3ZOPA

Arg90cit chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
116
Chain Sequence
b'MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIVMMTVQTDVPQEQIRHVYLEKAVVLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
molecule tags Isomerase
source organism Bacillus subtilis
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
total genus 32
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zopA00
4ZK7A 1J7HA 3I7TA 1DBFA 2UYKA 1ODEA 3KJKA 2OTMA 2CW4A 3GTZA 1NQ3A 1COMA 2CVLA 3KJJA 1PF5A 3R0PA 3VCZA 3M1XA 5HP7A 2UYNA 2EWCA 2B33A 5HP8A 2CWJA 2IG8A 2UYPA 3K0TA 3ZP7A 3ZO8A 2DYYA 3LMEA 3M4SA 1XRGA 1QAHA 3MQWA 3K12A 2CHSA 2CSLA 1UI9A 3D01A 3V4DA 1JD1A 1XHOA 2CHTA 3ZOPA 1FNKA 3I3FA 1X25A 3LYBA 3L7QA 1ONIA 2UYJA 4NWOB 3QUWA 1UFYA 1QD9A 3ZP4A 1FNJA 2UYNB 1QU9A
chains in the Genus database with same CATH superfamily
5IJ0B 3BYQA 4M8IA 2LCAA 4I4TB 1OFUA 3MDOA 3ELCA 1DT9A 3GTZA 3NVIB 2Z1UA 3R0PA 3P10A 4O4HB 4RHAA 3SIUA 4YJ3A 1YGYA 4IHJB 3CCEF 1VK3A 1XRGA 3VYTC 3VIUA 3DC2A 3HKCA 4TV9A 2CHTA 3I3FA 1U3PA 3CYPB 2GVIA 3WPXA 2BTUA 4ZI7B 1Q81H 1N8RH 2H8EA 1CLIA 5EZYA 5JCOC 4NUTA 1Z5VA 3G71F 1XBIA 3WGJA 3KIZA 1TVKB 1NQ3A 5LOVA 5EYPA 4BT2A 1VQ9F 3ERNA 4XCQA 2HP0A 4TUYA 4ZI7A 2IAFA 3U0OA 5EB0A 4BT4A 1NMUB 1Z5WA 1U40A 3LMEA 3JCMM 2QA4F 2BTOA 1JFFA 2DT4A 4WBNB 4C82A 3LWVC 1IPAA 3JVHA 5KMGB 1FFXB 1GO0A 1E7KA 3LDTA 4X1IB 1VQVA 2PHNA 1YHQF 1ZWZA 4O4HA 1QU9A 1X52A 5CA1A 2ZVYA 3PLAC 4BVTA 2Z1TA 1H7MA 4BY9D 3LWRC 3KJJA 1PF5A 3M1XA 3JAKB 1W5AA 3VYSC 5MN4A 3K2XA 2CWJA 1VQ5F 3LWPC 2OTJF 2QTPA 4EB6B 5CA0B 3UT5B 1GZ0A 3Q8HA 5ITZA 3D01A 2CZWA 4I55B 5LA6B 3MCAB 1U3LA 3OBWA 3VOBA 3FFMA 1X25A 3N2KA 3HKDB 4G4XA 4O4IA 1ONIA 5JCOA 4NWOB 4F6RB 5GANK 3IKEA 3RYHA 2ZF8A 5IJ9B 3N2KB 1RLGA 4LCKA 2NMUA 4B5CA 1VQMF 3NVKE 1Q7YH 2I6DA 2Z1EA 4ZHWA 3IKFA 3KHNA 1VQ8F 2IG8A 4EI7A 2ZVZA 3M4SA 2Z1FA 3RYFB 3C9TA 5JH7B 1Q8RA 1S72F 4O4JA 3S03A 1FNKA 3E22B 1RA4A 1FSZA 4C8EA 3KE1A 4FFBB 3WXMB 4ZK7A 