3ZOPA

Arg90cit chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
116
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 32
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zopA00
3I3FA 1ONIA 3ZP4A 2UYNB 1ODEA 3VCZA 1XHOA 2UYKA 3R0PA 3K0TA 5HP7A 3MQWA 3V4DA 4ZK7A 2CHSA 2OTMA 2IG8A 3I7TA 1NQ3A 1QAHA 3L7QA 1FNKA 3LYBA 2CVLA 2UYNA 3D01A 3M1XA 1X25A 2B33A 1COMA 2CW4A 2DYYA 3ZP7A 2EWCA 1FNJA 1DBFA 1QD9A 2UYPA 3KJJA 1J7HA 2CWJA 1QU9A 1UFYA 1JD1A 5HP8A 3GTZA 3LMEA 1UI9A 3K12A 3KJKA 3M4SA 1PF5A 2CHTA 3ZO8A 3ZOPA 2UYJA 4NWOB 2CSLA 1XRGA 3QUWA
chains in the Genus database with same CATH superfamily
4BVTA 5IYZA 3TD4A 5HY4A 2GVIA 4C8EA 1XV2A 3IMPA 2UYKA 3FD5A 3K0TA 3WJRA 5LYJB 3JARB 5LP6C 3CPQA 4WBNA 1FNKA 4I4TB 1KNJA 3J7AR 1W3EX 3S06A 1X25A 5DCVA 4RQOA 3C9UA 3JAMM 4BT4A 2ZODA 1VH8A 3HJWC 3ELCA 1FFXA 3K12A 1TVKB 3KJKA 3TD5A 3F0FA 2V9YA 3N2GA 4IHJB 1VQVA 3FD6A 3FPIA 4M8IA 2QI2A 3JATA 2KTUA 5GONA 5LOVB 3N4ZA 1W581 4NUTA 4BT7A 3RYHA 1K73H 2OTJF 1TUBB 5EYPB 5C8YA 1S72F 2AIFA 2Z1FA 1W5AA 2RHJA 5HY1A 5B8FA 5ITZA 1FNJA 2VXYA 4PWTA 4C82A 5CA0B 3G71F 1YI2F 3G4SF 2LBXA 2NMUA 3JAWB 5GIOC 3LWVC 5CA1B 4BT5A 3MBMA 3F0GA 3E22B 5LA6B 3EORA 3KIZA 4O4IB 3OW2F 2HP0B 3F6MA 1VQOF 3WGLA 2RHHA 5GIPC 2F9ZC 3CYPB 4X1IB 3WGNA 3JVHA 5EIBD 5AVMA 4BT6A 2I6RA 2CW4A 5LYJA 2HRUA 3JARA 1NMUB 1DBFA 1IV4A 5IJ0B 2AMTA 5HY2A 1UFYA 5HXUA 2BTOA 3TD3A 4I4TA 1JY8A 5BMVB 2YXZA 5IT9M 3ZO8A 1KNKA 2OHWA 4I50B 1KQSF 3RYIB 2HS4A 1K8AH 4G4ZA 4KWEA 1X7OA 3SIUA 2WALA 2IAFA 1PXWA 1W41A 3OONA 3R0PA 1TVKA 1QVFF 4ZK7A 3U0OA 1KC8H 4FFBA 3J81M 4IHJA 4C8IA 5LOVA 3FFMA 2QA4F 4BVQA 2R6R1 3CD6F 3P4EA 3PAFA 1TUBA 3ERNA 5EYPA 1SDSA 3HKDA 1Q82H 2N48A 5LP6B 1PF5A 5FJ4C 2JNBA 5JVDB 3WJQA 2RHLA 1GO1A 4YJ3B 1K9MH 3VOBA 4BY9D 4DRXA 4NQ3A 1M1KH 5CA0A 2HRYA 3DC2A 3GHZA 3JAWA 3LFOA 3MCQA 4ZHWA 5HP7A 1E7KA 4LCKA 3V4DA 4RHAA 1M90H 3WGMA 3NK6A 3E22A 4G4XA 5LA6A 3UT5B 1U3LA 5GAPK 4O4IA 4B5CA 1W2BF 2HP0A 2FGYA 2LBWA 1YIJF 4TUYB 2ALEA 3T80A 4X1IA 5EAZA 4O2AB 4DXDA 4YJ2B 2W8BC 2KTVA 1VQMF 3QUWA 2KGWA 2HVYD 1VQ7F 5IJ0A 5JQGB 1ODEA 3D00A 3F0DA 2Z1TA 5BMVA 