3ZOPA

Arg90cit chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
116
Chain Sequence
b'MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 32
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zopA00
3I7TA 1PF5A 1QAHA 1COMA 2UYNB 2CHTA 3VCZA 2CHSA 1ONIA 1UI9A 2UYJA 2DYYA 2CWJA 4ZK7A 3QUWA 1QU9A 1X25A 1XHOA 3D01A 1UFYA 2UYPA 2EWCA 2B33A 4NWOB 1J7HA 3MQWA 3LMEA 3R0PA 2UYNA 5HP8A 1DBFA 1QD9A 3GTZA 3K12A 2CVLA 3L7QA 1NQ3A 3K0TA 2CW4A 1JD1A 2UYKA 3KJJA 3M1XA 3M4SA 3ZOPA 3ZP4A 3V4DA 3KJKA 5HP7A 3LYBA 2OTMA 3ZP7A 1ODEA 2CSLA 3I3FA 2IG8A 1XRGA 1FNKA 1FNJA 3ZO8A
chains in the Genus database with same CATH superfamily
3VMFB 3ERNA 2OTJF 2HS4A 3E1YA 4BT4A 2CZWA 1W59A 2ZVYA 5EYPA 4O4HB 3J80M 1Q8RA 1VQKF 4TV9A 5FJ4C 5J2TA 2N48A 4BVSA 3CD6F 1RA4A 1VQVA 1FFXA 1VQ9F 1QD9A 1NJIH 2RHJA 5J2UA 4YJ2A 3ZOPA 1QVGF 3V4DA 3JVHA 1W5FA 1W5BA 5FNVB 5LA6A 3WGNA 4FFBA 3ZP7A 1ODEA 4G4ZA 2AIFA 2ZODA 3B6NA 4O4IA 5EZYA 4I55A 3N2KB 2ZVZA 1W40A 1OAPA 3CC4F 2KTVA 1UI9A 3FBAA 2IQQA 1Q81H 3MBMA 3WJRA 3NK7A 3TD5A 1TVKA 1DBFA 2QTPA 3L7QA 4BW0B 1KQSF 5JVDB 1W55A 5HWEA 3RE3A 1Q7YH 3CB2A 4O4HA 1VK3A 4O4JB 2RHOA 3D54A 5IT9M 2HP0B 3UT5B 3VOBA 3WJPA 1FNKA 3HKBB 4C8EA 1N8RH 4BT6A 3QTYA 5EB0A 5JCOC 4IHJA 3NVKE 1W41A 5HY1A 4BVRA 3JATB 4G4VA 4G4XA 4G88A 1YITF 2F9ZC 3WGJA 5LYJB 2QEXF 3HTNA 1KD1H 5LXTA 3N2KA 5DCVA 2ZAUA 1YJNF 2H8CA 3S0HA 4NQ3A 4O4LB 2DT4A 2CSLA 4ZHQA 5G4VC 3CXCF 3ELCA 2Z1EA 2ALEA 3VCZA 3I55F 4I50B 1U43A 5JVDA 1ONIA 2Z1TA 5CB4A 3F6MA 5HY2A 2LBXA 2AMTA 2B33A 2HP0A 3S03A 4ZHWA 1S72F 1XBIA 3GTZA 1H48A 1IPAA 3KJJA 3M1XA 2PMPA 5IYZA 2UYKA 5MN4A 1X7PA 5MN5A 4IIJA 4BVTA 3J7AR 2HX0A 3CYPB 3JATA 3ESJA 3FD6A 2IAFA 5LYJA 1FFXB 1GX1A 5CA1B 1PF5A 3TD4A 2KG4A 3CCMF 4XCQA 3F0FA 2ZF8A 2UYJA 3IKEA 3SIVA 2DYYA 3KE1A 4TZZA 4O4LA 1X25A 3D01A 4B46A 3WGMA 5KX5A 3VOAA 2BTUA 4U3JA 5GIOC 3V7QA 2VGNA 4PWTA 1RQ2A 1W5AA 4I50A 3J81M 3IMPA 3P0ZA 5HY0A 3O85A 3LYBA 1VQ5F 4X20A 1FSZA 3JASB 2VAPA 4TV8A 3CMAF 5IJ0B 2QA4F 1YIJF 5JQGB 1IV3A 1YJWF 1VQNF 1U3LA 1ZWZA 3VI6A 2VGMA 3NMUC 5EWRA 4TUYB 3S0YA 3G4SF 1YI2F 5CA1A 4IHJB 3OBYA 3VYTC 5IJ9B 