3I56F 3M84A 4HNAA 5J2UB 1X7OA 2Q1YA 4TV8B 2OTLF 5MN6A 5CB4A 3CC7F 1JY8A 1TVKA 2WALA 3NMUC 3OW2F 5J2TA 4WBNA 5JQGA 2B33A 1K9MH 5G4VC 2DYYA 3F0EA 3RE3A 3K14A 4TUYB 1UI9A 2IQQA 5LOVB 3IR9A 3RYFA 1YIJF 3I55F 1Q82H 2LBWA 2Q1XA 2V9YA 3CB2A 3VOAA 3N4ZA 5GIPC 3JAWA 4G88A 2YYEA 3GHZA 3CCLF 2Z01A 2HS4A 3TD3A 4X20B 2HS0A 1YJNF 3CCVF 4PWTA 4ZOLB 2OHWA 1JN1A 1PXWA 1VQOF 3S02A 2HP3A 2YXZA 1K73H 2K1SA 5JVDA 4G4YA 1YJ9F 3UT5A 4ZHQB 4BT6A 5HXZA 1RQ7A 1YQNA 2F9ZC 4RQOA 5HY1A 2FGYA 5C8YA 4E6EA 2HQSC 4ERHA 1OAPA 1YITF 2RHOA 3VI6A 4C8IA 2GLZA 1SZQA 3CMAF 3CG6A 1W42A 1VQPF 2R751 1VQ6F 5A2QM 3IMPA 4U3JA 1K8AH 3CCJF 1XHOA 5KMGA 3JALA 3LYBA 2L26A 1R1MA 3WGLA 3N4YA 3ON1A 2RHHA 3WJRA 3HWUA 5JVDB 5LP6A 4LNUA 1M1KH 4G4ZA 3V3TA 5B8FA 2QEXF 5FLXM 3VMFB 5KX5B 2UYNA 4R40B 1GO1A 2H6LA 1RQ2A 5EZYB 2ZOVA 5FNVA 3VO8A 1W5EA 1QAHA 3HKEB 3CD6F 3LWQC 3N2GB 5BMVB 3JATA 1JD1A 3WJQA 1CN7A 1H48A 2VGMA 3P4EA 4X1KB 1W5FA 2G9IA 1FNJA 2ALEA 1W41A 5MN5A 4O2AB 3I7TA 2I6RA 3WJPA 3KJKA 3QTYA 2VGNA 4LNUB 2CVLA 3CCSF 2AMTA 3VCZA 4BT3A 2LBXA 5JQGB 1KNKA 4O2BB 1XV2A 5IJ0A 3EORA 2KTUA 3RYCA 3RYIA 1TUBA 3DDNA 1T0AA 5LYJA 4HNAB 5J2UA 2KTVA 3CXCF 3OONA 2GZLA 3CYQA 3E1YA 3HKBA 2HRYA 4G4VA 2UZHA 4EI9A 1DBFA 5IT9M 4U3JB 3MBMA 5DCVA 2CW4A 5JH7A 3IEQA 5IYZB 3C8LA 3V7QA 1M90H 4X1YB 1YJWF 3HKBB 4ZHQA 2HRUA 3CPQA 2MQEA 3JASA 4BVRA 3LWOC 1YI2F 3HAXD 1RLUA 1GX1A 1SA0B 1W55A 4ZOLA 4EI8A 3F0GA 5GIOC 3HJWC 4X20A 4ZHYB 1UFYA 3JAMM 4O4IB 4F6RA 3VTIC 4O4LB 2UYKA 5EWRA 4I55A 3RA5A 4B62A 3S0HA 3WGKA 1IV1A 1KQSF 3CCUF 4X1KA 5AVMA 3RYCB 4I50B 5EAZA 3JAKA 2VAMA 3C9UA 2QI2A 5EB1B 1T0KB 3CPWF 3CC2F 1VQ7F 3FBAA 2CSLA 4C8GA 2H8CA 3S0WA 4IIJA 4NQ3A 4IIJB 3JARA 2PMPA 1W2BF 2VAWA 2ZAUA 1QD9A 2JNBA 3J81M 3ZP4A 2UYNB 2RHJA 1X7PA 4DRXB 5LXTA 2OTMA 1JJ2F 3C9SA 5HY0A 3T80A 1COMA 4TV8A 2KG4A 1VQLF 2LBTA 5BMVA 3N2GA 3J7AR 3O85A 4BVQA 5LP6C 5FJ4C 4BW0B 5J2TB 2UYPA 3ZO8A 4I50A 2AIZP 2BTQB 5EYPB 3K12A 1VH8A 1QVGF 1NJIH 3V4DA 1IV3A 5EIBD 2BO1A 