2FPOA 4QTTB 5FTNA 3V48A 2R0QC 3X0DA 2GM4A 2DBRA 2FSIA 1R4AA 3PGA1 2AK2A 4O4LF 1G8FA 2JK5C 4PVDA 3FDZB 1SVMA 4EHLA 1N1MA 1NRWA 5CCEA 5FPKA 3ZY2A 2CUKA 4BLSA 4V2IA 1Z2AA 2JA2A 2QIPA 1Z0AA 3CPEA 3L8CA 3EX7C 1R1BA 4C3VA 3BQNB 4GRDA 1X8XA 4R5MA 4XCVA 1B06A 1EINA 4IINA 2PRSA 4DRXA 1GTRA 4B3MB 1ZHFA 4H59A 1ZR2A 5CH3A 3CE2A 3BFRA 1YCGA 3B51X 3HN7A 4M9RA 4OQMA 4CIVA 5JU6A 4Q93A 1LK5A 3JYHA 4RVCA 3HXMA 1XL6A 2X7RB 1GARA 3HV0A 1ZLZA 4D4GA 2CXQA 4KPGA 5DRTA 4BFXA 4BVGA 4RTLA 1HY3A 3K9NA 3IQWA 4XRGA 1QX4A 3FUXA 3V8QA 5BSTA 2WJ6A 5D01A 1YBFA 2XVMA 5JMOA 1UWKA 3AVTA 3G7NA 4CPDA 1XMXA 1DMRA 3CLSD 4EA7A 1B14A 2CV2A 1DV1A 2Y1KA 2BHNA 1V43A 3C48A 4KQXA 1E6EA 1FFHA 1KI8A 3IJPA 5CITA 4N5DA 1K9MH 4OOFA 1XLWA 2P9CA 1U2ZA 2PZ8A 1MNAA 3KQPA 4JLDA 2AZXA 1ZJJA 1YKFA 4AULA 4CM1A 2QJOA 2EBWA 1W75A 1GWNA 2CUZA 2G5TA 3G85A 2LCIA 5FCDA 4JLBA 2F9ZC 2A4KA 5BWMA 5IT5A 2BY4A 4XGIA 2D6FA 1X7XA 2GPSA 3R09A 3FNIA 3PYLA 1KI7A 2HT1A 4I3GA 2CF5A 4LZPA 4GF5A 4LGYA 5KSZA 1A9PA 4PYMA 3I62A 1PJAA 1JKFA 3LFOA 1PO7A 2TRSB 2VS1A 1KTVA 5DMHA 3ZNQA 5ES4B 4DN6A 1KL7A 3U4GA 1FMLA 4GVPA 3DO6A 3E2EA 2PUDA 1DXHA 4C0HA 4LXHA 3VKHA 4JAVA 1QE0A 4G1MB 1IC6A 3SZMA 5A02A 4FCTA 4IXDA 1KY4A 2IEBA 1GPLA 1ML3A 4YT8A 5GY7A 2GLUA 3VR5D 5IHXA 4YJHB 5BT8A 5DBGA 5C35A 1HLPA 4JY7A 1EUZA 1TTPB 2Q8VA 3MBMA 1MDFA 2QIOA 3KJNA 1DTEA 1YRQA 3JWGA 1GVNB 3GJ3A 3HN6A 5MFZA 4A6PA 2EULA 3WPWA 3ENZA 4U6SA 2PUCA 4ARCA 3SIRA 2MJLA 3GZNA 4FVMA 1XLUA 3NEAA 3E15A 2CEAA 4I4CA 3UGQA 5D86A 2ZXWB 2J41A 4CEIA 4N5MA 1G4HA 4ZQFA 2C9ZA 4PC1A 4DSUA 4U7PB 4URZR 4TQDA 5B6PA 1F2DA 3C70A 3UATA 2HW8A 2WM9B 1LTQA 5DN6G 4C2BA 1COWG 4JMPA 2BM8A 2W2NA 2IEDA 2ENWA 1WNTA 4I1YA 2QL5A 4JBYA 2O4UX 1UUFA 2CXSA 2EL7A 4N7BA 4YRMA 4LF6O 4Z6KA 4Y2HA 3S5UA 221PA 1JR9A 4XJSA 1KAHA 1XDZA 3FOFC 3C7DB 2DSTA 4QYIB 1WP9A 3ABLB 4P9PA 3RGBA 3MJDA 1G21B 1N6KA 2ONKA 2BHRA 3BB4A 4N3CA 4TMKA 2ZRKA 1JPXA 3B1XA 4HQKA 3WI7A 1H85A 4NI5A 5REQA 1V39A 1Y67A 4B3TB 3CH4B 4IZIA 1SXIA 3ICVA 1XF1A 4IUBS 2AN5A 2OHXA 3ZOPA 3KM0A 2UUBO 1GUDA 2W6JG 1NVKA 1Z5PA 4RD0A 5AW0A 4Z1MG 4R69A 3A4LA 1PJSA 1KYZA 2ZU0C 3OESA 4S1VA 4C0LA 4BNVA 2XAUA 3VBCA 2XQIA 2R9AA 3FBGA 3PJSK 5CDFA 3CXCU 1KKCA 1OE0A 2BDTA 1ZL8A 2YV2A 1X1CA 2QEXF 4FHGA 3WGZA 1I3OA 3BSSA 2XVZA 2WAXA 3WADA 1QNLA 2JCXA 3PR2B 5K3FA 3VPXA 3L4BC 2O50A 1AB3A 3FB1A 4OQLA 4O4IF 3TLAA 1LBQA 2VHEA 5ITZB 4CMEA 3VO9A 1OLOA 1Z6GA 1AKMA 1N9KA 1Q19A 2IPMA 1YDMA 4OSPA 2F00A 3AT1A 1R3KC 4EELA 1XJ0A 4P31A 1GXSA 5EIBD 3H1FA 1EDZA 1S02A 1CV2A 1I9CA 4WZBA 3H2GA 3FWHA 1ADYA 1U31A 4I99A 1Z4MA 5DTQA 5BRAA 3ZQ4A 1WMBA 4ONEA 3TD4A 3CMEV 2G1UA 3BGVA 3GAZA 3G0DA 2B83A 4WESB 4DDHA 1NJ2A 2CK3A 3E82A 5T41A 5KC9A 2BGGA 2J3MA 3EWAA 1XTIA 1IBCA 3NLLA 2O3SA 4IJMA 4AZTA 3CF0A 4IFTA 3NT5A 1E1QD 2NUTB 4CCYB 5IJWA 3OBWA 3RGGA 1GQFA 4EO4A 3J81A 2NOAA 1QANA 4JX9A 4MKZA 3COZA 4XJVA 3RS2A 4RKYA 2ES4A 2NVBA 1GL9B 4I36A 2PQ0A 1CQIA 1ZK1A 1M93A 3DTYA 4Q01A 1RDFA 1X8JA 2CFCA 4G8CA 5IU6A 4CF3A 2F1RA 3B2EE 4W5JA 1JA0A 4C14A 1VSQA 3KD3A 3BT7A 2AF4C 2EJUA 2OQRA 4OAOA 5H3LA 1S72V 2HU2A 3R0PA 2BCCH 3COPA 3HY6A 4OHMA 4EKYA 1W581 2CVZA 2V6GA 4E51A 4Q82A 3TPFA 4TQ9A 3H05A 3TQFA 3UAGA 4EG0A 2VOEA 4XVUA 1T26A 4KUEA 3TI9A 3F2IA 1UT6A 1MA1A 1SBTA 2X2EA 4P81A 2Q2QA 3OIVA 5DV9A 4NS1A 3U61B 1U1IA 4GXRA 3GUZA 1YZ3A 4FHEA 2E75B 3QYAA 4HL6A 1JEQB 1RFYA 1XTBA 3F4BA 3KQQA 3PIRA 4K6FA 4LCJA 1WO8A 1NR5A 3JTEA 3Q72A 4CKZA 3V6MA 5JDCA 1DX9A 1M2GA 1VA4A 1CIVA 4FM9A 3CRMA 1EE9A 3WYDA 3I37X 3I6ZA 4GKAA 5HUHA 3O8BA 2O8DB 3RJ5A 3OUFA 3M1AA 5GGXA 3E7XA 5HG0A 5JS2A 2Q7XA 5E7QA 3NC4A 4CQMD 5HFLA 1VHTA 1WZIA 4YAIA 2YXDA 2H59A 3HHEA 3LHDA 1Q0PA 1KYTA 3HB4X 3JRXA 3EAQA 3PC8C 4UDYX 5CYGA 1IWPB 1EWRA 3T94A 2Z43A 3KTDA 1T6XA 5BYKA 5A5VA 1W87A 4GXTA 2ZRDA 3AM1A 1XK6A 2HMVA 1XWIA 4YQYA 4BDTA 1ZO8A 4HUTA 1GDTA 1ZNXA 1Q21A 1O95D 4DV1B 1O9BA 4EAQA 2HA7A 2QZJA 4HN4B 1IK4A 4L7VA 3I5XA 1EFKA 2ZATA 3ETJA 3TIIA 1MB2A 3SIVA 1P60A 4IWNA 3X1JA 4UTRA 5EHZA 4C82A 1SKQA 4MI9A 4Q5IA 3VH1A 1FLNA 2H4JA 4Z8XA 1DBVO 3ANXA 3KOUA 2XF8A 3G2KA 3LKZA 2YYYA 4NNJA 1XQ8A 5CRIA 2WMNB 2N3ZA 5KVQA 3VVCA 2HRZA 2WMYA 3JD1A 2FGKA 2XCLA 3IT1A 3NXKA 4XDGA 5FF9A 1IN4A 2X2FA 4MYCA 1Q6UA 4JZ2A 4FZ5A 4YDQA 2C9MA 3LLSA 1O54A 3JARB 1FS6A 3VBBA 1R5JA 4GICA 5HY1A 1Q0QA 3RC9A 3BBLA 2E85A 4BBPA 4MO2A 4K03A 1TE2A 1CUCA 1M6VA 5J2UB 1WVGA 2ZI7A 4C6SA 1P80A 4WZZA 4X7BA 4BX3A 5JWRA 1PEAA 3K0SA 2W2OA 1N33O 1T5HX 2X6CA 1KVTA 4X64B 3GLTA 4G1UC 1PWZA 5TC4A 4MDYA 2YQ5A 3RS3A 5C9ZA 3OTFA 3KPWA 2R84A 2VXOA 1AN9A 2OCLA 1H05A 3ITDA 3OUUA 1NG1A 2PD6A 2FRDA 3F8TA 3D8RA 1VCMA 2O7NA 2P27A 3JZMA 2OHGA 3USZA 