3ZOPA

Arg90cit chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
116
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 32
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zopA00
2UYPA 2B33A 1UFYA 1QD9A 1NQ3A 2CVLA 3ZO8A 3KJJA 2CHTA 3R0PA 1ONIA 3I7TA 1JD1A 3I3FA 2EWCA 3V4DA 2UYKA 2CSLA 2DYYA 1DBFA 4NWOB 2UYNA 4ZK7A 3MQWA 3K0TA 1XRGA 2UYNB 5HP7A 1J7HA 1ODEA 2CHSA 1X25A 3KJKA 2CWJA 3M4SA 3ZP4A 2OTMA 1FNKA 3D01A 3M1XA 1QU9A 2CW4A 1COMA 3ZOPA 1PF5A 3LMEA 3L7QA 3ZP7A 3GTZA 1UI9A 1XHOA 3QUWA 2IG8A 1FNJA 3LYBA 5HP8A 3VCZA 2UYJA 1QAHA 3K12A
chains in the Genus database with same CATH superfamily
2RHLA 4IHJB 4O2BA 5ITZA 1ONIA 3G4SF 2NMUA 1CN7A 2Z1TA 3N4ZA 1RA4A 4C8IA 3DDNA 2IAFA 5GAPK 3PLAC 2GVIA 4BW0B 4BVRA 4BVQA 1YJWF 2CHSA 3SIUA 1JFFB 3F0FA 5HWEA 3KJKA 3JAMM 2OTMA 3D01A 4ZHQA 2CW4A 1PF5A 3CCQF 5B8FA 2Q1YA 5JCOC 3CMAF 1Q81H 1VQMF 2HS3A 2F9ZC 3T80A 3B6NA 3TD4A 3S02A 4X1YB 4IIJB 3IEWA 1U43A 3C9RA 5J2UB 1IPAA 2HX0A 2HS4A 3JALB 4ZHWA 2VAPA 3F6MA 2HS0A 5FNVB 4TV9A 5C8YB 1Q86H 1H7MA 4PWTA 3S06A 5LA6A 5CB4A 2CWJA 5KMGB 3VTIC 3WGJA 2Z1FA 3HKCB 4RQOA 3WGLA 1FNJA 3K2XA 1TUBA 3G71F 2H8CA 1W42A 3HKEA 1SA0A 3IKEA 2BTQB 4E6EA 2JNBA 2KTVA 2UYNA 2H8EA 5CA0A 3VYUC 1W3EX 4RHAA 3TD5A 3RYCB 3RYIA 1U3LA 1YJ9F 3FBAA 3CCLF 4U3JA 2BTUA 5EWRA 1Q8RA 3FPIA 1VQVA 3GTZA 3ZP7A 4XCQA 4F6RB 2IG8A 3MCQA 4LNUA 1W40A 3LFOA 5GONA 1RLUA 4O4JA 4X1KB 1X7OA 3DC2A 3FFMA 3K14A 4ZOLA 1Q7YH 1IV3A 3IEQA 2ZVZA 4G4ZA 2V9YA 4O4LB 3JAKB 3V4DA 4C81A 3WGNA 3CCUF 3MBMA 2OZBA 1RQ7A 3C9UA 5JQGB 1OFUA 3JASB 3S0YA 3N2GA 2K1SA 3RYFA 3IMPA 3J7AR 2OHWA 5MN6A 1QVGF 1H47A 2ZVYA 1QAHA 5LYJB 4X20B 5HY2A 4TUYA 4B5CA 1W41A 4R40B 3WJRA 3P0ZA 3AGKA 5JVDB 3R0PA 5KX5A 2HP3A 3UT5A 3S03A 1VQ9F 3CG6A 3CPWF 3FD5A 4I55A 1U3PA 5BMVA 1W57A 2RHOA 1YGYA 4HNAA 5HXZA 1W5AA 5LP6B 2UZHA 4EB6B 4ZI7A 4I4TA 4ERHA 5EYPB 3JCMM 2ZAUA 5HY1A 1GX1A 2FC3A 3HWUA 5AVMA 1KNKA 2Z01A 1IV2A 3J81M 2QI2A 5HY0A 4C82A 2ALEA 1DBFA 1VQ8F 5CA1B 1GO0A 4YJ3B 3RA5A 4O4IB 1OAPA 1K8AH 4YJ2A 4I50B 5FLXM 1KC8H 3OONA 2ZOVA 2VGNA 3GHZA 4DRXA 1E7KA 3QUWA 3HKDA 2KTUA 4X1KA 4G88A 5HP8A 