3QHDA 3ZOPA 1W40A 2UYJA 5GINC 3CCMF 4FFBA 5G4UC 5LP6B 3E22A 4O4LA 3TD4A 4ZHVA 2W8BC 5C8YB 4IHJA 1SA0A 2ZODA 4YJ3B 3C9RA 3CMEF 3P0ZA 3NK7A 1IV4A 2HS3A 5IJ9A 5ITZB 2P6YA 4TZZA 5LYJB 4X1YA 3TD5A 3E20B 2RHLA 1W59A 4C81A 1U43A 3B6NA 3HKDA 2OZBA 1W581 1KD1H 5LA6A 3F6MA 4BT5A 5HY2A 4YJ2B 4B45A 3CC4F 5CA0A 4EB6A 3CCQF 1VQ4F 3FPIA 3CCRF 1VHAA 3F0FA 3FD5A 2FC3A 4DRXA 4X1IA 5LXTB 2KGWA 3G4SF 3GYQA 4O2AA 3ZP7A 1VQNF 4U39A 4O2BA 1FFXA 3F0DA 1JFFB 3JARB 3WGMA 3JATB 5CA1B 1SDSA 3J80M 2HX0A 3L7QA 3WPWA 3D00A 5GONB 3JAWB 3QUWA 2HP0B 1ODEA 5FNVB 2HVYD 1J7HA 3VYUC 3SIVA 3ESJA 3AGKA 5EIBC 5CB4B 5KX5A 3S0YA 4C4WC 3PAFA 1IV2A 3HKEA 3S06A 5HP8A 3OBYA 2VXYA 3IEWA 2AIFA 2CHSA 3JALB 5HY4A 4BT7A 1W57A 3HTNA 3G6EF 5GAPK 1W3EX 1W5BA 1Q86H 1KC8H 5GONA 3JASB 4DXDA 2VAPA 3V7EA 4X3LA 3MCQA 4TV9B 1VQKF 3HKCB 3D54A 3NK6A 3RYHB 5IYZA 2RB9A 4I4TA 4O4JB 5HP7A 1QVFF 1KNJA 2EWCA 3K0TA 4X3MA 5HXUA 4YJ2A 3MQWA 4G4WA 3RA6A 3LFOA 3FD6A 4KWEA 1H47A 4B46A 2N48A 1TUBB 3RYIB 4BVSA 5EO3A 3WGNA 5HWEA 2R6R1 1CK2A
chains in the Genus database with same CATH topology
4ZK7A 1J7HA 3I7TA 1DBFA 2UYKA 1ODEA 3KJKA 2OTMA 2CW4A 3GTZA 1NQ3A 1COMA 2CVLA 3KJJA 1PF5A 3R0PA 3VCZA 3M1XA 5HP7A 2UYNA 2EWCA 2B33A 5HP8A 2CWJA 2IG8A 2UYPA 3K0TA 3ZP7A 3ZO8A 2DYYA 3LMEA 3M4SA 1XRGA 1QAHA 3MQWA 3K12A 2CHSA 2CSLA 1UI9A 3D01A 3V4DA 1JD1A 1XHOA 2CHTA 3ZOPA 1FNKA 3I3FA 1X25A 3LYBA 3L7QA 1ONIA 2UYJA 4NWOB 3QUWA 1UFYA 1QD9A 3ZP4A 1FNJA 2UYNB 1QU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK7 A;  1J7H A;  3I7T A;  1DBF A;  2UYK A;  1ODE A;  3KJK A;  2OTM A;  2CW4 A;  3GTZ A;  1NQ3 A;  1COM A;  2CVL A;  3KJJ A;  1PF5 A;  3R0P A;  3VCZ A;  3M1X A;  5HP7 A;  2UYN A;  2EWC A;  2B33 A;  5HP8 A;  2CWJ A;  2IG8 A;  2UYP A;  3K0T A;  3ZP7 A;  3ZO8 A;  2DYY A;  3LME A;  3M4S A;  1XRG A;  1QAH A;  3MQW A;  3K12 A;  2CHS A;  2CSL A;  1UI9 A;  3D01 A;  3V4D A;  1JD1 A;  1XHO A;  2CHT A;  3ZOP A;  1FNK A;  3I3F A;  1X25 A;  3LYB A;  3L7Q A;  1ONI A;  2UYJ A;  4NWO B;  3QUW A;  1UFY A;  1QD9 A;  3ZP4 A;  1FNJ A;  2UYN B;  1QU9 A; 