6CHYA 5AVZA 2H48A 1MEOA 4FILA 1GH6A 5EJAA 3PC4A 4GPBA 3MRVA 2SKCA 3DOCA 3N8HA 4LRSB 1VL0A 4C7VA 1PU2A 4I6EA 5TRTA 1WRBA 4C4AA 4Q3EA 3I9MA 3TLGA 5JV5A 4AY6A 3LSTA 1RQ2A 4Y9TA 2WJIA 3SX0A 4WIAA 3NT2A 5K3AA 1R10A 1LDNA 3LT1A 2IPOA 3BMNA 1CJVC 2AV6A 2EX0A 2NV0A 5JYDA 3UUGA 2UUAB 1COWA 4MI3A 2L69A 4R8LA 4NY1A 4TYPA 1B42A 4PY2A 1CERA 5HCIA 3KE8A 4YRGA 1SURA 2HK7A 1ESMA 3C5HA 2VQFO 2XSZA 3V4PB 2PT9A 1WB5A 2DQ3A 1NW5A 4KXQA 4AQ7A 1GHTA 1M6WA 2H0RA 2P6OA 3FFAA 4PTLA 4ALLA 5BN3B 2JLVA 3T4XA 1Z4QA 3IESA 1M1XB 3S2GA 1AKUA 3OBYA 2GI4A 4ZC8A 1WZNA 2PIDA 1DI0A 2ZIOA 4GPEA 4R51A 2H2DA 4Y30A 1AHIA 3EAFA 3F7OA 2PH7A 2DQYA 4I8XA 3GJ4A 4KIJA 4BIOA 4HQLA 2X7XA 3KU1A 1DS6A 4FINA 2DN9A 4IL5A 1M2OB 4NL4H 3PXEA 4R9UC 2VAMA 1T1EA 1T10A 1ZD1A 3D3JA 3VDQA 4DVJA 2A9VA 1VJ5A 2EZUA 3LOUA 1JIJA 3RCBA 4B8ZA 4R1TA 1RBZA 3JVVA 2IODA 4DR5O 1PZMA 2PKWA 4DEVA 1BQ3A 1QMGA 3FHOA 1W48A 4RCVA 1HOTA 4TUYF 3AG1C 1K5PA 2WV7A 1KEEA 4YMWA 5G02A 3E89A 2YRFA 4MWGA 4OKIA 4TLEA 2CTPA 2G1AA 5KYKA 4BGIA 4GOMD 1A88A 1E6LA 5JALA 4EGAA 1KZ7B 3EQ9A 4QEZA 3BRCA 3EF0A 4V2UA 3B8HA 1JIQA 4K6MA 2OFOA 2X3YA 2WHQA 3BTSA 3EEYA 1LC3A 1JAZA 3R7WB 4Q3AA 2P5YA 4F4DA 1FNBA 2NPOA 3H3XA 1SVOA 1SIBE 4JLSA 1ABFA 2GAOA 2ZBEA 3IUJA 3RYCB 4RDIA 3HU5A 5I47A 1DRKA 4RHUA 4K3UA 1QQ7A 3PJFA 5TMBA 1I5XA 4ZKDA 1ZGZA 1GMGA 4TT3G 1IAVA 4GKJO 3I7TA 1DU4A 3PQ8A 4IUYA 4NV3A 1JXQA 2EJRA 3JYOA 3NVIB 3L6DA 1P6UA 2FLVA 4B3DA 5HOEA 4AICA 4R8KA 5EK0A 1RMYA 4H37A 4YGXB 3D6NB 2Q99A 1N9GA 1VQLF 1JILA 1JFRA 1QSGA 2ODAA 2Q9BA 2QUBA 3NIBA 4EKDA 1YMVA 2JRLA 1A0OA 1GCAA 3RV3A 6NULA 1QVGF 2G77B 1KMIZ 2XNHA 3LP5A 1TAGA 1AX9A 1HXHA 4W8HA 1I94B 3L01A 4IUDS 3R5TA 1MGOA 2Q1YA 3NASA 4QYXA 3RJMA 2CNLA 4RIFA 2AL7A 2QRGA 3K0AB 5COAA 4UARA 4LDAA 3F4LA 4EVRA 1N8NA 1RM1B 1M56C 4DV2B 1CDDA 1VFPA 1X7DA 2AJBA 3DUWA 4JBWA 1T9AA 1WW2A 3CJTA 4GWGA 4LDQA 1N77A 4LOLA 1QDUA 2AZTA 2Z30A 3AJ8A 5EVCA 1NOKA 3SMQA 2RGGA 4KMSA 1QIKA 4KQGA 1YMUA 3J81k 1ZD2P 3B1KA 4ATNA 1EM6A 1DJMA 3MJTA 2VHVA 1CRWG 2DYYA 3CLRD 4H4EA 4GX0A 5A9TA 1TO6A 3P0FA 3X2SA 4EB6B 1JG4A 1A5TA 4GOJA 4XARA 1QVWA 3MWLA 2SBTA 3AZPA 2F43A 3GWZA 3FRHA 3IP3A 1MG5A 5SICE 3RIEA 3K70B 4A8JA 3S2YA 4L5CA 4TSRA 1W1WA 1LDGA 2DJ5A 5E1AC 3AHDA 4B4WA 3L7IA 3QVNA 2J9FB 4NCNA 1Z36A 4M0EA 3LDDA 3BXXA 2VDVE 1T5LA 4ZT6A 1QYCA 4HVLA 2ZJ3A 2WMDA 2CLSA 2Q8QA 4EY4A 5J1TB 5IMSA 4GRAA 3VQWA 1XCMA 1G8SA 1ZA2A 3M8KA 3S7TA 2FDXA 3RROA 2B8TA 1M9NA 3OW2U 2UDPA 4C43A 1Y8ZA 2ZYSA 1ETUA 3KVOA 4W4TA 4X7RA 1XNRB 2D0DA 5KS2A 1D0IA 2IEAA 1E92A 3ZCSA 3O85A 1TVKA 3R3JA 1VCHA 4NVRA 1DKOA 2DWCA 1C1XA 4KODA 4CCYA 4F92B 4IIJA 2AOUA 2BFFA 4GI1A 2JAXA 4NOMA 5CXXA 3F5DA 5DB4A 2IEZA 2HUNA 2NUPB 3CNNA 3PC7A 4X71A 4JI6B 1AOXA 2RIPA 2BYTA 4BE9A 2RB9A 2VDKB 3DPUA 3SF0A 4GYWA 1C3VA 3H1PA 5ALPA 3M6VA 4PR0A 1VZ3A 4RLFA 3W9BA 3EYWA 1QV6A 3QW2A 5AYVA 1Z12A 3WOVA 3H65A 4YCAA 4Q3BA 4ZTUB 2CVPA 2FXIA 2H2WA 3FETA 3GAMA 4GKVA 3B7GA 3QUTA 3PNQA 2ARHA 3HKEA 1NVPD 1K8RA 5B58T 4C05A 4BNFA 2DWOA 5LOVF 2XCSB 3QWAA 5DCYA 4C9BA 2H1OA 1JE0A 1HQCA 2I2CA 1IWOA 1UBKS 2QZSA 4XRRA 4D1YA 1GPH1 3C3MA 4O8ZA 5IBPA 2LP7A 1JDSA 1CZRA 1E2BA 2OTLV 1TZBA 3HNPA 1BZYA 1Z47A 2IXFA 2ZGVA 2ZW9A 1RAAA 3CC4V 5CVCA 4BMVA 5A9RA 1FFBA 3LM8A 4RQBA 5K03A 2AYYA 1WB7A 4BBZA 2R2AA 4LSWA 4Q4AA 2RH8A 4B40A 2AMFA 2JIOA 3K5MA 3Q98A 3IAS1 1WXHA 2G63A 4MUFA 2GZSA 3OT5A 1H2AS 1TKCA 4TVOA 2CAZC 3EVBA 4N12A 4EQ6A 3LW7A 5KSWB 3LQKA 5HKLA 2GXUA 3GA7A 4UCQA 4GL4A 4MVSA 2ILTA 3HRKA 2O59A 1GPKA 1ZNWA 2I8AA 4ALJA 1UAAA 3JVEA 3N0WA 3OUSA 2BE9A 4JASA 2VFAA 2YJGA 3EWNA 3TZCA 3OQMA 5CA3A 1GN2A 3ANSA 1R00A 3L1KA 5FOQA 5LL6P 3VYSC 2AG0A 2DHRA 2ZTMA 2VK1A 4NOKA 4PHTA 2W2LA 5A6SB 2HHCA 5AW8A 2Q41A 3KKYA 3B20A 2P2LA 3GEBA 3OZDA 4QU5A 1W59A 1ZNZA 2ZIGA 5A71A 3R4CA 1FQJA 5BQ3A 4C01A 1VE6A 2QM3A 4EHDA 2NZ8A 3K05A 4DZRA 1F06A 3X2QC 2GASA 3WL3A 3WHIA 1QIJA 4IZOA 1OC2A 4LYEA 1JJIA 2C9CA 3FI9A 1V8FA 4JITA 2AT1A 3TN7A 1UI9A 1XMSA 4ISCA 1MT0A 3KXLA 3P20A 3UMVA 5C1BA 3QI7A 1M2KA 2MQEA 1W76A 3ZW8A 4F2HA 3ORYA 4DY4A 4ERXA 4M1YA 1PLJA 8GPBA 4QDKA 1WDKA 3UANA 3O8OA 3I55F 3WGJA 1SVLA 4OHBA 3QE3A 3K7EA 5DEIA 5D8DA 5EG5A 3S2EA 3C90A 2E49A 4KV9A 2XKBA 4OHOA 4ZDWA 4BWGA 2OVFA 3SFTA 5LMUO 1TA0A 4BO9A 1LLQA 3ZKAA 1YTFD 1LGYA 5AUOB 3VYTB 4BN5A 1PNRA 4BLVA 5F2VO 4RK7A 4FXPA 1ZJZA 1PD3A 2OBLA 2X76A 3A1UA 2WTEA 2ZUVA 1PS8A 3FVRA 3KHUA 4B46A 3WGYA 3W9YA 4J1TC 1IX9A 1NT4A 2JFWA 3PQFA 4AKSA 2BFNA 4HGNA 4UMFA 4O2AA 4QKQA 5A4KA 2ZVQX 3ZE9A 5AVXA 1OHHD 1LQ2A 4KIGA 1QX3A 4QYMA 4CCWA 3QVGB 3CCMF 2R7KA 5DTMA 2DWDC 4W5RA 3UHJA 1JECA 2XCUA 1VFNA 3KAPA 3QWBA 2CLDX 3ZDYB 2W8ZA 3EPHA 2PMEA 1GFSA 