3AGKA 3WPWA 2YXZA 3HKCB 2R6R1 4X1KB 4C8GA 3SIUA 4BT3A 3EORA 3F0GA 3ON1A 1FNJA 3ZP4A 3CCEF 3C8LA 5KMGA 5LP6C 5LXTB 4EI7A 2L26A 3N4ZA 4RHAA 1SDSA 2YYEA 5GINC 4BVQA 2CWJA 4ZK7A 1XHOA 2FGYA 4ZHQB 1DT9A 3JASA 5HP8A 4M8IA 3M84A 4DRXA 3LWOC 3BYQA 5IJ0A 1JD1A 5JQGA 1M1KH 2QI2A 5CB4B 4LNUB 3CC2F 1T0AA 4TUYA 4C81A 1CN7A 3RYFB 2W8BC 1Q82H 1RQ7A 2NMUA 2RHLA 3LWRC 1KNKA 3RYCA 1K73H 2CHTA 3HKEB 1W581 1GO0A 5IYZB 5IJ9A 5HXUA 3HKCA 2BO1A 3MCAB 1JJ2F 4IIJB 3QUWA 4X1KA 4F6RB 3MQWA 3R0PA 2ZOVA 3MDOA 1Q86H 2KTUA 3LFOA 3CG6A 4B5CA 2Z01A 4KWEA 3FFMA 3CCUF 3OW2F 3JAKA 3NK6A 1VQOF 4X1YA 5KX5B 3VYSC 3N4YA 4U3JB 1X7OA 3JALB 4X3LA 5EB1B 1VQ4F 1U40A 1JFFB 2HP3A 4LNUA 2EWCA 2GLZA 4X20B 3IEWA 3RYFA 3G6EF 3F0EA 4TV8B 1VQPF 1M90H 3HKEA 4O2AB 1Z5WA 3C9TA 4YJ3B 2Z1UA 3FD5A 3N2GA 2RB9A 4O2BB 4F6RA 3KHNA 3P10A 1SZQA 1GO1A 1JN1A 4C4WC 2CHSA 4BT2A 1IV2A 3S06A 5ITZB 2HS3A 2R751 2VAMA 3CPWF 3G71F 2K1SA 4I4TB 1K8AH 3CCJF 3HKDB 1UFYA 3PAFA 5MN6A 1OFUA 5KMGB 2OZBA 2CVLA 3K0TA 3CC7F 3RYHB 5CA0B 3JALA 1R1MA 5FLXM 4X1IB 4EI8A 4U39A 3DDNA 1JFFA 3RA6A 2IG8A 5JCOA 3I3FA 1W5EA 1SA0A 3WJQA 2JNBA 2UZHA 4ZHVA 1RLGA 1X52A 4DRXB 4O2AA 3V3TA 4LCKA 1K9MH 4YJ3A 4ZI7B 1NMUB 1YHQF 2UYPA 3CPQA 2MQEA 4O2BA 3C9SA 1VHAA 2UYNA 3CCRF 1VQ6F 3RYCB 3E22B 3OONA 4ZHYB 2GVIA 5ITZA 5HP7A 1RLUA 4I4TA 3HKDA 1H7MA 4WBNB 3IR9A 3VO8A 5EAZA 1W3EX 3HAXD 1XV2A 3S02A 3RYHA 5CA0A 3CCSF 3CMEF 4X1IA 2HRYA 3JAKB 1CK2A 5EIBD 4X1YB 3CCQF 5GAPK 4ZOLB 2VAWA 5BMVA 1PXWA 3K12A 1T0KB 3RYIB 1E7KA 1NQ3A 5GIPC 3GHZA 3F0DA 1VQLF 1GZ0A 2LCAA 1VQ8F 4ERHA 3JAMM 3KJKA 1VH8A 3VIUA 4ZI7A 4HNAB 4BY9D 3WGKA 1XRGA 3ZO8A 3JARA 1TUBB 3E22A 2PHNA 3I56F 3Q8HA 4E6EA 3OBWA 2GZLA 3CYQA 2LBWA 3U0OA 2BTQB 3NVIB 5LP6B 1QVFF 1IV4A 3N2GB 4WBNA 1JY8A 2V9YA 5JH7B 4C8IA 3FPIA 3CCVF 4EB6B 4RQOA 3CCLF 3LWQC 2HQSC 3VYUC 4BT7A 3K14A 3WPXA 4C82A 4G4WA 1COMA 2H8EA 5EO3A 3IKFA 4EI9A 3LWVC 4ZOLA 3PLAC 3RYIA 2AIZP 5B8FA 1CLIA 5HY4A 4DXDA 5FNVA 3MCQA 5AVMA 1W57A 2VXYA 2OTLF 4HNAA 3C9UA 5LOVB 5EIBC 1SA0B 3LMEA 1H47A 3C9RA 2Z1FA 1TUBA 3JCMM 3E20B 2RHHA 1YJ9F 2HRUA 1VQMF 1YQNA 3WGLA 4R40B 3QHDA 5LP6A 3TD3A 3V7EA 