#chains in the Genus database with same CATH topology
 5IJ0 B;  3BYQ A;  4M8I A;  2LCA A;  4I4T B;  1OFU A;  3MDO A;  3ELC A;  1DT9 A;  3GTZ A;  3NVI B;  2Z1U A;  3R0P A;  3P10 A;  4O4H B;  4RHA A;  3SIU A;  4YJ3 A;  1YGY A;  4IHJ B;  3CCE F;  1VK3 A;  1XRG A;  3VYT C;  3VIU A;  3DC2 A;  3HKC A;  4TV9 A;  2CHT A;  3I3F A;  1U3P A;  3CYP B;  2GVI A;  3WPX A;  2BTU A;  4ZI7 B;  1Q81 H;  1N8R H;  2H8E A;  1CLI A;  5EZY A;  5JCO C;  4NUT A;  1Z5V A;  3G71 F;  1XBI A;  3WGJ A;  3KIZ A;  1TVK B;  1NQ3 A;  5LOV A;  5EYP A;  4BT2 A;  1VQ9 F;  3ERN A;  4XCQ A;  2HP0 A;  4TUY A;  4ZI7 A;  2IAF A;  3U0O A;  5EB0 A;  4BT4 A;  1NMU B;  1Z5W A;  1U40 A;  3LME A;  3JCM M;  2QA4 F;  2BTO A;  1JFF A;  2DT4 A;  4WBN B;  4C82 A;  3LWV C;  1IPA A;  3JVH A;  5KMG B;  1FFX B;  1GO0 A;  1E7K A;  3LDT A;  4X1I B;  1VQV A;  2PHN A;  1YHQ F;  1ZWZ A;  4O4H A;  1QU9 A;  1X52 A;  5CA1 A;  2ZVY A;  3PLA C;  4BVT A;  2Z1T A;  1H7M A;  4BY9 D;  3LWR C;  3KJJ A;  1PF5 A;  3M1X A;  3JAK B;  1W5A A;  3VYS C;  5MN4 A;  3K2X A;  2CWJ A;  1VQ5 F;  3LWP C;  2OTJ F;  2QTP A;  4EB6 B;  5CA0 B;  3UT5 B;  1GZ0 A;  3Q8H A;  5ITZ A;  3D01 A;  2CZW A;  4I55 B;  5LA6 B;  3MCA B;  1U3L A;  3OBW A;  3VOB A;  3FFM A;  1X25 A;  3N2K A;  3HKD B;  4G4X A;  4O4I A;  1ONI A;  5JCO A;  4NWO B;  4F6R B;  5GAN K;  3IKE A;  3RYH A;  2ZF8 A;  5IJ9 B;  3N2K B;  1RLG A;  4LCK A;  2NMU A;  4B5C A;  1VQM F;  3NVK E;  1Q7Y H;  2I6D A;  2Z1E A;  4ZHW A;  3IKF A;  3KHN A;  1VQ8 F;  2IG8 A;  4EI7 A;  2ZVZ A;  3M4S A;  2Z1F A;  3RYF B;  3C9T A;  5JH7 B;  1Q8R A;  1S72 F;  4O4J A;  3S03 A;  1FNK A;  3E22 B;  1RA4 A;  1FSZ A;  4C8E A;  3KE1 A;  4FFB B;  3WXM B;  4ZK7 A;  3I56 F;  3M84 A;  4HNA A;  5J2U B;  1X7O A;  2Q1Y A;  4TV8 B;  2OTL F;  5MN6 A;  5CB4 A;  3CC7 F;  1JY8 A;  1TVK A;  2WAL A;  3NMU C;  3OW2 F;  