5HGJA 2BGNA 2B4YA 1BNCA 3IAAA 4LMRA 4CG3A 1GKLA 2QV0A 3SEAA 2MU1A 1IATA 1V5GA 2UZHA 3E9YA 3OOSA 2GAAA 4N18A 4ZA2A 3RRZA 2I67A 3BF8A 3VR4A 2HJWA 2Q0QA 4MPRA 2VZEA 2XB9A 4CKEB 3ZX6A 3U4QA 2VGNA 1EX1A 1I0IA 1R6NA 4DARA 1LY1A 4BV9A 3KR0A 4UEWA 2B5VA 4G0OA 4ZOLB 2EINC 5L3FA 1ULAA 1XRSB 4KAXA 2HA4A 2A1UA 2XUZA 3K9BA 2BKAA 1FPMA 3IA2A 4BFCA 3WDSA 4CU2A 1AJQA 4RNDB 2OECA 4G67A 4NKRA 1A2BA 3EGOA 1T9KA 1U2EA 1XT6A 4WZBE 4TV8A 1QVGU 1YHYA 1YVPA 5CEFA 4JI0O 3UPDA 2NZJA 3F6PA 2JCSA 1X8KA 3QPBA 1UXHA 2UUOA 1CXZB 1OFIA 1XEFA 2NO0A 1L6RA 1R0YA 5E95A 1PKXA 5IVIA 4WXYB 4XCXA 4WY8A 1S0VA 4RCZA 1L5WA 1YJNF 1GX1A 4HZIA 1PFQA 1GO1A 4BTEA 2KMLA 4M0UA 4L57A 3AEIA 4XSGA 4EBBA 3WRWA 3H8WA 2UVQA 1Y8AA 2H9YA 2OXFA 3WB2A 4EL5A 2HCFA 3AEQA 3PDJA 5FEUA 5CR9A 4L0DA 1N36O 2EKQA 3KFXA 4IRXA 4D45A 1RJFA 2FLKA 1G1AA 1XTZA 2A5LA 4IFIA 2NTJA 4QUDA 3L73H 4RF3A 4AN1A 4BS9A 1YCFA 3ON5A 3VVBA 5LA6B 2P1ZA 4LI0A 1WIWA 4TZ6A 4LGVA 2ZSJA 3DJFA 3QKSB 4HF7A 3RC7A 1RPJA 2Q4TA 2QD4A 3M3PA 3Q7SA 2A06H 2Y0PA 2VEDA 3RE1A 2AYZA 4FJ1A 1D03A 1TM1E 4J3JA 4UCXA 4EJ6A 1ZH4A 2BKXA 4KL1A 1UINA 1UOQA 2GPWA 3L7KA 3CB2A 4Z2AA 4EJ0A 2R4TA 3FCCA 2HDNB 3IULA 1LLUA 2AFHE 1I2ZA 3NBQA 4P33A 3QNMA 5KYUB 5LLTA 3LP6A 3WHKA 1W73A 1NU6A 2BJVA 1EFUA 1QYRA 2EWVA 2Y1WA 3R3WA 4UTXA 4W82A 1TDJA 3RRMA 1J7JA 3L4SO 4W9NC 2R9IA 4V38A 3VZSA 3I8XA 2R5WA 1KU6A 1E20A 1XE3A 2EW8A 1M2VB 1TEXA 3K0CA 4MI1A 3MBIA 1U8AA 3N0TA 4I81A 2IHBA 4BLQA 1J0AA 1E5TA 3WWYA 1QK3A 3CUWA 4BAGA 3MTAA 1PQ4A 3MILA 1TYCA 1BOFA 2CNKA 5CGQB 3SYRA 3CCVF 4O2RA 3ADDA 1UODA 2GBOA 3COVA 2IITA 2XD9A 3G6EV 3ZHQA 1NBMA 1QH1A 2VG8A 5SZKB 2W4MA 3P4EA 1HZZC 1K34A 3A31A 3SBEA 2R1TA 2FOLA 3W05A 2G9IA 3V2HA 1L7RA 2YWFA 2DUMA 1ZVMA 5FA5A 3UMCA 3URMA 1CLUA 1GQOA 3DMGA 3RK1A 1KAOA 2PYLA 3L7AA 3GLHE 3V33A 5AJUA 3UKDA 5EXEA 4CI0B 4JJ8A 3S03A 5C32A 4UB6Z 3R5HA 5BURA 2NR5A 3DBRB 2QU7A 1T6NA 1Y74A 4FR5A 4IDEA 4W5OA 1TJYA 2QUHA 3P9XA 1V48A 1WDLA 2EC5A 2K7ZA 4JS0A 1L3BA 4QHYA 1QC5B 1G38A 1BMQA 1BXGB 1ONNA 1CZOA 4LJLA 1XVVA 3F98A 3V8EA 1G20A 5ABPA 1E2UA 3HBJA 5DF1A 1BS1A 4EKWA 1I10A 4BBAA 3NTXA 4YV0A 2UV8A 3PHHA 3MAQA 1W5TA 4ZT3A 1OT5A 3ESYA 3JAKB 4BZWA 5HR5A 2ZJ8A 3RVBA 1GV1A 5C51B 1IVNA 1USKA 1QO9A 5A5EA 4XIIA 2PZFA 2I3BA 4HEQA 1XFAA 4E4RA 1FFAA 3CVJA 1A8SA 2O2EA 4U9HS 5H0IA 1GPYA 1Q83A 3WTBA 4CBVA 3FUTA 4E7PA 4P3YA 4A6DA 1FVOA 4CDRA 5F35A 3JQEA 3OLWA 4OPAA 2IOHA 3RYHA 4F4FA 2CHFA 3H2SA 1Y9ZA 3NIDB 4OM7A 4I0XA 3QEOA 3WQBA 2VAXA 4C7BA 4N9WA 2RHLA 2HJFC 4R2LA 3T1TA 3BHIA 3ONDA 3MWYW 4PA7A 3GCGA 5MGBA 3OHMA 2NSDA 5BN1A 2OHWA 2WICA 4M21A 2BEVB 4QUJA 4WY2A 3WNDA 2H08A 5TY0A 4ND8A 2XB6A 3MJCA 2EWCA 1BFUA 4YAKA 5LD2C 1W36D 1UBMS 1JZSA 3FWNA 1O89A 1E1QG 4CKCB 2Y0DA 1JCHA 3E22A 4KR7A 1JAYA 3BL8A 4C5CA 4UMEA 2J4FA 4ABTA 1FK8A 5DTEA 2A0WA 4WMLA 4D0RA 2YFYA 5FWNA 1U8FO 1W2HA 4KXWA 1DEKA 3RFFA 1XK7A 2EHJA 3OFVA 2FQ1A 4BECA 1KK3A 1T2NA 2QN2A 2J8ZA 3L0ZA 3KAQA 5EJ7A 4UM9D 2A3RA 1U0JA 1N32B 1DDIA 1QAOA 2QI9C 5AKHA 1I6LA 2CJPA 3UQYS 2HX0A 1T4BA 3K6JA 1ACLA 1GPJA 3PC6A 4B81A 1IONA 1YR6A 3HJGA 2DOSA 1PR3A 3A3YA 3GGDA 4PW0A 4I9WA 4ZANA 1NM5A 2FHPA 1XD2B 2WTMA 2EKDA 1ZM3A 1Z2OX 3L18A 2FMFA 2V0CA 4G28B 2WHRA 4YJKA 2CW5A 5FUYA 1F4LA 1GU0A 2J5RA 3ZY3A 6Q21A 3HVJA 2FMLA 4CHTA 3L4EA 2ZIFA 1B7GO 4TX1A 3BYQA 4GUAA 4HJRA 2HHJA 3GF4A 4HLUC 2W8BC 1EGAA 2X6RA 1CW2B 4BMSA 2UZ1A 1OZ0A 4NNPA 2VGMA 5JO0A 4K9DA 2CL6X 4IQGA 2LZ0A 4TZKA 5ESWA 4Q9AA 2AI2A 3HJBA 4I8DA 4X66O 1E1CB 2RFLA 4IGEA 3WDLA 4LECA 1E2EA 4R7TA 2Q6TA 3K58A 1FBNA 2QYTA 3UHAA 2P0YA 3A1WA 1F9EA 2FQXA 5I3ZA 4DDVA 2B4KA 3VRHA 2OO5A 5EIBC 2AW3A 2PGXA 3F90A 2VDOB 1T5TA 3HA2A 4YJGA 1EFPA 1GO0A 2G17A 1DAOA 2QTMA 4ZYTA 5BMVB 1KRXA 2KB1A 1ULTA 1G291 1K6MA 1W0CA 2JGFA 2Y1LA 3HR7A 4G4GA 4L8LA 4E1VA 3CKLA 5AI4A 3UMMA 1GN3A 2BEUA 1KNXA 2R6AA 3B8NA 1XRGA 4H60A 3M89A 2OORC 3MPOA 4WZAE 4ZGWA 1QKKA 3HWX1 5L7TA 4NE7A 1TJ3A 1T1JA 4C87A 1GGHA 2PQ2A 3ET5A 1IBSA 1DBPA 1L4UA 1SCUB 3I53A 5DN6D 1UK6A 3WAJA 3R9WA 2LW7A 1FJGB 3LUKA 3OTHA 3MGCA 1H38A 4RQAA 1F0PA 2C88A 1HGXA 4V0OA 5HFNA 1YFJA 4FUTA 3OPYA 4BY9D 4MRPA 4H3SA 1S8OA 3L7JA 3PPIA 1U7OA 5FBKA 5TGZA 3GX1A 1NZFA 3DTVB 1Z5NA 2B30A 3MJRA 4LRQA 4ZDJA 4C06A 4PC6A 1YK1A 3UOWA 1E6KA 1EG7A 2X0KA 5E38A 4HAXA 5FI3A 5J2TA 2VPZA 1QP4A 4LF5O 1FU8A 3SG0A 2O0KA 1FFYA 4XB1A 1RYFA 3SDBA 1DT9A 2WSSD 5HXAA 5EJ4A 2IDZA 1MG0A 3LZCA 3FPFA 2Q50A 4YXWG 2C9BA 4C6RA 4EUEA 3L41A 3F5FA 2R6CA 1TC2A 2C4VA 1FX1A 2EW2A 4R5HA 1RBMA 2HU7A 4DQ0A 2ZTSA 5BUCA 3UCSC 2FMTA 4JNCA 5DK4A 3C87A 4EL0A 1Y4DE 4NK5A 2DZDA 2IYUA 2CBXA 1Z15A 1I5OA 2DFVA 3LBHA 3MIZA 4I4NA 4TYNA 3AVXA 3O2NA 4GYJA 