2I6DA 3I7TA 2UYNB 3P4EA 5JH7A 2G9IA 3RA5A 4EB6A 5GONB 1KC8H 3LDTA 1YGYA 5G4UC 4O4JA 5GANK 5C8YB 2P6YA 3JAWB 3UT5A 2I6RA 1W42A 1U3PA 3HKBA 2H6LA 1J7HA 3GYQA 2FC3A 3LWPC 2HS0A 5A2QM 3S0WA 1VQ7F 2Q1XA 4NUTA 2KGWA 5EYPB 4G4YA 2BTOA 4TV9B 5J2TB 2OTMA 3K2XA 4B45A 3T80A 5LOVA 1QAHA 4X3MA 5BMVB 5J2UB 4YJ2B 2OHWA 3HJWC 5LA6B 4B62A 1W2BF 4FFBB 1QU9A 4BT5A 1IV1A 4NWOB 4O4IB 5EZYB 3DC2A 4I55B 2Q1YA 1Z5VA 2WALA 3JARB 5HXZA 2CW4A 3WXMB 5GONA 2HVYD 2LBTA 3IEQA 3HWUA 3KIZA 5C8YA 3VTIC 1TVKB 3D00A 3M4SA 3JAWA 1KNJA
chains in the Genus database with same CATH topology
3I7TA 1PF5A 1QAHA 1COMA 2UYNB 2CHTA 3VCZA 2CHSA 1ONIA 1UI9A 2UYJA 2DYYA 2CWJA 4ZK7A 3QUWA 1QU9A 1X25A 1XHOA 3D01A 1UFYA 2UYPA 2EWCA 2B33A 4NWOB 1J7HA 3MQWA 3LMEA 3R0PA 2UYNA 5HP8A 1DBFA 1QD9A 3GTZA 3K12A 2CVLA 3L7QA 1NQ3A 3K0TA 2CW4A 1JD1A 2UYKA 3KJJA 3M1XA 3M4SA 3ZOPA 3ZP4A 3V4DA 3KJKA 5HP7A 3LYBA 2OTMA 3ZP7A 1ODEA 2CSLA 3I3FA 2IG8A 1XRGA 1FNKA 1FNJA 3ZO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7T A;  1PF5 A;  1QAH A;  1COM A;  2UYN B;  2CHT A;  3VCZ A;  2CHS A;  1ONI A;  1UI9 A;  2UYJ A;  2DYY A;  2CWJ A;  4ZK7 A;  3QUW A;  1QU9 A;  1X25 A;  1XHO A;  3D01 A;  1UFY A;  2UYP A;  2EWC A;  2B33 A;  4NWO B;  1J7H A;  3MQW A;  3LME A;  3R0P A;  2UYN A;  5HP8 A;  1DBF A;  1QD9 A;  3GTZ A;  3K12 A;  2CVL A;  3L7Q A;  1NQ3 A;  3K0T A;  2CW4 A;  1JD1 A;  2UYK A;  3KJJ A;  3M1X A;  3M4S A;  3ZOP A;  3ZP4 A;  3V4D A;  3KJK A;  5HP7 A;  3LYB A;  2OTM A;  3ZP7 A;  1ODE A;  2CSL A;  3I3F A;  2IG8 A;  1XRG A;  1FNK A;  1FNJ A;  3ZO8 A; 
#chains in the Genus database with same CATH topology
 3VMF B;  3ERN A;  2OTJ F;  2HS4 A;  3E1Y A;  4BT4 A;  2CZW A;  1W59 A;  2ZVY A;  5EYP A;  4O4H B;  3J80 M;  1Q8R A;  1VQK F;  4TV9 A;  5FJ4 C;  5J2T A;  2N48 A;  4BVS A;  3CD6 F;  1RA4 A;  1VQV A;  1FFX A;  1VQ9 F;  1QD9 A;  1NJI H;  2RHJ A;  5J2U A;  4YJ2 A;  3ZOP A;  1QVG F;  3V4D A;  3JVH A;  1W5F A;  1W5B A;  5FNV B;  5LA6 A;  3WGN A;  4FFB A;  3ZP7 A;  1ODE A;  4G4Z A;  2AIF A;  2ZOD A;  3B6N A;  4O4I A;  5EZY A;  4I55 A;  3N2K B;  2ZVZ A;  1W40 A;  