3RE3A 4B46A 3CPWF 3V7EA 4X3LA 1RA4A 4I50A 2UZHA 3RYIA 4EI7A 1W5FA 3OBWA 1IPAA 4XCQA 1RQ7A 3J80M 1Q86H 5KMGB 4LNUB 2EWCA 3CC2F 1VHAA 3I56F 2PHNA 2ZF8A 3IEWA 2BO1A 3WPWA 1XBIA 1KD1H 1T0AA 3HWUA 3S0YA 1CN7A 4G88A 3WPXA 5A2QM 5FNVB 3VMFB 4EI8A 5LP6A 5EWRA 2G9IA 5HY0A 5JVDA 3LWOC 4EI9A 1DT9A 1SA0B 4X1YB 1RQ2A 3S03A 4YJ3A 4ZHVA 5GANK 1YJWF 4TV9B 3CCEF 3JCMM 2DYYA 2UYPA 3RYCB 3E1YA 5J2TB 1JN1A 3JALB 3UT5A 5JCOA 3S0WA 1VQ4F 1H7MA 2VAPA 3VYUC 4R40B 4TUYA 3ESJA 2UYNB 3VCZA 3VO8A 3CCRF 1XHOA 4ZOLB 4YJ2A 2Q1XA 2Z1UA 1X52A 2CHSA 3G6EF 3CCQF 1Q8RA 3HAXD 2HQSC 4G4WA 1W55A 4ZHQB 3P0ZA 1JD1A 2HS0A 1T0KB 3F0EA 1UI9A 3OBYA 1YITF 2ZAUA 4LNUA 3P10A 3LWRC 1FSZA 2Z1EA 3Q8HA 2VAWA 4G4YA 3V7QA 4BVSA 4TZZA 1NQ3A 3M84A 2RB9A 1SZQA 2ZVYA 4IIJB 3C9TA 5GINC 3CCJF 3JAKB 1RLUA 3QTYA 4BT2A 3CCUF 4O2BB 3VI6A 3M1XA 1YGYA 4BT3A 5LXTB 1SA0A 5CB4B 4X1YA 4E6EA 1ZWZA 4TV9A 1GX1A 3C8LA 1VQNF 3FBAA 2CSLA 1W5BA 4O4JB 4O4HB 4B45A 3VIUA 1GO0A 1IV3A 3RYCA 5EB1B 2ZOVA 2QTPA 5J2TA 3CCSF 2H8EA 3RYFB 3JALA 2IQQA 3NK7A 1VQLF 2KG4A 4C8GA 5CA1A 5MN4A 3I7TA 3CG6A 3HKEB 2UYNA 5EZYB 1JFFB 4ZI7B 4ZOLA 3JATB 5GONB 1U3PA 3WXMB 2Z01A 1VQ6F 3K14A 1GZ0A 3GTZA 3RYHB 3WJPA 5C8YB 3PLAC 3C9RA 2FC3A 3CMEF 2CZWA 4ZHQA 2MQEA 1ONIA 3GYQA 1YHQF 1W59A 3CC4F 2I6DA 4X3MA 3V3TA 5MN5A 5G4UC 2OTMA 1U43A 5EO3A 1QAHA 3HKBB 4ERHA 3E20B 2VGMA 1COMA 3KJJA 1QD9A 3LWQC 1IV1A 5IJ9B 4U3JB 5J2UB 3RA5A 1N8RH 4IIJA 4BW0B 3JAKA 2P6YA 3D54A 3I55F 3ZOPA 4O2BA 2R751 3IR9A 2GZLA 4I55B 5LXTA 4X20B 5CB4A 3N2KB 4EB6B 1VQ8F 1W5EA 4O4HA 4O4JA 4HNAB 2OZBA 2CVLA 3S0HA 3D01A 1H47A 3JASB 3RYFA 3CMAF 5G4VC 2B33A 1NJIH 4C4WC 3HKCB 1QU9A 1YJ9F 5MN6A 2AIZP 3IKEA 3O85A 2H6LA 3HKEA 4B62A 5JCOC 1W40A 2CHTA 4FFBB 5EZYA 1JFFA 4ZI7A 4TV8B 3K2XA 3AGKA 3ZP4A 4F6RB 3N4YA 2BTUA 4O2AA 1U40A 5EIBC 2LCAA 3VOAA 2LBTA 1IV2A 5HXZA 3HKDB 2IG8A 3LYBA 1JJ2F 2GLZA 5JQGA 3IKFA 2ZVZA 5JH7B 4DRXB 1J7HA 1VQ5F 1RLGA 3HKBA 3HTNA 3VTIC 2OTLF 3VYSC 2H8CA 4U39A 3B6NA 1W42A 4C81A 5KMGA 2K1SA 5IJ9A 4U3JA 3CCMF 4X1KB 5J2UA 1OAPA 3CCVF 3CB2A 1OFUA 2BTQB 3C9SA 5FLXM 5KX5B 4I55A 1QVGF 2QEXF 4O4LB 4X20A 4BVRA 1Q7YH 