1ENOA 2IH2A 1NPDA 4JLUA 2B3DA 5I8PA 2DYSC 3WFVA 2Z01A 2J30A 2X0LA 4ZCPA 1UBJS 4UUPA 1QONA 7MHTA 5F1PA 3GQBB 2HRUA 5BWLA 2PT7A 2IX9A 2B9EA 3HDGA 1BGWA 3AGQA 4MJLA 1HTTA 3I42A 3M2PA 1N57A 3STVA 1SVSA 3THXB 3N4YA 4B2YA 4E5DA 3IKEA 1PFVA 2Z8XA 2I4OA 2SNIE 1UBNA 3C6XA 3ABIA 1U9IA 2GFHA 3FZGA 3TM5A 3KUKA 4D0GA 3VNBA 1HWYA 5LQAA 4HTFB 4YRSA 3V3KA 2AH5A 3X1DA 5LP6C 1JKMA 1I36A 4DLNA 4DQDA 2CH7A 3TIGA 4R84A 3UGKA 1AHNA 3RVQA 1EWVA 3UTCA 1DJOA 4FGZA 3K72B 1RKBA 3EPKA 3DD5A 1H93A 3AP3A 1SVUA 1L6IA 2QE7A 1M2NA 2QYOA 4XFDA 1PG0A 3LGAA 3IVXA 4EG7A 5KTOA 5JCPA 4I3FA 3FYUA 2MINB 1CZLA 3K1JA 5FPPA 1N6IA 4L9AA 1YJWF 3V2GA 3C3BA 4CH6A 4JBNA 1O4WA 2X0JA 3FCXA 1T5IA 3E8BA 3MWJA 4NG4A 2DUJA 2YIVX 3H5AA 3PQ7A 3BKWA 3ROXA 3SPGA 1PWHA 3ASOB 3ONVA 4KWHA 4MWSA 2VF2A 5LP6A 3K0KA 4IGAA 2I2DA 4QJBA 2I66A 1TYAE 1NMSA 3INNA 1IZ8A 1OXKB 3Q9UA 1CUAA 2C4KA 4BIIA 1LLFA 3LX5A 5T3UA 4ZAYA 4ZVPA 4X20A 4YCLA 3N2EA 1IJFA 3SN6A 3VTAA 3ERCA 2W0SA 4FYWA 4BKUA 5ESRA 1NJSA 2CLCX 2JEYA 2Z58A 3B8MA 2JEXA 1FXUA 4ILEA 4XFJA 2IUUA 3U13A 2QBYA 2Q4OA 2FSFA 3NV9A 5FL7A 1D4ZA 1KDRA 3HE3A 1N9GB 1AB5A 4TSKA 3V6LA 2HF9A 4RQEA 3F6MA 2RDMA 1CRQA 4LYYA 3PIIA 1L7OA 2DT4A 2H0QA 2QS9A 3CCFA 3U5TA 4P4SB 3TMKA 4Y2QA 1H8HG 3VKFA 4D81A 2ZRBA 1K2VN 2QE7D 2AEMA 4QFDA 5AK0A 1LNZA 1I0HA 1MRSA 3L43A 3L8MA 4MSUA 1PFKA 1ZD9A 1J39A 2FMXA 2RI6A 5LQSA 2CLMB 3SFZA 1FFWA 2EZ9A 3TL2A 5LQRA 4AJPA 1ZA1A 1S7CA 3OQBA 4QNRA 3CUVA 2Q1XA 3OTQA 4QAJA 1XD2A 1GAJA 3GH1A 1R6TA 4JI7O 2NSLA 3A26A 4HLNA 2NO9A 1VIAA 3BHJA 3NPAA 4ZAXA 4AK9A 1TU4A 3RT3C 2EKBA 2YBDA 1F51A 1GEGA 4J0CA 3CEIA 3T7AA 3R0JA 1GM9A 4D3DA 3AHFA 1J0DA 1VG1A 4MVRA 1JYSA 1K7EB 3OOHA 1BDJA 1NXTA 3CRCA 3K1TA 4Q37A 4WT7A 1G1XB 4LQLA 1L0BA 3VXKA 1Y8RA 3RHZA 3FM9A 3PNSA 2WD8A 1AZLA 3FF1A 1XNGA 3Q12A 3UT0A 4I5EA 4MYSA 3LFUA 4WDQA 4R4JA 4G4VA 3QVVA 2ZVPX 3BD6A 3VJLA 3IL2A 1GCGA 3PJDA 4KDFA 4BYMA 2GF9A 2W0FC 4TXHA 3VZDA 4F0JA 3W5IA 5JVDF 1LPOA 4EG3A 2YYSA 1DAMA 3JCMM 4XDHA 4BVHA 4O1IA 4EF4A 3MDSA 3CH6A 3WX0A 2V96A 1Z4KA 3Q0IA 3JD2A 1GUFA 3UC9A 2HFJA 2A2ZA 3PENA 2ZIEA 2LDBA 5BV1A 4LV8B 2V6JA 4HQNA 1PNKA 3IR7A 4D98A 1M5TA 1KP3A 1M6NA 2ECOA 1ECBA 3L0OA 1XDBA 3AB7A 4IRUB 5EWJA 1VPVA 3VV3A 2AE2A 3B3AA 2VUUA 2W2QA 3GGPA 4IJVA 1FXWA 3TBHA 2XMRA 3VHXB 2WVJA 1NAIA 2RAFA 3T1CA 1EE2A 1QNMA 2B5WA 4NMMA 5DK6A 4KR9A 3BWEA 1QCYA 3QU5A 4D3FA 4FWTA 1S3JA 4HN9A 3RUHA 1QNFA 2UU9B 5BT9A 3O4RA 3O8QB 2ZSBA 2R8BA 5ECYA 2I4IA 3TNJA 2QV7A 3CW9A 2VUHB 2CWJA 1JSLA 2O07A 4JAUA 3FWPA 4JBIA 3K53A 2HRRA 2HX1A 2DT5A 2IHUA 3H2ZA 1RMQA 2IGTA 1JSXA 1F9AA 4MAFA 5JSKA 3RUEA 3SSOA 5FKJA 3I2IA 4JI5B 3LP8A 1DBWA 3AHIA 1CVRA 1W9HA 4XYMA 5DTRA 3OM1A 2HP0A 1V45E 3KCYA 3GARA 4HH4A 4N5IX 4OA5A 3FGOA 5HQ3B 3LWRC 2H4YA 5B1AB 4NYMR 1B76A 5DYYA 3MB5A 1AF7A 1UC5B 3SIXA 2YN0A 2UZ1B 4GQAA 1D07A 1P7PA 4Y6OA 4YJ3A 4HNRA 1SG6A 2VYCA 1DOHA 4MB0A 3TO5A 4UUAA 1QFJA 1U5BB 1V8BA 4DBVO 4BLRA 3BC1A 3BXFA 4RLQA 2FKAA 2YZNA 3AY0A 3ZCTA 2OGZA 2X8AA 1QB8A 2Z6VA 2Q4DA 4MPTA 4OP1A 2I54A 3QKIA 1CEXA 4OQYA 4WLFA 3BQ9A 5BW5A 1GZSA 3PNVA 4ZK7A 1E7WA 5DRYA 2FEAA 4FFPA 4HDAA 4X8MA 4GI2A 3WFIA 5JNRA 1ZR4A 3ZQJA 1E2KA 1RYNA 4OGWA 2PEZA 4P3NA 2WG0A 1A4UA 4FOLA 2J5KA 4OQZA 2YW2A 5KNCA 3JQAD 1M1KH 2OCCB 1E4EB 1PFUA 2RGCA 1GK9A 4QLOA 2NAPA 3KETA 1N5KA 4TTPA 5KNCD 1VARA 1K9VF 3B3GA 4RH0A 3K2IA 4U8HA 2AZ2A 1IN7A 2N47A 2CNBA 4UBMA 2BIFA 4TT3D 3WJ7A 2EX4A 3RADC 3UAOA 1TQ2A 3COWA 4OLHA 5D3ZA 1YZVA 5IAJA 4J7AA 1Z7YA 3OA0A 4Z4CA 2B9VA 1JFFB 1M90H 1IY8A 3FB6C 3A6DA 1US6A 4KAFA 3I3FA 2VJLA 5CDGA 3LSUA 2XBMA 3MC1A 4Z99A 1MZVA 1J5EO 5JD5A 4PRLA 3W0LB 1I6KA 1HMYA 5D7BA 4IDQA 4WH0A 4MHSA 2G7MC 4AZ3B 4FT2A 1GDHA 2G71A 2Y6UA 3B6JA 4L02A 4RTKA 1I4WA 1R0RE 3OSZA 4I9QA 5CVVA 2R9VA 3KZOA 4NYKA 2RHWA 3C6KA 5ED4A 4K5QA 4W4LA 3FD8A 1DAHA 4AF7A 2P2DA 3G8CA 3NVDA 2ARKA 2CBGA 3E8XA 5KMGA 3DV2A 1RRCA 1NMQA 1JG3A 1N0WA 2ZBRA 2N74A 1WKCA 2NMUA 1C4KA 3DQQA 1MVOA 1SK8A 1BW9A 4OQ4A 5FLYA 5KVSA 4MVJD 1Q0UA 1EZVH 1MTZA 4E5KA 1JQAA 3AFGA 5BNZA 4MQ5A 3MLAA 2DJVA 1FJXA 3HNRA 4LY6A 3LH5A 3COSA 2MSWA 5CPBA 4KFRA 3EBLA 2FTKE 4JR1A 3LYBA 2AW5A 2DVMA 2QN8A 3PFIA 4RPKA 1G42A 3O9VA 5AJTA 3FBTA 3HYTA 2HJRA 2AG5A 4FFOA 2WSIA 1NN0A 5EYPA 2DY1A 5J43A 2NG1A 1TJPB 4TKUB 2JJ2G 1MDBA 1PYGA 2QX7A 1RU3A 2PSSA 2R11A 3KZNA 3KYCB 1KD1W 3LG2A 1U3WA 3LD9A 4G56A 3T7DA 3VOTA 3EIOA 2UXNA 1XRJA 1QRAA 4KCGA 3I9KA 3ZQ6A 3FYDA 4BVQA 4F7WA 4JI2O 5JYBA 1RYDA 3AI3A 1OIVA 3D7MA 2G4VA 3RTGA 3O74A 3QG5A 3Q0EA 1KPGA 4CTNA 5EVJA 2XDAA 4JUIA 3EGWA 3EIWA 1T2DA 1GCIA 2NV2B 4N0MA 3CMAF 4P93A 1HLFA 1UBCA 4LF4B 3QLUA 4KHZA 4QA9A 5ALIA 5EOVA 1SCKA 2BEVA 4B2IA 