5G4UC 4BT6A 2ZODA 4WBNA 2KGWA 2WALA 1FFXB 3JARB 2LBWA 3F0DA 3VI6A 3ZO8A 4BVTA 3KJJA 5GINC 3S0WA 5IJ0A 5EB0A 3VO8A 2PMPA 3G6EF 3WPXA 5JQGA 3CCMF 5IYZB 3MQWA 3K0TA 1VHAA 4TV8B 3CB2A 1W5BA 4G4YA 5EZYA 4BT4A 3RYHB 1TVKB 4LCKA 2OTLF 1RLGA 2FGYA 4DXDA 1K73H 5JH7B 1Z5WA 5LXTA 4FFBA 2R751 3C9SA 1GO1A 3MCAB 3VOAA 1ZWZA 1VQPF 2UYPA 3CD6F 4X1IA 4G4WA 3CPQA 3O85A 3P10A 1VK3A 3V3TA 4C8EA 3RE3A 5IJ9B 3LWRC 2QTPA 1DT9A 1JD1A 2EWCA 1Z5VA 5J2TB 2GZLA 1KQSF 2HP0A 2QEXF 1IV1A 3JATA 3HKBB 3RA6A 3E22A 4O4HB 1N8RH 4O2AA 3IR9A 4B62A 1W5EA 5LOVB 1R1MA 2Z1UA 3JAWB 3OBWA 3D00A 3OBYA 2DT4A 1X52A 3P4EA 2UYJA 3ON1A 1YITF 4IHJA 3IKFA 2B33A 4O2BB 5ITZB 2CVLA 1NMUB 4KWEA 4NUTA 3J80M 1KD1H 3ELCA 1K9MH 1VQ5F 3LDTA 3CCVF 4NWOB 2QA4F 4U39A 3NK6A 1JFFA 4G4XA 5LP6C 3CXCF 3F0EA 3M84A 3LWQC 5EAZA 4EI8A 4ZHQB 3L7QA 5GIOC 1M1KH 3N2KB 3CMEF 3LYBA 2YXZA 3PAFA 2HQSC 3LWVC 4X1YA 4IIJA 1QD9A 1NQ3A 3Q8HA 3KHNA 5J2UA 3JALA 1M90H 3I7TA 3I3FA 5EIBC 2DYYA 5FNVA 5C8YA 1XRGA 4TV9B 3HAXD 2L26A 5LA6B 5CB4B 5KMGA 1COMA 3HKCA 1GZ0A 1XHOA 1W2BF 1CK2A 4X3LA 3VCZA 4NQ3A 1TUBB 3CCEF 4B46A 1UFYA 3HKEB 1YQNA 1SZQA 4C8GA 5A2QM 1SA0B 3VYTC 3D54A 2UYKA 3JVHA 3MDOA 3CC2F 3NVIB 1XV2A 4X3MA 3QTYA 2UYNB 1YJNF 5CA0B 5HP7A 5DCVA 2AIFA 3RYCA 1RQ2A 1VQKF 3CC4F 3BYQA 3JAWA 3RYIB 3I55F 3CYQA 4U3JB 4F6RA 1X7PA 1YHQF 3VMFB 1UI9A 4LNUB 1CLIA 3WJQA 5GONB 5HY4A 4O4JB 2AMTA 3OW2F 3GYQA 4ZOLB 2GLZA 3EORA 5EB1B 5GIPC 1W5FA 1YI2F 4O4LA 3JAKA 5G4VC 3CCJF 4BT3A 1XBIA 2MQEA 2P6YA 3TD3A 1ODEA 3ERNA 3JASA 2HVYD 3N2GB 5IT9M 2G9IA 3M1XA 3N2KA 1KNJA 3LMEA 3RYFB 2IQQA 1T0AA 1W59A 2LBXA 5LYJA 4X20A 3U0OA 4TUYB 3NK7A 5JVDA 2RHJA 2CHTA 3V7QA 3E20B 1T0KB 5KX5B 3WGKA 3WGMA 1H48A 3UT5B 3KIZA 3SIVA 2LCAA 2YYEA 4I55B 5GANK 1U40A 1VQOF 4ZHYB 5BMVB 1W581 5MN5A 5EO3A 2KG4A 3QHDA 1VQNF 4HNAB 3S0HA 5LP6A 4EB6A 3I56F 2VXYA 4BY9D 4EI9A 4ZI7B 3LWPC 1VQ6F 2CZWA 5EYPA 4BT2A 3F0GA 4I4TB 2VGMA 4B45A 1JJ2F 4BVSA 1W55A 3LWOC 1QVFF 2CSLA 3C8LA 2OTJF 5CA1A 4YJ3A 1J7HA 4O4IA 4I50A 5EIBD 3CCSF 3M4SA 3ZP4A 3FD6A 3C9TA 4YJ2B 3ZOPA 1QU9A 3CCRF 3NMUC 4DRXB 3HKDB 4TZZA 2AIZP 5HXUA 1FFXA 3CC7F 2RB9A 