1OAP A;  3CC4 F;  2KTV A;  1UI9 A;  3FBA A;  2IQQ A;  1Q81 H;  3MBM A;  3WJR A;  3NK7 A;  3TD5 A;  1TVK A;  1DBF A;  2QTP A;  3L7Q A;  4BW0 B;  1KQS F;  5JVD B;  1W55 A;  5HWE A;  3RE3 A;  1Q7Y H;  3CB2 A;  4O4H A;  1VK3 A;  4O4J B;  2RHO A;  3D54 A;  5IT9 M;  2HP0 B;  3UT5 B;  3VOB A;  3WJP A;  1FNK A;  3HKB B;  4C8E A;  1N8R H;  4BT6 A;  3QTY A;  5EB0 A;  5JCO C;  4IHJ A;  3NVK E;  1W41 A;  5HY1 A;  4BVR A;  3JAT B;  4G4V A;  4G4X A;  4G88 A;  1YIT F;  2F9Z C;  3WGJ A;  5LYJ B;  2QEX F;  3HTN A;  1KD1 H;  5LXT A;  3N2K A;  5DCV A;  2ZAU A;  1YJN F;  2H8C A;  3S0H A;  4NQ3 A;  4O4L B;  2DT4 A;  2CSL A;  4ZHQ A;  5G4V C;  3CXC F;  3ELC A;  2Z1E A;  2ALE A;  3VCZ A;  3I55 F;  4I50 B;  1U43 A;  5JVD A;  1ONI A;  2Z1T A;  5CB4 A;  3F6M A;  5HY2 A;  2LBX A;  2AMT A;  2B33 A;  2HP0 A;  3S03 A;  4ZHW A;  1S72 F;  1XBI A;  3GTZ A;  1H48 A;  1IPA A;  3KJJ A;  3M1X A;  2PMP A;  5IYZ A;  2UYK A;  5MN4 A;  1X7P A;  5MN5 A;  4IIJ A;  4BVT A;  3J7A R;  2HX0 A;  3CYP B;  3JAT A;  3ESJ A;  3FD6 A;  2IAF A;  5LYJ A;  1FFX B;  1GX1 A;  5CA1 B;  1PF5 A;  3TD4 A;  2KG4 A;  3CCM F;  4XCQ A;  3F0F A;  2ZF8 A;  2UYJ A;  3IKE A;  3SIV A;  2DYY A;  3KE1 A;  4TZZ A;  4O4L A;  1X25 A;  3D01 A;  4B46 A;  3WGM A;  5KX5 A;  3VOA A;  2BTU A;  4U3J A;  5GIO C;  3V7Q A;  2VGN A;  4PWT A;  1RQ2 A;  1W5A A;  4I50 A;  3J81 M;  3IMP A;  3P0Z A;  5HY0 A;  3O85 A;  3LYB A;  1VQ5 F;  4X20 A;  1FSZ A;  3JAS B;  2VAP A;  4TV8 A;  3CMA F;  5IJ0 B;  2QA4 F;  1YIJ F;  5JQG B;  1IV3 A;  1YJW F;  1VQN F;  1U3L A;  1ZWZ A;  3VI6 A;  2VGM A;  3NMU C;  5EWR A;  4TUY B;  3S0Y A;  3G4S F;  1YI2 F;  5CA1 A;  4IHJ B;  3OBY A;  3VYT C;  5IJ9 B;  3AGK A;  3WPW A;  2YXZ A;  3HKC B;  2R6R 1;  4X1K B;  4C8G A;  3SIU A;  4BT3 A;  3EOR A;  3F0G A;  3ON1 A;  1FNJ A;  3ZP4 A;  3CCE F;  3C8L A;  5KMG A;  5LP6 C;  5LXT B;  4EI7 A;  2L26 A;  3N4Z A;  4RHA A;  1SDS A;  2YYE A;  5GIN C;  4BVQ A;  2CWJ A;  4ZK7 A;  1XHO A;  2FGY A;  4ZHQ B;  1DT9 A;  3JAS A;  5HP8 A;  4M8I A;  3M84 A;  4DRX A;  3LWO C;  3BYQ A;  5IJ0 A;  1JD1 A;  5JQG A;  1M1K