2Q5OA 4UV8A 4O2AB 2O3QA 2R7NA 1V11A 5KUKA 2YW9A 3PVZA 3RSFA 3WFZA 5D7NA 3V7EA 1I2DA 5F9HA 5FPRA 2A0UA 4KITB 4D8YA 1OPXA 3RYHB 1QBKC 3UK2A 1ZMOA 1D3AA 1JIKA 1TQDA 2A30A 2WDPA 1NVEA 3LOQA 3VTIC 3PQ4A 3DEFA 4KBYA 2JI8A 4KVFA 2COEA 5HKAA 4TM8A 4EEZA 3EC2A 3KXKA 5JNTA 1Z73A 1PW5A 4EW2A 4PPYA 2ZBDA 3ROTA 4H15A 2LDXA 5L7WA 1OILA 3QVXA 3QXSA 3QUBA 3GLHA 2EJ7A 3CR8A 5FTJA 5IBRA 3CCRF 1PG5A 2GVZC 5G1PA 4U9UA 4R9RA 4D9GA 1Z6ZA 4LA4A 2PV7A 3N07A 2J7KA 2YXHA 4Y1EA 1JJBA 3W2FA 1WUTA 2BFCA 3WK6A 3ZVLA 5AVKA 2IHJA 1IFXA 1UZNA 5T4EA 4GUNA 1R88A 2VF4X 2WWGA 4X54A 5G0UA 3E5RA 3UQZA 3EZNA 4XD7A 3WIBA 1DBFA 1C8LA 1D2MA 4WI1A 5AJXA 4EEXA 3G49A 1QP7A 2EATA 1GEEA 4G4XA 4B82A 3PF8A 4H4DA 4G1VA 4BCCA 1YITF 3ED1A 4MCAA 5E7MA 1WHSB 2V4MA 1DF5A 3WBBA 5ADVA 1M8FA 1U3TA 2M6SA 4L8FA 2ECQA 2JJ2A 3ZNOA 5JMWA 4HZ3A 4ZHVA 1GA1A 1IZYA 3PLAC 1Q7RA 1JYEA 1VBMA 2ENUA 3ICWA 4MRMB 4RDCA 4FMTA 3WDMA 3G6WA 3I3SR 3OQIB 2IOYA 1KI6B 3HMKA 1W2BU 2H4HA 1B0PA 2GVNA 1H6AA 3H1IH 4A1FA 1IBKO 2BZ0A 2Q07A 1E2HA 1ZN7A 2R8ZA 2W4IA 4MP3A 3OQOA 2XIQA 4GOLD 2H7CA 1RQRA 2GXQA 4HYOA 2WWXA 1CQJA 2D8AA 3HPLC 4Z2WA 5BSMA 1CUEA 3FYHA 3IDQA 3PWTA 1ZH8A 1XKTA 1AT1A 4NXMO 2RKOA 3L6OO 2VTDA 1YS6A 2X8JA 3A06A 3LI2A 5IF3A 5LHGA 4B3SO 1QVFU 1E77A 3PGMA 1BHJA 2AI1A 2N42A 1NNLA 2UZ4A 4UEOA 4MS2A 3SDZA 4QDOA 5KYUA 2A1IA 1W4AA 1XDUA 5H68A 3X2EA 1KFCB 4CLOB 1IH8A 1OI4A 1FFGA 4G6ZA 2PGNA 4AURA 5J4KA 2XMQA 1YJXA 3OCJA 5AVOA 1NA5A 4BMOB 3N28A 5IH7A 5JROA 1OB2A 1E8DA 1XIVA 1ZOPA 3KBOA 3MUNA 5L3CA 1K4MA 2GLXA 3TXYA 3B2NA 2IJIA 5D51S 1R1MA 5EIOA 4KKXB 3VU3A 1QRSA 1DG9A 3CKKA 1NF9A 2LCFA 3B13B 3SPXA 5K6AC 4W1SA 3IALA 3B3QA 2DWUA 4QLBA 1MH9A 3T80A 4IFEA 4QVGA 3TAHA 4MB2A 2QQ0A 4RJ2A 4BV3A 2YWRA 5JJIA 1N8RW 4QDZA 3IB6A 3MJHA 3OWOA 3FNGA 3AESA 1AZWA 2EBOA 3DFFA 5EL0A 2HCJB 1T6ZA 3I0NA 3L1UA 2WALA 1X77A 2Q9UA 2QF7A 3AF5A 4AHCA 2CXRA 2QVYX 4G1BA 3R9IA 4B4VA 2FR8A 1L7PA 1ZUNA 4U63A 4BNXA 3GGCA 2HP0B 4MW3A 1EZJA 5GTIZ 2ABWA 1SKYB 1BMDA 2F2TA 3DR3A 3N2LA 3HS3A 2R3SA 3LUBA 3O3OB 4NKGB 4JVSB 4M36A 2Z5GA 1U28C 4XOUA 1N3BA 3D6VA 5H80A 3VNAA 5K0BA 3O0DA 4MUEA 1VRCA 4KQKA 1YR7A 3H19A 3JWPA 1OV9A 1T9GR 1RFLA 1I51A 2Z2YA 3T99A 1FNNA 3I04M 1UJ5A 3Q3IA 3KFLA 4KE6A 5D87A 1SC1A 1ESDA 2R79A 4GX5A 2OOKA 4KUHA 1A1VA 4LWSB 1DEOA 2EP7A 3Q3EA 1YDXA 4UATA 3N86A 5DLQC 2P9FA 4DIOA 3ITEA 3OIFA 3LECA 3QXGA 5KQGA 2C7PA 1SH7A 4U2EA 5B12A 1AE1A 1CUXA 3GFBA 4JI4O 2NXWA 2TSYB 3OE5A 3ZI0A 2JGMA 3MT9A 5I7RA 4TYWA 1IBLB 1Y81A 1Q86W 2QR3A 1OFGA 3BCRA 3KT0A 4JU9A 4X6UA 1GITA 5ECDA 2BFPA 2WYIA 1UMBA 4DR2B 1YZHA 3T61A 3TBKA 2WVGA 4U6QA 4YHHO 1NYRA 4BO7A 5DWQA 1ES9A 3E48A 2SECE 3QOFA 1RM4A 5SY4A 3RKRA 3O3NB 4QGBA 1H22A 2DC1A 3ZEDA 2AFHB 3JQ9C 2GMWA 2W2LD 3T4UA 1DTWA 1T9ZA 3ZU3A 5KQMA 2DWEC 3CPQA 3AR6A 1N5JA 2VBGA 2YXYA 3W2TA 2HKIA 1ZL0A 1HT0A 3T5GA 1RLUA 4X1KA 1G5PA 1LLDA 3G13A 4UOEA 1IOLA 2Q5HA 2CZQA 3MXTA 3OJWA 2HS3A 1A9ZA 2OM2A 3GT3A 3WLTA 2IIQA 1GZVA 4HXYA 3N6XA 2P7IA 4ENPA 2E74B 1MH1A 3ZZ0A 4IJ6A 1T8UA 3GFRA 3SVLA 1OAOA 1VK3A 4JSYA 5JAIA 4F96A 3FNFA 1Y6XA 4FLVA 3WGOA 2PY6A 2EIKB 3E1YA 5E7IA 4OHCA 1JX6A 3PNBA 5ADWA 3PT5A 3RE3A 4NLLA 3ZWCA 1CDZA 1YIDA 4F3NA 2QAIA 4EUNA 2P4SA 3ABKC 3G9ZA 5JRJA 4C78A 2HIGA 3IAS6 3N75A 3S1SA 1H69A 3E4CA 3GJ5A 4LOHA 2VO1A 2W6MA 2ZSEA 4L3OA 5JARA 1PM9A 3ENQA 4RVOA 1VE9A 1K5QA 2I2WA 4TKZA 2ODPA 4YQZA 3W6UA 4A0HA 2VWPA 2DBYA 1F5NA 4TL8A 2A5JA 1OT3A 3AF0A 1BGXT 2QN3A 4Q4JA 4L75A 5FFFA 3HI4A 3W79A 4DXAA 3HVRA 3EZ2A 3LX8A 1FDWA 1WPGA 1NW3A 3FFWA 3EXIA 3BFVA 4FCVA 2Y1OA 2XCIA 2P9GA 3FA2A 2RHTA 4LGCA 1UC9A 4B6FA 1YUNA 2VQ6A 5KAPA 4A3SA 2AD1A 4Z9BA 1OXXK 4ZYZA 3I55V 2P2NA 1ORRA 2V7PA 2Q4PA 3NHBA 2Q5IA 2DJIA 4PZEA 4CKXA 5BN5A 5DTIA 2P6MA 3PU6A 4EA9A 1EG2A 1KKMA 3O3CA 3X1XA 2W9XA 2YIMA 3CO0S 8OHMA 5AQEA 2ZE8A 1S5PA 4OXSA 2DCUA 3VI6A 2JA1A 3OAAA 1DKLA 4OXQA 3B3FA 1RA4A 2FG7C 2R87A 3BRSA 3H2BA 4IH1A 3ZNNA 3IEUA 1L5NA 1SCDA 1UFIA 1BHO1 4PJ0Z 1DE0A 1RFGE 5CA0A 1VJTA 3WB1A 1JAXA 2HMTA 3I5DA 2OEPA 2BH9A 3G1TA 4QFBA 4S05A 3ZIDA 1VEWA 1PJZA 3IQIX 1G63A 4F9FA 2ZI5A 1BOOA 3QYFA 3CCCA 3GLFE 3H17A 3PFKA 2XUGA 4ZTZB 1QQCA 1K4KA 3F1KA 3NDJA 4LZWA 4JK3A 2ZPTX 3CYFA 1XYYA 1QS0A 3FFXA 1ODIA 1JQEA 4A0FA 1ORVA 3FOBA 4RHEA 5TQ0B 3SU8A 2H1FA 3L8GA 1IZ7A 2H7VA 4DMGA 4YIPA 1FC0A 1I7PA 1MO3A 4DV6O 1SXJC 1WCIB 1XWFA 5JXWA 4IKPA 5FHRA 1RTTA 3B4SA 3W9UA 2X15A 1IN8A 1P9OA 2AQKA 3DKKA 4GZ3A 1XTQA 2BE3A 3BX1A 3DL4A 5AXBA 1SDSA 2D59A 2NU7A 1JLLA 1X39A 3TCXB 4MA4A 1AUPA 3UJ8A 1JHOA 3GLHB 1GCUA 1U3GA 3QY0A 3VGJA 5BQ5A 2OHJA 3EPPA 1R5OA 1D2DA 5EMHA 3WNZA 4BMZA 3DBIA 4WK0B 5IJ9B 1YIAA 3EZ6A 3FWZA 3QW4B 3BB1A 2AC2A 