3JARA 4WBNB 5MN4A 1VH8A 2LBTA 1YIJF 2N48A 5IJ0B 3WJPA 5IYZA 2VAWA 3WXMB 2Z1EA 4TV8A 1SDSA 1X25A 3RYHA 5EZYB 1TVKA 3VOBA 1FNKA 3ESJA 1S72F 2ZF8A 5JH7A 1VQLF 3HTNA 3E1YA 5LXTB 3NVKE 4FFBB 4BT5A 2HRUA 2VAMA 2BTOA 3K12A 1VQ4F 2W8BC 5IJ9A 4X1IB 1VQ7F 2H6LA 2I6DA 3CYPB 1JN1A 3V7EA 2R6R1 1NJIH 2I6RA 3KE1A 4G4VA 1PXWA 2Q1XA 1Q82H 2HRYA 5J2TA 4M8IA 3N4YA 4ZK7A 2PHNA 3VIUA 3HKBA 4O4HA 2HP0B 4EI7A 3JATB 2RHHA 3E22B 2BO1A 5LOVA 4O2AB 3VYSC 1FSZA 3HJWC 3WPWA 1IV4A 4BT7A 4C4WC 5FJ4C 1JY8A 4ZHVA 5JCOA
chains in the Genus database with same CATH topology
2UYPA 2B33A 1UFYA 1QD9A 1NQ3A 2CVLA 3ZO8A 3KJJA 2CHTA 3R0PA 1ONIA 3I7TA 1JD1A 3I3FA 2EWCA 3V4DA 2UYKA 2CSLA 2DYYA 1DBFA 4NWOB 2UYNA 4ZK7A 3MQWA 3K0TA 1XRGA 2UYNB 5HP7A 1J7HA 1ODEA 2CHSA 1X25A 3KJKA 2CWJA 3M4SA 3ZP4A 2OTMA 1FNKA 3D01A 3M1XA 1QU9A 2CW4A 1COMA 3ZOPA 1PF5A 3LMEA 3L7QA 3ZP7A 3GTZA 1UI9A 1XHOA 3QUWA 2IG8A 1FNJA 3LYBA 5HP8A 3VCZA 2UYJA 1QAHA 3K12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYP A;  2B33 A;  1UFY A;  1QD9 A;  1NQ3 A;  2CVL A;  3ZO8 A;  3KJJ A;  2CHT A;  3R0P A;  1ONI A;  3I7T A;  1JD1 A;  3I3F A;  2EWC A;  3V4D A;  2UYK A;  2CSL A;  2DYY A;  1DBF A;  4NWO B;  2UYN A;  4ZK7 A;  3MQW A;  3K0T A;  1XRG A;  2UYN B;  5HP7 A;  1J7H A;  1ODE A;  2CHS A;  1X25 A;  3KJK A;  2CWJ A;  3M4S A;  3ZP4 A;  2OTM A;  1FNK A;  3D01 A;  3M1X A;  1QU9 A;  2CW4 A;  1COM A;  3ZOP A;  1PF5 A;  3LME A;  3L7Q A;  3ZP7 A;  3GTZ A;  1UI9 A;  1XHO A;  3QUW A;  2IG8 A;  1FNJ A;  3LYB A;  5HP8 A;  3VCZ A;  2UYJ A;  1QAH A;  3K12 A; 
#chains in the Genus database with same CATH topology
 2RHL A;  4IHJ B;  4O2B A;  5ITZ A;  1ONI A;  3G4S F;  2NMU A;  1CN7 A;  2Z1T A;  3N4Z A;  1RA4 A;  4C8I A;  3DDN A;  2IAF A;  5GAP K;  3PLA C;  2GVI A;  4BW0 B;  4BVR A;  4BVQ A;  1YJW F;  2CHS A;  3SIU A;  1JFF B;  3F0F A;  5HWE A;  3KJK A;  3JAM M;  2OTM A;  3D01 A;  4ZHQ A;  2CW4 A;  1PF5 A;  3CCQ F;  5B8F A;  2Q1Y A;  5JCO C;  3CMA F;  1Q81 H;  1VQM F;  2HS3 A;  2F9Z C;  3T80 A;  3B6N A;  3TD4 A;  3S02 A;  4X1Y B;  4IIJ B;  3IEW A;  1U43 A;  3C9R A;  5J2U B;  