H;  2QI2 A;  5CB4 B;  4LNU B;  3CC2 F;  1T0A A;  4TUY A;  4C81 A;  1CN7 A;  3RYF B;  2W8B C;  1Q82 H;  1RQ7 A;  2NMU A;  2RHL A;  3LWR C;  1KNK A;  3RYC A;  1K73 H;  2CHT A;  3HKE B;  1W58 1;  1GO0 A;  5IYZ B;  5IJ9 A;  5HXU A;  3HKC A;  2BO1 A;  3MCA B;  1JJ2 F;  4IIJ B;  3QUW A;  4X1K A;  4F6R B;  3MQW A;  3R0P A;  2ZOV A;  3MDO A;  1Q86 H;  2KTU A;  3LFO A;  3CG6 A;  4B5C A;  2Z01 A;  4KWE A;  3FFM A;  3CCU F;  3OW2 F;  3JAK A;  3NK6 A;  1VQO F;  4X1Y A;  5KX5 B;  3VYS C;  3N4Y A;  4U3J B;  1X7O A;  3JAL B;  4X3L A;  5EB1 B;  1VQ4 F;  1U40 A;  1JFF B;  2HP3 A;  4LNU A;  2EWC A;  2GLZ A;  4X20 B;  3IEW A;  3RYF A;  3G6E F;  3F0E A;  4TV8 B;  1VQP F;  1M90 H;  3HKE A;  4O2A B;  1Z5W A;  3C9T A;  4YJ3 B;  2Z1U A;  3FD5 A;  3N2G A;  2RB9 A;  4O2B B;  4F6R A;  3KHN A;  3P10 A;  1SZQ A;  1GO1 A;  1JN1 A;  4C4W C;  2CHS A;  4BT2 A;  1IV2 A;  3S06 A;  5ITZ B;  2HS3 A;  2R75 1;  2VAM A;  3CPW F;  3G71 F;  2K1S A;  4I4T B;  1K8A H;  3CCJ F;  3HKD B;  1UFY A;  3PAF A;  5MN6 A;  1OFU A;  5KMG B;  2OZB A;  2CVL A;  3K0T A;  3CC7 F;  3RYH B;  5CA0 B;  3JAL A;  1R1M A;  5FLX M;  4X1I B;  4EI8 A;  4U39 A;  3DDN A;  1JFF A;  3RA6 A;  2IG8 A;  5JCO A;  3I3F A;  1W5E A;  1SA0 A;  3WJQ A;  2JNB A;  2UZH A;  4ZHV A;  1RLG A;  1X52 A;  4DRX B;  4O2A A;  3V3T A;  4LCK A;  1K9M H;  4YJ3 A;  4ZI7 B;  1NMU B;  1YHQ F;  2UYP A;  3CPQ A;  2MQE A;  4O2B A;  3C9S A;  1VHA A;  2UYN A;  3CCR F;  1VQ6 F;  3RYC B;  3E22 B;  3OON A;  4ZHY B;  2GVI A;  5ITZ A;  5HP7 A;  1RLU A;  4I4T A;  3HKD A;  1H7M A;  4WBN B;  3IR9 A;  3VO8 A;  5EAZ A;  1W3E X;  3HAX D;  1XV2 A;  3S02 A;  3RYH A;  5CA0 A;  3CCS F;  3CME F;  4X1I A;  2HRY A;  3JAK B;  1CK2 A;  5EIB D;  4X1Y B;  3CCQ F;  5GAP K;  4ZOL B;  2VAW A;  5BMV A;  1PXW A;  3K12 A;  1T0K B;  3RYI B;  1E7K A;  1NQ3 A;  5GIP C;  3GHZ A;  3F0D A;  1VQL F;  1GZ0 A;  2LCA A;  1VQ8 F;  4ERH A;  3JAM M;  3KJK A;  1VH8 A;  3VIU A;  4ZI7 A;  4HNA B;  4BY9 D;  3WGK A;  1XRG A;  3ZO8 A;  3JAR A;  1TUB B;  3E22 A;  2PHN A;  3I56 F;  3Q8H A;  4E6E A;  3OBW A;  2GZL A;  3CYQ A;  2LBW