5J2T A;  4WBN A;  5JQG A;  2B33 A;  1K9M H;  5G4V C;  2DYY A;  3F0E A;  3RE3 A;  3K14 A;  4TUY B;  1UI9 A;  2IQQ A;  5LOV B;  3IR9 A;  3RYF A;  1YIJ F;  3I55 F;  1Q82 H;  2LBW A;  2Q1X A;  2V9Y A;  3CB2 A;  3VOA A;  3N4Z A;  5GIP C;  3JAW A;  4G88 A;  2YYE A;  3GHZ A;  3CCL F;  2Z01 A;  2HS4 A;  3TD3 A;  4X20 B;  2HS0 A;  1YJN F;  3CCV F;  4PWT A;  4ZOL B;  2OHW A;  1JN1 A;  1PXW A;  1VQO F;  3S02 A;  2HP3 A;  2YXZ A;  1K73 H;  2K1S A;  5JVD A;  4G4Y A;  1YJ9 F;  3UT5 A;  4ZHQ B;  4BT6 A;  5HXZ A;  1RQ7 A;  1YQN A;  2F9Z C;  4RQO A;  5HY1 A;  2FGY A;  5C8Y A;  4E6E A;  2HQS C;  4ERH A;  1OAP A;  1YIT F;  2RHO A;  3VI6 A;  4C8I A;  2GLZ A;  1SZQ A;  3CMA F;  3CG6 A;  1W42 A;  1VQP F;  2R75 1;  1VQ6 F;  5A2Q M;  3IMP A;  4U3J A;  1K8A H;  3CCJ F;  1XHO A;  5KMG A;  3JAL A;  3LYB A;  2L26 A;  1R1M A;  3WGL A;  3N4Y A;  3ON1 A;  2RHH A;  3WJR A;  3HWU A;  5JVD B;  5LP6 A;  4LNU A;  1M1K H;  4G4Z A;  3V3T A;  5B8F A;  2QEX F;  5FLX M;  3VMF B;  5KX5 B;  2UYN A;  4R40 B;  1GO1 A;  2H6L A;  1RQ2 A;  5EZY B;  2ZOV A;  5FNV A;  3VO8 A;  1W5E A;  1QAH A;  3HKE B;  3CD6 F;  3LWQ C;  3N2G B;  5BMV B;  3JAT A;  1JD1 A;  3WJQ A;  1CN7 A;  1H48 A;  2VGM A;  3P4E A;  4X1K B;  1W5F A;  2G9I A;  1FNJ A;  2ALE A;  1W41 A;  5MN5 A;  4O2A B;  3I7T A;  2I6R A;  3WJP A;  3KJK A;  3QTY A;  2VGN A;  4LNU B;  2CVL A;  3CCS F;  2AMT A;  3VCZ A;  4BT3 A;  2LBX A;  5JQG B;  1KNK A;  4O2B B;  1XV2 A;  5IJ0 A;  3EOR A;  2KTU A;  3RYC A;  3RYI A;  1TUB A;  3DDN A;  1T0A A;  5LYJ A;  4HNA B;  5J2U A;  2KTV A;  3CXC F;  3OON A;  2GZL A;  3CYQ A;  3E1Y A;  3HKB A;  2HRY A;  4G4V A;  2UZH A;  4EI9 A;  1DBF A;  5IT9 M;  4U3J B;  3MBM A;  5DCV A;  2CW4 A;  5JH7 A;  3IEQ A;  5IYZ B;  3C8L A;  3V7Q A;  1M90 H;  4X1Y B;  1YJW F;  3HKB B;  4ZHQ A;  2HRU A;  3CPQ A;  2MQE A;  3JAS A;  4BVR A;  3LWO C;  1YI2 F;  3HAX D;  1RLU A;  1GX1 A;  1SA0 B;  1W55 A;  4ZOL A;  4EI8 A;  3F0G A;  5GIO