3N2KA 2YYEA 3NMUC 4EB6A 5FNVA 5IYZB 3MCAB 2HP3A 4HNAA 5EB0A 1Z5WA 2PMPA 1CLIA 3WGKA 3JASA 3DDNA 1H48A 2HS3A 3WGJA 1XRGA 4WBNB 1VK3A 1YJNF 1YQNA 4G4VA 3HKCA 3LWPC 3NVKE 3RA6A 4TV8A 3L7QA 1Z5VA 1FFXB 2VGNA 5HWEA 4F6RA 3CXCF 3LDTA 3MDOA 3ZP7A 3N2GB 3CCLF 2CWJA 3IEQA 5HP8A 2VAMA 3ON1A 5JH7A 3I3FA 1CK2A 1W57A 4ZHYB 1X7PA 3KHNA 5ITZB 3S02A 3QHDA 1VQ9F 3MQWA 1VQPF 1Q81H 1R1MA 3SIVA 3NVIB 2L26A 2RHOA 4X1KA 3CC7F 3CYQA 3BYQA 5KX5A 2Q1YA 3LMEA 4O4LA 2DT4A 3M4SA 2UYJA 4NWOB 3KE1A 3VYTC 1VQKF 2HX0A
chains in the Genus database with same CATH topology
3I3FA 1ONIA 3ZP4A 2UYNB 1ODEA 3VCZA 1XHOA 2UYKA 3R0PA 3K0TA 5HP7A 3MQWA 3V4DA 4ZK7A 2CHSA 2OTMA 2IG8A 3I7TA 1NQ3A 1QAHA 3L7QA 1FNKA 3LYBA 2CVLA 2UYNA 3D01A 3M1XA 1X25A 2B33A 1COMA 2CW4A 2DYYA 3ZP7A 2EWCA 1FNJA 1DBFA 1QD9A 2UYPA 3KJJA 1J7HA 2CWJA 1QU9A 1UFYA 1JD1A 5HP8A 3GTZA 3LMEA 1UI9A 3K12A 3KJKA 3M4SA 1PF5A 2CHTA 3ZO8A 3ZOPA 2UYJA 4NWOB 2CSLA 1XRGA 3QUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3F A;  1ONI A;  3ZP4 A;  2UYN B;  1ODE A;  3VCZ A;  1XHO A;  2UYK A;  3R0P A;  3K0T A;  5HP7 A;  3MQW A;  3V4D A;  4ZK7 A;  2CHS A;  2OTM A;  2IG8 A;  3I7T A;  1NQ3 A;  1QAH A;  3L7Q A;  1FNK A;  3LYB A;  2CVL A;  2UYN A;  3D01 A;  3M1X A;  1X25 A;  2B33 A;  1COM A;  2CW4 A;  2DYY A;  3ZP7 A;  2EWC A;  1FNJ A;  1DBF A;  1QD9 A;  2UYP A;  3KJJ A;  1J7H A;  2CWJ A;  1QU9 A;  1UFY A;  1JD1 A;  5HP8 A;  3GTZ A;  3LME A;  1UI9 A;  3K12 A;  3KJK A;  3M4S A;  1PF5 A;  2CHT A;  3ZO8 A;  3ZOP A;  2UYJ A;  4NWO B;  2CSL A;  1XRG A;  3QUW A; 
#chains in the Genus database with same CATH topology
 4BVT A;  5IYZ A;  3TD4 A;  5HY4 A;  2GVI A;  4C8E A;  1XV2 A;  3IMP A;  2UYK A;  3FD5 A;  3K0T A;  3WJR A;  5LYJ B;  3JAR B;  5LP6 C;  3CPQ A;  4WBN A;  1FNK A;  4I4T B;  1KNJ A;  3J7A R;  1W3E X;  3S06 A;  1X25 A;  5DCV A;  4RQO A;  3C9U A;  3JAM M;  4BT4 A;  2ZOD A;  1VH8 A;  3HJW C;  3ELC A;  1FFX A;  3K12 A;  1TVK B;  3KJK A;  3TD5 A;  3F0F A;  2V9Y A;  3N2G A;  4IHJ B;  1VQV A;  3FD6 A;  3FPI A;  4M8I A;  2QI2 A;  3JAT A;  2KTU A;  5GON A;  5LOV B;  3N4Z A;  