1KHTA 4DR1B 1UMDA 1KC3A 3EIEA 4EGSA 3RVPA 1H1TA 3I32A 4UJ3A 2ZULA 4YCBA 2NUBA 3FNRA 1SY7A 1PE0A 4OMUA 4MYTA 2WSYB 1GADO 3HY4A 4R7ZA 5F23A 3KSAC 4DSOA 1OBHA 5FR2A 4A6EA 2CLFB 1K5HA 5CBGA 3JYLA 5IVKA 3O75A 1ZTEA 3OEED 4V0MA 2G9ZA 5EWMA 4YONB 2VHQA 3CX4A 1YKGA 1GZ7A 1V3QE 2OQIA 3G88A 4JLPA 3PFWO 1GUAA 3RV4A 4D9BA 4CIWA 1A8PA 1FTWA 2F3UA 2ZUWA 2AMJA 3UCFA 3FYEB 4H33A 3FCUB 4J2OA 4OIFA 2BISA 1OH7A 1PR4A 4V0LA 1ZGCA 1D7OA 2I4MA 2Y0IA 1TI7A 2RDCA 1XV2A 5J4YA 4M1EA 1XEQA 3F8WA 3WJRA 3DYBA 3K32A 1AI5A 3IFXA 3T4ZA 2YS7A 2OZKA 4BW9A 3EULA 3HBFA 4G41A 4JB3A 5T4BA 4X61A 3HUDA 1SBCA 4RMIA 1H0RA 4ME6A 5HF6A 1KJWA 4LY3A 2AG1A 1YHQV 1TJNA 5KI6A 4ZIRB 2Q6KA 2ZRNA 4NDNE 1PL7A 2QRNA 2UZIR 4QUBA 3UB3A 4BB0A 1H6BA 1N78A 1N1GA 2XW6A 3D3WB 4PZ9A 4K8ZA 3JR3A 4JV5B 3F0GA 2OV2A 2R8XA 3L46A 3NBXX 3VPGA 3QKWA 3ZLVA 1L5ZA 1JJFA 1RPNA 4MVJM 5ARDA 5EMKA 4NF2A 4P38A 5H5JA 1DRVA 4BO1A 1FBTA 1C9NA 2PUTA 1GZ6A 3O82A 4LZAA 1NH2B 2Y9MB 3C24A 3UAWA 421PA 1J6UA 4LZJA 3DQPA 3ZWNA 1URPA 4A10A 4KPUA 2UKDA 4MZDA 4JKYA 2YFQA 2P5OA 1UBSB 4POOA 3U7FB 3V7YA 1TW3A 5CDTA 2AGAA 1MJHA 4URWR 9LDTA 5AHWA 3MQFA 5FUBA 2Q49A 5J2TF 3Q40A 1BQZA 3SXJA 1IHDA 2WLKA 1Z7BA 5HZMA 1IBMO 2C5GA 3K2BA 1RWPA 2HRDA 2BP7A 2OGSA 3V7WA 4F12A 5KOJA 4D9MA 1H9AA 1KORA 4BNUA 1NSYA 3WISA 5JPCA 3U60B 4OHVA 4I0WB 1A4RA 2H00A 1BWSA 4D4MA 3JAMN 2XNDG 1DZIA 4BO8A 1FNKA 3CUEF 2XX3A 2CYAA 2LUOA 3K9FC 4E31A 5JBQA 1WSWA 3OT7A 2C3YA 1EJBA 1S3FA 2XBLA 4FDTA 3EIFA 3H1TA 1NOJA 4C3ZA 5AK6A 3I6IA 5D5HA 3THYB 4DG8A 4PDMA 1DLIA 1H2FA 3GFTA 3M2TA 4WESA 3DP7A 2J08A 3KOYA 3WVNA 1J8VA 1PYOA 1A4XA 5DOVA 1QCDA 4L73A 4Y18A 4F46A 2A5DA 2DRIA 3AV0B 4LF7B 1U4SA 1SCNE 4O2AF 1Z0JA 1UBOS 4TSFG 1HBJA 2ICAA 4JC8A 4ER3A 3CH5A 5IM5A 5IVHA 2HK6A 3O84A 4PGAA 2O8EA 4JDPA 1F60A 2H4WA 1NQXA 1VE7A 3KCXA 1NZJA 4GMFA 4MMYB 3U3OA 3ZHXA 4B6QA 3WLHA 1DB3A 3FNEA 5A7HA 3QJ5A 4EKIA 4OL0A 5DTJA 1AR5A 2GJKA 1LUWA 2C96A 3D2CA 3N2IA 2GTSA 1EGQA 1JHZA 3GEMA 3IURA 3NGXA 3NHZA 4J9VA 3S27A 3I28A 2XMZA 1Z0ZA 2FZ5A 1GKYA 5K0JA 3JARA 2GZ2A 4J9ZB 1GNTA 2VF8A 4FB5A 1NVBA 1C29B 3E5MA 1E9DA 3MOGA 1N6HA 1J97A 1SG9A 2VL7A 5KWVA 3EW9A 3OO1A 1H2RS 2FP3A 5KJ1A 3FPSA 1CU1A 2I78A 5FOVA 3UOAB 3AY7A 1SVWA 1W4ZA 3ZZ1A 2XVXA 2Q9AA 3IPCA 1O3YA 4LSMA 5FEMA 4ESOA 4FDLA 5A1JA 4ZJUA 4F5WA 2B7CA 4X92A 4C4WC 1HFEL 1RW4A 2JK1A 5H7XA 3RRFA 3N9IA 3NIGB 3CXUA 3PE6A 2NLJC 4MTLA 3F49S 5JATA 1FPOA 2PM8A 1KZYC 4S04A 1HDZA 5A06A 1RRKA 3JZAA 1QFXA 3LHIA 4AY2A 3VI4B 1LSJA 3QYPA 4Q47A 4FCCA 3EXEB 5K3DA 1AXEA 1KOFA 2ZREA 4UOZA 1HA3A 5LJIA 4B4UA 1PDWA 1Q1ZA 3P9QA 2VSYA 1JEYA 4W5QA 3BJMA 3FTNA 2O2XA 1WJZA 1YCIA 1E94E 3DOFA 4WTOA 2X1VA 5E79Z 3CR3C 3FDXA 3MCAA 1ZMBA 2D06A 2QRZA 4DEXA 2QVZX 2V45A 3FYUB 4GI7A 4BTVA 3EG9B 3LBNA 3IDSA 4L5YA 5ENDA 2BRUA 3DV0B 3ZNPA 1QCCA 3ZO8A 4DV0O 1SZTA 3FYIB 4CBCA 1MF7A 1U7ZA 1V3TA 2ZJ7A 3ID6C 3M5WA 3PKIA 3W3AA 5IC6A 3CU5A 3G68A 4JH0A 5BRJA 3QNWA 4AIIA 1QHIA 1U3CA 1E2NA 2VATA 3DL7A 3OZFA 4G4SP 1VHWA 2ZE7A 3IUBA 1ZCFA 4RTSA 2QOEA 1V16A 4ND2A 4TL6A 4FFWA 3OMNB 1QGDA 4OGLA 1X19A 2GT1A 2Z2ZA 2CHEA 1XHZA 2ZNJA 2QJ1A 1OI2A 3E1SA 3OKAA 1V5EA 4XBFA 3ACBA 3GJ8A 4I9GA 4MVWA 3P9SA 1M6VB 4TN1A 2F66C 2PDAA 3ZVMA 3LA6A 3Q7TA 1YA8A 1ZHHA 4QDJA 4CCAA 2CYBA 1UBHS 1BDIA 2JARA 1SHJA 1J07A 1GR1A 2ZU6A 2WA2A 3CRRA 2B20A 3SWWA 4AKTA 4NYJQ 3TG8A 1JX9A 2XHBA 3TQHA 2R751 3G80A 1E4EA 2PAAA 4Q3CA 5JJKA 1EXWA 4BTLA 2JFGA 1EX9A 4JJ6A 4WPGA 1ZM4A 4UHBA 1SMKA 4PNPA 2WEKA 4LXTA 3ORHA 1FPQA 1HSOA 2JGAA 3PKZA 3PPVA 2WI8A 4QUKA 2YC0A 1E59A 2G1KA 1ZH6A 3ZU5A 2VP2A 1BA3A 2XHZA 2G28A 4AJNA 5IKXA 4BT2A 1KZ4A 4XLLA 2J0VA 4B48A 1KO1A 1NVMB 1JNXX 4H6PA 3GP8A 2YWEA 1MOFA 1FVXA 2PE5A 2DTDA 3A3NA 4P7BA 1YB4A 3AL0C 1KU9A 4HK4A 5FA8A 4GZ6A 1UF9A 4FNOA 4IQ8A 3B9PA 1MXFA 4MV4A 3IXQA 3R7SA 4CUZA 1WA5A 2IVFA 4CKYA 3UWOA 4ZU1X 1X7YB 2ZAMA 3A70A 5JH7F 3CCQF 1R2QA 2X0IA 3CRNA 3PD7A 4RY0A 1IQ0A 4B6JA 2OKGA 3LPLA 3QVTA 8ATCA 4P0PB 2C00A 2BTOA 2C7VA 3EK2A 3G8DA 3KTOA 4L51A 3W7UA 2VNAA 3HRHA 2ZM5A 1LXCA 3CZQA 1Y3IA 2RHDA 1X86B 1PCXA 2MIIA 1EM8B 3ZWKA 4AWXA 5EJEA 3WKEA 2W90A 5IAOA 1LPPA 1ZJWA 5C3UA 4XIGS 4ZT7A 3K70D 3R66A 2W6PA 2ZODA 3ETNA 1WB6A 3ZV5A 4CV2A 1J70A 1JD1A 1SQVH 1QQ5A 3DWGA 3T1YB 2P30A 1Y8QB 1XMOO 3U10A 4O63O 1JJAA 3FIJA 4GPAA 3P9KA 1XZ8A 4UM5A 5B5EZ 3IIJA 2XE7A 3CKMA 4BOYA 5C7YA 3TJZA 4B3CA 5HIAA 1ZUIA 5PNTA 1LS1A 4HXGA 1S2MA 2J9ZB 3EZLA 5EZ5A 2NVUB 1A9SA 2PUBA 3I09A 3JCZA 2PA0A 1R6AA 1ADBA 3M3HA 4KO4S 5CX1A 4CC6A 1QGED 5JQGB 5GZ6A 5HDQA 1N6RA 5J3JA 4L5JA 5CVJA 3N8NA 4YLEA 3VH3A 3BH6A 3QXCA 2IZOA 2E48A 4EKEA 2HH9A 2EIJB 1YQEA 2ZOSA 2HJGA 2EERA 1NVDA 2J7PA 