1IPA A;  2HX0 A;  2HS4 A;  3JAL B;  4ZHW A;  2VAP A;  3F6M A;  2HS0 A;  5FNV B;  4TV9 A;  5C8Y B;  1Q86 H;  1H7M A;  4PWT A;  3S06 A;  5LA6 A;  5CB4 A;  2CWJ A;  5KMG B;  3VTI C;  3WGJ A;  2Z1F A;  3HKC B;  4RQO A;  3WGL A;  1FNJ A;  3K2X A;  1TUB A;  3G71 F;  2H8C A;  1W42 A;  3HKE A;  1SA0 A;  3IKE A;  2BTQ B;  4E6E A;  2JNB A;  2KTV A;  2UYN A;  2H8E A;  5CA0 A;  3VYU C;  1W3E X;  4RHA A;  3TD5 A;  3RYC B;  3RYI A;  1U3L A;  1YJ9 F;  3FBA A;  3CCL F;  4U3J A;  2BTU A;  5EWR A;  1Q8R A;  3FPI A;  1VQV A;  3GTZ A;  3ZP7 A;  4XCQ A;  4F6R B;  2IG8 A;  3MCQ A;  4LNU A;  1W40 A;  3LFO A;  5GON A;  1RLU A;  4O4J A;  4X1K B;  1X7O A;  3DC2 A;  3FFM A;  3K14 A;  4ZOL A;  1Q7Y H;  1IV3 A;  3IEQ A;  2ZVZ A;  4G4Z A;  2V9Y A;  4O4L B;  3JAK B;  3V4D A;  4C81 A;  3WGN A;  3CCU F;  3MBM A;  2OZB A;  1RQ7 A;  3C9U A;  5JQG B;  1OFU A;  3JAS B;  3S0Y A;  3N2G A;  2K1S A;  3RYF A;  3IMP A;  3J7A R;  2OHW A;  5MN6 A;  1QVG F;  1H47 A;  2ZVY A;  1QAH A;  5LYJ B;  4X20 B;  5HY2 A;  4TUY A;  4B5C A;  1W41 A;  4R40 B;  3WJR A;  3P0Z A;  3AGK A;  5JVD B;  3R0P A;  5KX5 A;  2HP3 A;  3UT5 A;  3S03 A;  1VQ9 F;  3CG6 A;  3CPW F;  3FD5 A;  4I55 A;  1U3P A;  5BMV A;  1W57 A;  2RHO A;  1YGY A;  4HNA A;  5HXZ A;  1W5A A;  5LP6 B;  2UZH A;  4EB6 B;  4ZI7 A;  4I4T A;  4ERH A;  5EYP B;  3JCM M;  2ZAU A;  5HY1 A;  1GX1 A;  2FC3 A;  3HWU A;  5AVM A;  1KNK A;  2Z01 A;  1IV2 A;  3J81 M;  2QI2 A;  5HY0 A;  4C82 A;  2ALE A;  1DBF A;  1VQ8 F;  5CA1 B;  1GO0 A;  4YJ3 B;  3RA5 A;  4O4I B;  1OAP A;  1K8A H;  4YJ2 A;  4I50 B;  5FLX M;  1KC8 H;  3OON A;  2ZOV A;  2VGN A;  3GHZ A;  4DRX A;  1E7K A;  3QUW A;  3HKD A;  2KTU A;  4X1K A;  4G88 A;  5HP8 A;  5G4U C;  4BT6 A;  2ZOD A;  4WBN A;  2KGW A;  2WAL A;  1FFX B;  3JAR B;  2LBW A;  3F0D A;  3VI6 A;  3ZO8 A;  4BVT A;  3KJJ A;  5GIN C;  3S0W A;  5IJ0 A;  5EB0 A;  3VO8 A;  2PMP A;  3G6E F;  3WPX A;  5JQG A;  3CCM F;  5IYZ B;  3MQW A;  3K0T A;  1VHA A;  4TV8 B;  3CB2 A;  1W5B A;  4G4Y A;  5EZY A;  4BT4 A;  3RYH B;  1TVK B;  4LCK A;  2OTL F;  1RLG A;  2FGY A;  4DXD A;  1K73 