1W58 1;  4NUT A;  4BT7 A;  3RYH A;  1K73 H;  2OTJ F;  1TUB B;  5EYP B;  5C8Y A;  1S72 F;  2AIF A;  2Z1F A;  1W5A A;  2RHJ A;  5HY1 A;  5B8F A;  5ITZ A;  1FNJ A;  2VXY A;  4PWT A;  4C82 A;  5CA0 B;  3G71 F;  1YI2 F;  3G4S F;  2LBX A;  2NMU A;  3JAW B;  5GIO C;  3LWV C;  5CA1 B;  4BT5 A;  3MBM A;  3F0G A;  3E22 B;  5LA6 B;  3EOR A;  3KIZ A;  4O4I B;  3OW2 F;  2HP0 B;  3F6M A;  1VQO F;  3WGL A;  2RHH A;  5GIP C;  2F9Z C;  3CYP B;  4X1I B;  3WGN A;  3JVH A;  5EIB D;  5AVM A;  4BT6 A;  2I6R A;  2CW4 A;  5LYJ A;  2HRU A;  3JAR A;  1NMU B;  1DBF A;  1IV4 A;  5IJ0 B;  2AMT A;  5HY2 A;  1UFY A;  5HXU A;  2BTO A;  3TD3 A;  4I4T A;  1JY8 A;  5BMV B;  2YXZ A;  5IT9 M;  3ZO8 A;  1KNK A;  2OHW A;  4I50 B;  1KQS F;  3RYI B;  2HS4 A;  1K8A H;  4G4Z A;  4KWE A;  1X7O A;  3SIU A;  2WAL A;  2IAF A;  1PXW A;  1W41 A;  3OON A;  3R0P A;  1TVK A;  1QVF F;  4ZK7 A;  3U0O A;  1KC8 H;  4FFB A;  3J81 M;  4IHJ A;  4C8I A;  5LOV A;  3FFM A;  2QA4 F;  4BVQ A;  2R6R 1;  3CD6 F;  3P4E A;  3PAF A;  1TUB A;  3ERN A;  5EYP A;  1SDS A;  3HKD A;  1Q82 H;  2N48 A;  5LP6 B;  1PF5 A;  5FJ4 C;  2JNB A;  5JVD B;  3WJQ A;  2RHL A;  1GO1 A;  4YJ3 B;  1K9M H;  3VOB A;  4BY9 D;  4DRX A;  4NQ3 A;  1M1K H;  5CA0 A;  2HRY A;  3DC2 A;  3GHZ A;  3JAW A;  3LFO A;  3MCQ A;  4ZHW A;  5HP7 A;  1E7K A;  4LCK A;  3V4D A;  4RHA A;  1M90 H;  3WGM A;  3NK6 A;  3E22 A;  4G4X A;  5LA6 A;  3UT5 B;  1U3L A;  5GAP K;  4O4I A;  4B5C A;  1W2B F;  2HP0 A;  2FGY A;  2LBW A;  1YIJ F;  4TUY B;  2ALE A;  3T80 A;  4X1I A;  5EAZ A;  4O2A B;  4DXD A;  4YJ2 B;  2W8B C;  2KTV A;  1VQM F;  3QUW A;  2KGW A;  2HVY D;  1VQ7 F;  5IJ0 A;  5JQG B;  1ODE A;  3D00 A;  3F0D A;  2Z1T A;  5BMV A;  3RE3 A;  4B46 A;  3CPW F;  3V7E A;  4X3L A;  1RA4 A;  4I50 A;  2UZH A;  3RYI A;  4EI7 A;  1W5F A;  3OBW A;  1IPA A;  4XCQ A;  1RQ7 A;  3J80 M;  1Q86 H;  5KMG B;  4LNU B;  2EWC A;  3CC2 F;  1VHA A;  3I56 F;  2PHN A;  2ZF8 A;  3IEW A;  2BO1 A;  3WPW A;  1XBI A;  1KD1 H;  1T0A A;  3HWU A;  3S0Y A;  1CN7 A;  4G88 A;  3WPX A;  5A2Q M;  5FNV B;  3VMF B;  4EI8 A;  5LP6 A;  5EWR