1L1RA 1HNWB 3BHNA 3NHMA 4L15A 5EJIA 4GVLA 2WTBA 1GGFA 3FOWA 4B32A 1AQ6A 3AKYA 2DBVO 3IQXA 4GPIB 4RCYA 1JJ2U 4MDHA 1U2GC 4HT3B 1JS1X 1ZUHA 3PDIB 3WBKA 3D4BA 2AZDA 4E12A 4NFHA 3LMEA 3UW3A 3LLVA 4N1AA 1XSEA 2E4WA 1Z8NA 4O2BB 1P75A 3PFGA 3FPEA 4EIWA 5ICFA 1W57A 3NCHA 2Z9BA 5DP1A 2Z1TA 4JB2A 4I5DA 2G09A 1AO0A 4BIMA 1DUIA 1NNI1 1M56B 3TSCA 2IKSA 1IY2A 4KMMA 1ZMRA 3L5KA 1MXHA 4Y2VA 1ESCA 3DTUB 1FOEB 1U8TA 3OE4A 1UFKA 1WEHA 2Q8PA 4XAQA 2GEFA 5E9QA 2AOWA 3ZJ4A 4RHAA 2DERA 2JIQA 2NM0A 3L1VA 3SIPA 5JJEB 2R66A 1K92A 1DCMA 2HSZA 5I9BA 3G4SV 1CHDA 5EKTA 3A2LA 3R9KA 3L8ZA 5L45A 4NZ9A 2G0NA 5LN1A 2GD6A 5HW0A 3S2FA 1F4NA 1K33A 3FH0A 5JE8A 4PIPA 2B2NA 4E32A 2PQ6A 5TMDA 4YA6A 5JPDA 2QYSA 3IKLA 3P2KA 5B3JA 1GNVA 5AJZA 1R0XA 2I1VB 3O9MA 4ZOAA 4PWTA 3RUPA 1YQDA 1XL1A 1KNJA 3UNXA 3GFSA 4YBZA 3NZEA 3K59A 2ACEA 2JZCA 3ZGYA 1XILA 2WJ4A 1YRLA 5BVHB 3C3TA 4MVMA 1RKVA 3JZIA 2QXYA 4F3YA 1SQ5A 2HM7A 3D59A 4EHFA 3CLSC 1V1MB 1ZK4A 5I7AA 2CDCA 1UM9A 1NE7A 2J3IA 2XCQA 4G1EB 3F7MA 1R0LA 4K9RA 1K8YB 3AFMA 5DGTA 4R54A 3VISA 1JHXA 4F5DA 3ZCUA 1OV6A 4CH4A 5AH0A 3WJ1A 1GNSA 1I5EA 1U3FA 3DKVA 3DC7A 4OYHA 1GA6A 3GA0A 3JQ7A 5B7GA 1S01A 4O0LA 5KHGA 2D74A 4FWIB 4WK4B 2Z3ZA 2ZIZA 4YJDA 3T9AA 2D2FA 3T3PB 1U28A 1L7EA 3GEGA 1GKKA 3IHWA 4N40A 2BGJA 1PTKA 2PUSA 3J7AR 1G3UA 1UXIA 2QX4A 3D5EA 1JHYA 4UTNA 5A9GA 2AIFA 1W85B 2ZYWX 5H59A 5BRNA 3N2KB 1R4MA 2FVXA 2FX2A 5EE9A 3Q4HB 3GOHA 3LRTA 4EF5A 3WGIA 1I4TD 2GN4A 3RU9A 5FI0B 1L5QA 2JKVA 1GTZA 5EWJB 4DIBA 1QQTA 1GSHA 1HFKA 1VSUA 4MQMA 4FK5C 3PA8A 5HF8A 3MT7A 3VKVA 2XKKA 2QLBA 1FFXB 1A2KC 3L82B 1MP0A 4QFMA 3S6JA 1J1IA 5JVDB 1Q57A 2IYQA 4L07A 3BA6A 1AM4D 4FU0A 5DW0A 1A5AB 4BNTA 2ZAYA 1M1UA 1EBFA 2XKAA 4K88A 5DGCA 1YZKA 3LE8A 1PJBA 5H4GA 2JGNA 3SYPA 4PCVA 5JI3E 1PJ4A 1A9XA 4D8WA 1RHRA 1CY1A 4RPGA 3FTQA 4G0QA 1H5UA 1AVTA 3CXCF 1DELA 2FZGA 1WQ4A 4MVJP 3RC1A 3BORA 3RSGA 3COJA 3RQSA 1EGVB 5EHQA 2XGJA 1F6BA 1QLNA 2RAUA 1QZTA 1UDRA 3UUWA 1WAMA 2YCBA 5K2MA 3ZOZA 3W1WA 4OEHA 1M34A 3DLAA 3P9IA 2NZVG 5JSYA 1JLHA 4KWTA 1B8OA 4IICA 3P32A 1DCFA 1NMXA 4TGLA 2PHZA 3OMWA 3V1LA 4Q7MB 5AJHA 4E6PA 1QPBA 2Y99A 3D7KA 2CNWD 5I48A 3Q6NA 1NLYA 5KZMB 4PZZA 3N0VA 4DOMA 2YJ6A 2GETA 1F6WA 4J43A 3ZX4A 3PPXA 3VKUA 5U1PA 1EBOA 2BFBA 4IIJB 2AOUB 3AEKA 2P9BA 2F1OA 2FPXA 2Q6IA 2GOYA 3GJ6A 3S2UA 2CHSA 5CFPA 1N2CB 5B3SC 3OEEG 3AF1A 4K6CA 2IIVA 4FWBA 3K31A 4ZV9A 2XMBA 2JIRA 1ZESA 3O4FA 2I99A 4NFLA 3HCFA 4P3XA 4YAWA 1VQNF 4HRXA 5TJHA 4BHTA 4DLVA 2PLNA 1OR8A 5I6DA 4O2LA 4R16A 3PX2A 4F4JA 1FNCA 1KVQA 1FTNA 1ZONA 1XXHB 1JOYA 2E4ZA 2YXPX 1SHZA 4MT8A 1HYEA 1PWEA 1X0VA 3F1LA 3NWOA 3PDUA 4N8SA 1ZUWA 4RSHA 4EM6A 5JWOA 3QFSA 5KWJA 4LQ4A 4PHZA 5B1OA 2W22A 2XZLA 3JYNA 1EUDA 1YOVA 4RE6A 5L4SA 1TCCA 1RXSA 2GKSA 1TAHA 3T9CA 5KO2A 1JTVA 1XTSA 1D09A 4RZ2A 4TTQA 3PIDA 3ELWA 4PV1B 1M2JA 2QA4V 1C5KA 1JHDA 4F8JA 3TW8A 2AJCA 3Q8XB 3G79A 4OFXA 3WQHA 1ZITA 3VSBA 1OYYA 1F17A 2YZGA 4EHKA 1J2YA 3H2HA 4ZZ0A 2OE2A 2H11A 1DT5A 1Q12A 2KYRA 5GANK 2ST1A 3EVCA 4CIBA 4Y2SA 4WCDA 4Z0TA 3VH2A 3U5ZB 1L9XA 3DHVA 4NHEA 5EP3A 2GCNA 1ZRMA 2OVBA 2XJ4A 5A2GA 4FLXA 3BKXA 1Q0SA 2D2XA 3CX8A 3PHLA 4RWZA 5H2FZ 2J9RA 4IIFA 3BXPA 4AECA 4O4JB 4HNAA 2X4LA 5EJMA 3K3WA 1VQ8F 2PH3A 1K88A 3OCZA 4GLFA 5JD3A 3L7OA 4QRDA 4XD7D 5LDHA 4ARZB 4RWUA 2BZ1A 3LU1A 4IJ5A 4R9VA 1US8A 2QR5A 4DRZA 1QHHB 2E4VA 1V7ZA 4DR4B 3E58A 1SESA 2E5FA 4MVJH 4GEGA 1SU6A 2HLHA 3A0UA 1EWKA 3KB1A 3RJTA 1JJ7A 5JY6A 5JRZA 4GAEA 3KJFA 3U7IA 4EUSA 1Z39A 1H8EG 3NBAA 1DKNA 4IILA 1N2CE 4N65A 2X7JA 1ODLA 2B1JA 1NZ6A 3QTTA 4UAUA 3H5IA 3R5KA 3V3TA 2EIMC 3D3QA 2VXCA 3LYLA 3WA6A 1W0JA 2F9LA 3PEYA 1RRMA 3EVFA 1QU2A 4PZYA 1WBJB 4DV3O 4L4RA 2FEKA 4MWOA 1GZ3A 2CLEB 3N05A 1BU5A 1QH0A 1GLVA 1B3RA 1IXKA 4OGGA 5LBIA 3SHFA 3UCXA 1P0QA 5JQGF 1KF0A 1OROA 2HFKA 4UBJA 2IYXA 4LZNA 4OP2A 5CBPB 4GCZA 3ENVA 3UKJA 2ATKC 3LY9A 1KMHB 1DT3A 1S5LZ 3E20B 3VSCA 5HTOA 2GA8A 3WYEA 2PFKA 1R73A 5KTYA 3PICA 3M4ZA 1JR3E 2VDLB 4B84A 2OL4A 2XRFA 1Y9EA 1U9ZA 1C3EA 3L71H 2RBGA 2XQFA 2G9UA 1XVUA 1Y1TA 2CK3D 1MVNA 4G1FA 4R01A 4ZQEA 1W42A 4OBXA 5TS3A 5IJ0B 4DA7A 2JFFA 3G5UA 4QVKA 3PF9A 3UG7A 2FWPA 1IULA 4U7JA 3RKSA 3GFGA 3ICEA 1ZVKA 3ZD9A 2XT9A 3D9QX 1DAIA 4A73A 1RRFA 1OX6A 3DHWC 1Z07A 3MIIA 3NHSA 5K0GA 1B3QA 1A5SB 4ZHWA 4FD2A 5EIWA 5TGDA 3LQRA 4RYDA 1R3JC 1EDBA 2W6CX 3N74A 3CSSA 3HM9A 3CLTD 3MJ4A 2PL9A 3GFQA 3GXBA 5EWRA 3HB5X 4R8RA 1Q16A 5KHHA 4EITA 2WB2A 1BGVA 2NQ8A 2P11A 3PE4A 4MIYA 1H1LB 3R3UA 5IKPA 5GQSA 2JIZD 3ZE0B 2J6IA 3U7HB 2BH2A 3SYQA 4OSOA 4G88A 1DXOA 1BGYH 4MWEA 4L6CA 5CEEA 2IHZA 3QBJA 1CRPA 5IN5A 1TMKA 1Q81H 5AVVA 4K1XA 4YC7A 1QVVA 4IJKA 