H;  5JH7 B;  1Z5W A;  5LXT A;  4FFB A;  2R75 1;  3C9S A;  1GO1 A;  3MCA B;  3VOA A;  1ZWZ A;  1VQP F;  2UYP A;  3CD6 F;  4X1I A;  4G4W A;  3CPQ A;  3O85 A;  3P10 A;  1VK3 A;  3V3T A;  4C8E A;  3RE3 A;  5IJ9 B;  3LWR C;  2QTP A;  1DT9 A;  1JD1 A;  2EWC A;  1Z5V A;  5J2T B;  2GZL A;  1KQS F;  2HP0 A;  2QEX F;  1IV1 A;  3JAT A;  3HKB B;  3RA6 A;  3E22 A;  4O4H B;  1N8R H;  4O2A A;  3IR9 A;  4B62 A;  1W5E A;  5LOV B;  1R1M A;  2Z1U A;  3JAW B;  3OBW A;  3D00 A;  3OBY A;  2DT4 A;  1X52 A;  3P4E A;  2UYJ A;  3ON1 A;  1YIT F;  4IHJ A;  3IKF A;  2B33 A;  4O2B B;  5ITZ B;  2CVL A;  1NMU B;  4KWE A;  4NUT A;  3J80 M;  1KD1 H;  3ELC A;  1K9M H;  1VQ5 F;  3LDT A;  3CCV F;  4NWO B;  2QA4 F;  4U39 A;  3NK6 A;  1JFF A;  4G4X A;  5LP6 C;  3CXC F;  3F0E A;  3M84 A;  3LWQ C;  5EAZ A;  4EI8 A;  4ZHQ B;  3L7Q A;  5GIO C;  1M1K H;  3N2K B;  3CME F;  3LYB A;  2YXZ A;  3PAF A;  2HQS C;  3LWV C;  4X1Y A;  4IIJ A;  1QD9 A;  1NQ3 A;  3Q8H A;  3KHN A;  5J2U A;  3JAL A;  1M90 H;  3I7T A;  3I3F A;  5EIB C;  2DYY A;  5FNV A;  5C8Y A;  1XRG A;  4TV9 B;  3HAX D;  2L26 A;  5LA6 B;  5CB4 B;  5KMG A;  1COM A;  3HKC A;  1GZ0 A;  1XHO A;  1W2B F;  1CK2 A;  4X3L A;  3VCZ A;  4NQ3 A;  1TUB B;  3CCE F;  4B46 A;  1UFY A;  3HKE B;  1YQN A;  1SZQ A;  4C8G A;  5A2Q M;  1SA0 B;  3VYT C;  3D54 A;  2UYK A;  3JVH A;  3MDO A;  3CC2 F;  3NVI B;  1XV2 A;  4X3M A;  3QTY A;  2UYN B;  1YJN F;  5CA0 B;  5HP7 A;  5DCV A;  2AIF A;  3RYC A;  1RQ2 A;  1VQK F;  3CC4 F;  3BYQ A;  3JAW A;  3RYI B;  3I55 F;  3CYQ A;  4U3J B;  4F6R A;  1X7P A;  1YHQ F;  3VMF B;  1UI9 A;  4LNU B;  1CLI A;  3WJQ A;  5GON B;  5HY4 A;  4O4J B;  2AMT A;  3OW2 F;  3GYQ A;  4ZOL B;  2GLZ A;  3EOR A;  5EB1 B;  5GIP C;  1W5F A;  1YI2 F;  4O4L A;  3JAK A;  5G4V C;  3CCJ F;  4BT3 A;  1XBI A;  2MQE A;  2P6Y A;  3TD3 A;  1ODE A;  3ERN A;  3JAS A;  2HVY D;  3N2G B;  5IT9 M;  2G9I A;  3M1X A;  3N2K A;  1KNJ A;  3LME A;  3RYF B;  2IQQ A;  1T0A A;  1W59 A;  2LBX A;  5LYJ A;  4X20 A;  3U0O A;  4TUY B;  3NK7 A;  5JVD A;  2RHJ A;  2CHT A;  3V7Q A;  3E20 B;  1T0K B;  5KX5 B;  