A;  3U0O A;  2BTQ B;  3NVI B;  5LP6 B;  1QVF F;  1IV4 A;  3N2G B;  4WBN A;  1JY8 A;  2V9Y A;  5JH7 B;  4C8I A;  3FPI A;  3CCV F;  4EB6 B;  4RQO A;  3CCL F;  3LWQ C;  2HQS C;  3VYU C;  4BT7 A;  3K14 A;  3WPX A;  4C82 A;  4G4W A;  1COM A;  2H8E A;  5EO3 A;  3IKF A;  4EI9 A;  3LWV C;  4ZOL A;  3PLA C;  3RYI A;  2AIZ P;  5B8F A;  1CLI A;  5HY4 A;  4DXD A;  5FNV A;  3MCQ A;  5AVM A;  1W57 A;  2VXY A;  2OTL F;  4HNA A;  3C9U A;  5LOV B;  5EIB C;  1SA0 B;  3LME A;  1H47 A;  3C9R A;  2Z1F A;  1TUB A;  3JCM M;  3E20 B;  2RHH A;  1YJ9 F;  2HRU A;  1VQM F;  1YQN A;  3WGL A;  4R40 B;  3QHD A;  5LP6 A;  3TD3 A;  3V7E A;  2I6D A;  3I7T A;  2UYN B;  3P4E A;  5JH7 A;  2G9I A;  3RA5 A;  4EB6 A;  5GON B;  1KC8 H;  3LDT A;  1YGY A;  5G4U C;  4O4J A;  5GAN K;  5C8Y B;  2P6Y A;  3JAW B;  3UT5 A;  2I6R A;  1W42 A;  1U3P A;  3HKB A;  2H6L A;  1J7H A;  3GYQ A;  2FC3 A;  3LWP C;  2HS0 A;  5A2Q M;  3S0W A;  1VQ7 F;  2Q1X A;  4NUT A;  2KGW A;  5EYP B;  4G4Y A;  2BTO A;  4TV9 B;  5J2T B;  2OTM A;  3K2X A;  4B45 A;  3T80 A;  5LOV A;  1QAH A;  4X3M A;  5BMV B;  5J2U B;  4YJ2 B;  2OHW A;  3HJW C;  5LA6 B;  4B62 A;  1W2B F;  4FFB B;  1QU9 A;  4BT5 A;  1IV1 A;  4NWO B;  4O4I B;  5EZY B;  3DC2 A;  4I55 B;  2Q1Y A;  1Z5V A;  2WAL A;  3JAR B;  5HXZ A;  2CW4 A;  3WXM B;  5GON A;  2HVY D;  2LBT A;  3IEQ A;  3HWU A;  3KIZ A;  5C8Y A;  3VTI C;  1TVK B;  3D00 A;  3M4S A;  3JAW A;  1KNJ A; 
#chains in the Genus database with same CATH homology
 3I7T A;  1PF5 A;  1QAH A;  1COM A;  2UYN B;  2CHT A;  3VCZ A;  2CHS A;  1ONI A;  1UI9 A;  2UYJ A;  2DYY A;  2CWJ A;  4ZK7 A;  3QUW A;  1QU9 A;  1X25 A;  1XHO A;  3D01 A;  1UFY A;  2UYP A;  2EWC A;  2B33 A;  4NWO B;  1J7H A;  3MQW A;  3LME A;  3R0P A;  2UYN A;  5HP8 A;  1DBF A;  1QD9 A;  3GTZ A;  3K12 A;  2CVL A;  3L7Q A;  1NQ3 A;  3K0T A;  2CW4 A;  1JD1 A;  2UYK A;  3KJJ A;  3M1X A;  3M4S A;  3ZOP A;  3ZP4 A;  3V4D A;  3KJK A;  5HP7 A;  3LYB A;  2OTM A;  3ZP7 A;  1ODE A;  2CSL A;  3I3F A;  2IG8 A;  1XRG A;  1FNK A;  1FNJ A;  3ZO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...