4GGPA 4EJSA 5IE9A 1TGVA 3K57A 3KJQA 1AVMA 4GFDA 4MP8A 1FXKC 1YRWA 1BFDA 1WPBA 1B8UA 2D3TA 3HUEA 4IO0A 3VNQA 1H2XA 4BNZA 3IERA 5FPSA 1IQPA 3THYA 4ZAGA 3KZKA 2ZCEA 1T24A 1PBTA 5DHQA 4KW7A 2NLOA 1G7RA 1GKFA 1NWCA 4DA0A 4G8JA 4KRFA 3ILSA 5TR9A 1E2MA 1XAGA 1VPLA 1YQXA 2CHGA 2GK4A 3QF4B 3NATA 2HA5A 1R9JA 1H3EA 1PXWA 3E8FA 4HFRA 3BK2A 4G1CA 4LGMA 4B6GA 1Z6XA 3HDQA 2WYOA 4UM9B 2JD2A 1IEVA 4DV4B 3QVKA 4A23A 2W83A 1CFZA 1MJFA 1T2UA 4NMHA 1ZC3A 1OIWA 3GELA 2I8LA 3LW8A 4FLEA 4YUYA 1G7SA 1DPFA 2AF3C 3I04A 4IS3A 4R05A 4EY6A 3O4JA 5DHAA 2XGOA 4UQLA 3RH0A 1V7QA 2H8CA 5CVEA 1U7DA 4HGQA 4L4YA 1FSSA 5T7BA 3AG2C 4HB0A 5B4UA 3IBTA 2C9OA 4MLDA 2QVCA 3JU3A 1GO2A 4K2HA 4N6OA 4HD8A 1C80A 4QARA 4HYQA 4C0QC 5KB3A 2D0OB 3LQ2A 2BCJQ 3CBQA 3BFKA 3VFDA 2VLIA 5FL3A 2HQBA 4TKVB 2C95A 2C1XA 3Q3CA 2L26A 3KLNA 1HTBA 1SRYA 1VMGA 16PKA 1A50B 1PZNA 3HA3A 4LJKA 4XEHA 3RIMA 3WGQA 4YV1A 4LH7A 2XDYA 1MGPA 3M81A 3SJCA 4K28A 4KN8A 1A9RA 4D4HA 2QVGA 3DZFA 1L8DA 2I7CA 1ISFA 1EYZA 1G19A 3OTOO 2I5PO 2Y9PB 1OLUA 3E23A 1VLMA 3IHLA 4Q7JB 3STTA 1RXIA 5M29A 1U8XX 1KWGA 4QRHA 3UHFA 1LRJA 4LJRA 4PA4A 1CLEA 4FFBA 2YIAA 1SJ9A 3PHJA 2GBLC 3UWKA 1XTRA 2FN4A 2IPNA 1IM2A 3EJ6A 4BRUA 4ZJZA 1L5GB 2F8TA 4FC7A 5IG2A 1L5KA 3M49A 1ZM9A 3LHSA 4EAAA 1SKVA 3FCOA 3HDYA 4J2HA 4QJ3A 4KXNA 4P7FA 4YYEA 3EGXA 1K7YA 2CGNA 2QMOA 5HWSA 3H1JH 1A8HA 1LWOA 2XTMA 3KIPA 2Q68A 2D00A 3T5PA 4B47A 3JX9A 4PGFA 2JHGA 4MVJG 5EJ6A 3K8ZA 1EWYA 3IMEA 3WLRA 4O4JF 2H3HA 2Y93A 4I55A 2PYJA 1X3SA 2UVPA 3VU9B 3ZY6A 3ZWXA 1TM3E 4KG7A 1IN6A 3LT2A 3W5DA 3RWBA 2ZJOA 4DPKA 4KR6A 3WGGA 1JDNA 4YRKA 2OG1A 5B2FA 4FE7A 5TVKA 1GM5A 1MC8A 2VJDA 4U3JB 5DNEA 3UJ6A 1JDZA 1ZH2A 2CMDA 4MVZA 3Q7EA 1QC5A 2O0JA 5B1SA 5ALSA 1CP9A 2RGBA 3IPXA 4E4TA 1BE0A 1E6CA 1IDN1 1ZGBA 2B0JA 2N75A 1V5FA 1LPMA 4QBGB 5F51A 4AJJA 4Y1RB 5F9FA 3CF4G 1DEAA 2GBIA 2Q29A 1PBNA 4XLTA 4COOA 2Y2UA 3OQPA 3V8PA 3IJ4A 1SA0A 4ZIBA 1F2TA 2BBWA 1VQPF 2R6DA 3UHOA 2OXCA 4DL9A 1Y9JA 3GLRA 1DQSA 2I6DA 4P4UA 2EBHX 5I4KA 1T4DA 4KOEC 3JQ8B 4X41A 5HQJA 6YASA 5EUCA 3U81A 5DNCA 721PA 2O0HA 2CZWA 4XW2A 1SKBA 3ZCQA 2J09A 3GFFA 3OOWA 5FFMA 2V7QG 4EO9A 3OZUA 1L7AA 4YI5A 1N25A 3L6CA 5KSPA 4LE0A 4UEJA 1X1DA 3ZJYA 4LY9A 1XCLA 1Z4PX 4ZMBA 4QDUA 5AVRA 1QE5A 4AD8A 5IJZA 5JFTA 5LMNO 1AB6A 1Z18A 2GZ3A 3FDJA 1DNPA 3GUVA 2H7XA 4I9UA 4YRTA 3RG8A 3AEKB 5BQPA 2IXEA 1RM5A 4XQ9A 3SC6A 4B9EA 1QYVA 4BT7A 4DZZA 2O5CA 5CXQA 5A4FS 4GSKA 4PSAA 4S1WA 4PO3X 5KOIA 1H4VB 2FP4A 2PL1A 3QPCA 1WA8A 3DOUA 3RSOA 4EW1A 3CW2A 4U6NA 2A0LA 1U2PA 3HKCA 1IQRA 3DDUA 3OPQA 2QTSA 1MX9A 1FRVA 1D4FA 3INRA 1W1UA 1Z2PX 2A0KA 3NI2A 3VBEA 1JA1A 1BWRA 5EE1A 4DMUB 5MGNA 4HFNA 3ZLBA 2BLLA 2ZBQA 4FHDA 3M83A 5IEJA 1P4SA 1IXYA 3OQNA 5COQA 4ZEOA 5AKLA 4ROSA 1JQ0A 3NR7A 5DHSA 2XDWA 2YN4A 1Z5VA 2BJHA 1OREA 3C5WP 1VBFA 3DMFA 4DHWA 4YUAA 2VA9A 4JLJA 3OE7D 2PANA 4C81A 4JUCA 4OFBA 5L3SA 4YRFA 4GOXA 2IP2A 5IDWA 2DYRC 5EHXA 3CCBA 2HBYA 1JR2A 1DQNA 2RBEA 1SXHA 1L4KA 1XZPA 3PUIA 2H1VA 5BW6B 4KFUA 2CYCA 3GVPA 4XUGB 3ABTA 1Y6RA 1JJ2F 2JJ2D 2NO6A 3MJSA 3NHLA 3OMLA 3QOXA 2W2MA 4OJKA 3T7TA 4YP5A 5DBEX 3VPFA 3HO6A 1PFYA 4O1MA 3PQ6A 3E18A 1XZDA 1FDIA 3S29A 4MVCA 2P3SA 3FUVA 3I9FA 4RW0A 3DAFA 5EFZA 3T0GA 3M9WA 4QTZA 4X85A 5BN4A 1ILEA 1QIEA 4CTKA 1P6XA 2FFBA 3CLUC 5K0CA 2IP4A 2KG4A 4JGBA 1XEWX 3ASZA 2NP6A 2W70A 5KTNA 5GIPE 1EWQA 3L7DA 4XPIB 4OI1A 1FSZA 1T2FA 1SB9A 5WRFA 5HFMA 2RGNC 1BEEA 1MW9X 2YVUA 3HBNA 1VRWA 4KVZA 4EYKA 4TLLB 4P4GA 2YXBA 4US0R 2WD7B 4NEHB 4NCKA 1YULA 4ZOBA 3W5HA 3ZKWA 5JNSA 3LV8A 3QU9A 2XQGA 2I3DA 4FOOA 2HG5C 1OXBB 3KX2A 4PDVA 1XRQA 2PGIA 3K92A 3UYKA 5A5DA 3FX2A 4OJQA 2VQDA 3UAZA 1MC5A 3H0KA 2IBTA 3E27A 4O25A 4G97A 2VQEB 1Y8RB 2JHPA 4QO7A 3N3AC 4N5HX 3Q8HA 4R0NA 1A98A 3NVMB 1R27A 3IT3A 3IKJA 4BGUA 4C7MA 4ZKIA 2JFZA 1PJCA 1UPGA 5JR3A 3GEHA 4JZGA 1IHPA 4ENVA 1F38A 5CYFA 1KH1A 4PYOA 4BAUA 3IKTA 3HJUA 5JEEA 4FPPA 3E9EA 1P4GA 3ND8A 1B6QA 4L8WB 4NEGA 5FUXA 3SZ3A 5H8WA 4YGYA 4DCTA 2BGUA 4M9CA 3H9CA 2EP8A 3W5JA 4CS2A 3A11A 4GI5A 3FD9A 3LTNC 1NF8A 2VPYA 4II3A 4Q3KA 4YPOA 1SO8A 2QE7G 1VJCA 4X95A 2JHFA 5F77A 4JBHA 4EMBA 4RGVA 1O5IA 2XIJA 1SWVA 2REXB 4RGYA 1NTKH 3F6CA 1I5RA 4TVSA 4H08A 1E32A 4TV9F 4NYIR 1KHHA 3FB4A 4HAWA 1OZGA 1XAJA 1ZJYA 5EMJA 4LJ7A 3TW0A 3K04A 3ZMUA 2FX3A 1MG1A 1NFFA 2WMOB 4RHFA 2RHCA 2XUKA 4YRJA 4LFBO 1S2OA 2P3OA 2QMQA 3D2BA 3MWEA 3N7AA 1BVRA 3EVAA 4P2ZA 3RAJA 2H52A 4PZDA 4BNHA 4DCCA 3AG5A 4O1HA 3RTBA 4M53A 4MRSA 4ZHQA 4E1AA 5BZBA 4X3LA 3IJ5A 4JKIA 5EZYF 1VE5A 4LYJA 3DS8A 1J00A 4Y1RA 4BCBA 3G0GA 1P1IA 3RWOA 2QAJA 4BGVA 1DX4A 2X5KO 5EYPB 4CIYA 4QM7A 3QE2A 4Z4EA 5FAKA 3VPCA 1Y9DA 2GNOA