3WGK A;  3WGM A;  1H48 A;  3UT5 B;  3KIZ A;  3SIV A;  2LCA A;  2YYE A;  4I55 B;  5GAN K;  1U40 A;  1VQO F;  4ZHY B;  5BMV B;  1W58 1;  5MN5 A;  5EO3 A;  2KG4 A;  3QHD A;  1VQN F;  4HNA B;  3S0H A;  5LP6 A;  4EB6 A;  3I56 F;  2VXY A;  4BY9 D;  4EI9 A;  4ZI7 B;  3LWP C;  1VQ6 F;  2CZW A;  5EYP A;  4BT2 A;  3F0G A;  4I4T B;  2VGM A;  4B45 A;  1JJ2 F;  4BVS A;  1W55 A;  3LWO C;  1QVF F;  2CSL A;  3C8L A;  2OTJ F;  5CA1 A;  4YJ3 A;  1J7H A;  4O4I A;  4I50 A;  5EIB D;  3CCS F;  3M4S A;  3ZP4 A;  3FD6 A;  3C9T A;  4YJ2 B;  3ZOP A;  1QU9 A;  3CCR F;  3NMU C;  4DRX B;  3HKD B;  4TZZ A;  2AIZ P;  5HXU A;  1FFX A;  3CC7 F;  2RB9 A;  3JAR A;  4WBN B;  5MN4 A;  1VH8 A;  2LBT A;  1YIJ F;  2N48 A;  5IJ0 B;  3WJP A;  5IYZ A;  2VAW A;  3WXM B;  2Z1E A;  4TV8 A;  1SDS A;  1X25 A;  3RYH A;  5EZY B;  1TVK A;  3VOB A;  1FNK A;  3ESJ A;  1S72 F;  2ZF8 A;  5JH7 A;  1VQL F;  3HTN A;  3E1Y A;  5LXT B;  3NVK E;  4FFB B;  4BT5 A;  2HRU A;  2VAM A;  2BTO A;  3K12 A;  1VQ4 F;  2W8B C;  5IJ9 A;  4X1I B;  1VQ7 F;  2H6L A;  2I6D A;  3CYP B;  1JN1 A;  3V7E A;  2R6R 1;  1NJI H;  2I6R A;  3KE1 A;  4G4V A;  1PXW A;  2Q1X A;  1Q82 H;  2HRY A;  5J2T A;  4M8I A;  3N4Y A;  4ZK7 A;  2PHN A;  3VIU A;  3HKB A;  4O4H A;  2HP0 B;  4EI7 A;  3JAT B;  2RHH A;  3E22 B;  2BO1 A;  5LOV A;  4O2A B;  3VYS C;  1FSZ A;  3HJW C;  3WPW A;  1IV4 A;  4BT7 A;  4C4W C;  5FJ4 C;  1JY8 A;  4ZHV A;  5JCO A; 
#chains in the Genus database with same CATH homology
 2UYP A;  2B33 A;  1UFY A;  1QD9 A;  1NQ3 A;  2CVL A;  3ZO8 A;  3KJJ A;  2CHT A;  3R0P A;  1ONI A;  3I7T A;  1JD1 A;  3I3F A;  2EWC A;  3V4D A;  2UYK A;  2CSL A;  2DYY A;  1DBF A;  4NWO B;  2UYN A;  4ZK7 A;  3MQW A;  3K0T A;  1XRG A;  2UYN B;  5HP7 A;  1J7H A;  1ODE A;  2CHS A;  1X25 A;  3KJK A;  2CWJ A;  3M4S A;  3ZP4 A;  2OTM A;  1FNK A;  3D01 A;  3M1X A;  1QU9 A;  2CW4 A;  1COM A;  3ZOP A;  1PF5 A;  3LME A;  3L7Q A;  3ZP7 A;  3GTZ A;  1UI9 A;  1XHO A;  3QUW A;  2IG8 A;  1FNJ A;  3LYB A;  5HP8 A;  3VCZ A;  2UYJ A;  1QAH A;  3K12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...