A;  2G9I A;  5HY0 A;  5JVD A;  3LWO C;  4EI9 A;  1DT9 A;  1SA0 B;  4X1Y B;  1RQ2 A;  3S03 A;  4YJ3 A;  4ZHV A;  5GAN K;  1YJW F;  4TV9 B;  3CCE F;  3JCM M;  2DYY A;  2UYP A;  3RYC B;  3E1Y A;  5J2T B;  1JN1 A;  3JAL B;  3UT5 A;  5JCO A;  3S0W A;  1VQ4 F;  1H7M A;  2VAP A;  3VYU C;  4R40 B;  4TUY A;  3ESJ A;  2UYN B;  3VCZ A;  3VO8 A;  3CCR F;  1XHO A;  4ZOL B;  4YJ2 A;  2Q1X A;  2Z1U A;  1X52 A;  2CHS A;  3G6E F;  3CCQ F;  1Q8R A;  3HAX D;  2HQS C;  4G4W A;  1W55 A;  4ZHQ B;  3P0Z A;  1JD1 A;  2HS0 A;  1T0K B;  3F0E A;  1UI9 A;  3OBY A;  1YIT F;  2ZAU A;  4LNU A;  3P10 A;  3LWR C;  1FSZ A;  2Z1E A;  3Q8H A;  2VAW A;  4G4Y A;  3V7Q A;  4BVS A;  4TZZ A;  1NQ3 A;  3M84 A;  2RB9 A;  1SZQ A;  2ZVY A;  4IIJ B;  3C9T A;  5GIN C;  3CCJ F;  3JAK B;  1RLU A;  3QTY A;  4BT2 A;  3CCU F;  4O2B B;  3VI6 A;  3M1X A;  1YGY A;  4BT3 A;  5LXT B;  1SA0 A;  5CB4 B;  4X1Y A;  4E6E A;  1ZWZ A;  4TV9 A;  1GX1 A;  3C8L A;  1VQN F;  3FBA A;  2CSL A;  1W5B A;  4O4J B;  4O4H B;  4B45 A;  3VIU A;  1GO0 A;  1IV3 A;  3RYC A;  5EB1 B;  2ZOV A;  2QTP A;  5J2T A;  3CCS F;  2H8E A;  3RYF B;  3JAL A;  2IQQ A;  3NK7 A;  1VQL F;  2KG4 A;  4C8G A;  5CA1 A;  5MN4 A;  3I7T A;  3CG6 A;  3HKE B;  2UYN A;  5EZY B;  1JFF B;  4ZI7 B;  4ZOL A;  3JAT B;  5GON B;  1U3P A;  3WXM B;  2Z01 A;  1VQ6 F;  3K14 A;  1GZ0 A;  3GTZ A;  3RYH B;  3WJP A;  5C8Y B;  3PLA C;  3C9R A;  2FC3 A;  3CME F;  2CZW A;  4ZHQ A;  2MQE A;  1ONI A;  3GYQ A;  1YHQ F;  1W59 A;  3CC4 F;  2I6D A;  4X3M A;  3V3T A;  5MN5 A;  5G4U C;  2OTM A;  1U43 A;  5EO3 A;  1QAH A;  3HKB B;  4ERH A;  3E20 B;  2VGM A;  1COM A;  3KJJ A;  1QD9 A;  3LWQ C;  1IV1 A;  5IJ9 B;  4U3J B;  5J2U B;  3RA5 A;  1N8R H;  4IIJ A;  4BW0 B;  3JAK A;  2P6Y A;  3D54 A;  3I55 F;  3ZOP A;  4O2B A;  2R75 1;  3IR9 A;  2GZL A;  4I55 B;  5LXT A;  4X20 B;  5CB4 A;  3N2K B;  4EB6 B;  1VQ8 F;  1W5E A;  4O4H A;  4O4J A;  4HNA B;  2OZB A;  2CVL A;  3S0H A;  3D01 A;  1H47 A;  3JAS B;  3RYF A;  3CMA F;  5G4V C;  2B33 A;  1NJI H;  4C4W C;  3HKC B;  1QU9 A;  1YJ9 F;  5MN6 A;  2AIZ P;  3IKE A;  3O85 A;  2H6L A;  3HKE A;  4B62 A;  5JCO C;  1W40 A;  2CHT A;  4FFB B;  5EZY A;  1JFF A;  4ZI7 A;  4TV8 B;  3K2X A;  3AGK A;  3ZP4 A;  4F6R B;  3N4Y A;  2BTU A;  4O2A A;  1U40 A;  5EIB C;  2LCA A;  3VOA A;  2LBT A;  1IV2 A;  5HXZ A;  3HKD B;  2IG8 A;  3LYB A;  1JJ2 F;  2GLZ A;  5JQG A;  3IKF A;  2ZVZ A;  5JH7 B;  4DRX B;  1J7H A;  1VQ5 F;  1RLG A;  3HKB A;  3HTN A;  3VTI C;  2OTL F;  3VYS C;  2H8C A;  4U39 A;  3B6N A;  1W42 A;  4C81 A;  5KMG A;  2K1S A;  5IJ9 A;  4U3J A;  3CCM F;  4X1K B;  5J2U A;  1OAP A;  3CCV F;  3CB2 A;  1OFU A;  2BTQ B;  3C9S A;  5FLX M;  5KX5 B;  4I55 A;  1QVG F;  2QEX F;  4O4L B;  4X20 A;  4BVR A;  1Q7Y H;  3N2K A;  2YYE A;  3NMU C;  4EB6 A;  5FNV A;  5IYZ B;  3MCA B;  2HP3 A;  4HNA A;  5EB0 A;  1Z5W A;  2PMP A;  1CLI A;  3WGK A;  3JAS A;  3DDN A;  1H48 A;  2HS3 A;  3WGJ A;  1XRG A;  4WBN B;  1VK3 A;  1YJN F;  1YQN A;  4G4V A;  3HKC A;  3LWP C;  3NVK E;  3RA6 A;  4TV8 A;  3L7Q A;  1Z5V A;  1FFX B;  2VGN A;  5HWE A;  4F6R A;  3CXC F;  3LDT A;  3MDO A;  3ZP7 A;  3N2G B;  3CCL F;  2CWJ A;  3IEQ A;  5HP8 A;  2VAM A;  3ON1 A;  5JH7 A;  3I3F A;  1CK2 A;  1W57 A;  4ZHY B;  1X7P A;  3KHN A;  5ITZ B;  3S02 A;  3QHD A;  1VQ9 F;  3MQW A;  1VQP F;  1Q81 H;  1R1M A;  3SIV A;  3NVI B;  2L26 A;  2RHO A;  4X1K A;  3CC7 F;  3CYQ A;  3BYQ A;  5KX5 A;  2Q1Y A;  3LME A;  4O4L A;  2DT4 A;  3M4S A;  2UYJ A;  4NWO B;  3KE1 A;  3VYT C;  1VQK F;  2HX0 A; 
#chains in the Genus database with same CATH homology
 3I3F A;  1ONI A;  3ZP4 A;  2UYN B;  1ODE A;  3VCZ A;  1XHO A;  2UYK A;  3R0P A;  3K0T A;  5HP7 A;  3MQW A;  3V4D A;  4ZK7 A;  2CHS A;  2OTM A;  2IG8 A;  3I7T A;  1NQ3 A;  1QAH A;  3L7Q A;  1FNK A;  3LYB A;  2CVL A;  2UYN A;  3D01 A;  3M1X A;  1X25 A;  2B33 A;  1COM A;  2CW4 A;  2DYY A;  3ZP7 A;  2EWC A;  1FNJ A;  1DBF A;  1QD9 A;  2UYP A;  3KJJ A;  1J7H A;  2CWJ A;  1QU9 A;  1UFY A;  1JD1 A;  5HP8 A;  3GTZ A;  3LME A;  1UI9 A;  3K12 A;  3KJK A;  3M4S A;  1PF5 A;  2CHT A;  3ZO8 A;  3ZOP A;  2UYJ A;  4NWO B;  2CSL A;  1XRG A;  3QUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...