C;  3HJW C;  4X20 A;  4ZHY B;  1UFY A;  3JAM M;  4O4I B;  4F6R A;  3VTI C;  4O4L B;  2UYK A;  5EWR A;  4I55 A;  3RA5 A;  4B62 A;  3S0H A;  3WGK A;  1IV1 A;  1KQS F;  3CCU F;  4X1K A;  5AVM A;  3RYC B;  4I50 B;  5EAZ A;  3JAK A;  2VAM A;  3C9U A;  2QI2 A;  5EB1 B;  1T0K B;  3CPW F;  3CC2 F;  1VQ7 F;  3FBA A;  2CSL A;  4C8G A;  2H8C A;  3S0W A;  4IIJ A;  4NQ3 A;  4IIJ B;  3JAR A;  2PMP A;  1W2B F;  2VAW A;  2ZAU A;  1QD9 A;  2JNB A;  3J81 M;  3ZP4 A;  2UYN B;  2RHJ A;  1X7P A;  4DRX B;  5LXT A;  2OTM A;  1JJ2 F;  3C9S A;  5HY0 A;  3T80 A;  1COM A;  4TV8 A;  2KG4 A;  1VQL F;  2LBT A;  5BMV A;  3N2G A;  3J7A R;  3O85 A;  4BVQ A;  5LP6 C;  5FJ4 C;  4BW0 B;  5J2T B;  2UYP A;  3ZO8 A;  4I50 A;  2AIZ P;  2BTQ B;  5EYP B;  3K12 A;  1VH8 A;  1QVG F;  1NJI H;  3V4D A;  1IV3 A;  5EIB D;  2BO1 A;  3QHD A;  3ZOP A;  1W40 A;  2UYJ A;  5GIN C;  3CCM F;  4FFB A;  5G4U C;  5LP6 B;  3E22 A;  4O4L A;  3TD4 A;  4ZHV A;  2W8B C;  5C8Y B;  4IHJ A;  1SA0 A;  2ZOD A;  4YJ3 B;  3C9R A;  3CME F;  3P0Z A;  3NK7 A;  1IV4 A;  2HS3 A;  5IJ9 A;  5ITZ B;  2P6Y A;  4TZZ A;  5LYJ B;  4X1Y A;  3TD5 A;  3E20 B;  2RHL A;  1W59 A;  4C81 A;  1U43 A;  3B6N A;  3HKD A;  2OZB A;  1W58 1;  1KD1 H;  5LA6 A;  3F6M A;  4BT5 A;  5HY2 A;  4YJ2 B;  4B45 A;  3CC4 F;  5CA0 A;  4EB6 A;  3CCQ F;  1VQ4 F;  3FPI A;  3CCR F;  1VHA A;  3F0F A;  3FD5 A;  2FC3 A;  4DRX A;  4X1I A;  5LXT B;  2KGW A;  3G4S F;  3GYQ A;  4O2A A;  3ZP7 A;  1VQN F;  4U39 A;  4O2B A;  1FFX A;  3F0D A;  1JFF B;  3JAR B;  3WGM A;  3JAT B;  5CA1 B;  1SDS A;  3J80 M;  2HX0 A;  3L7Q A;  3WPW A;  3D00 A;  5GON B;  3JAW B;  3QUW A;  2HP0 B;  1ODE A;  5FNV B;  2HVY D;  1J7H A;  3VYU C;  3SIV A;  3ESJ A;  3AGK A;  5EIB C;  5CB4 B;  5KX5 A;  3S0Y A;  4C4W C;  3PAF A;  1IV2 A;  3HKE A;  3S06 A;  5HP8 A;  3OBY A;  2VXY A;  3IEW A;  2AIF A;  2CHS A;  3JAL B;  5HY4 A;  4BT7 A;  1W57 A;  3HTN A;  3G6E F;  5GAP K;  1W3E X;  1W5B A;  1Q86 H;  1KC8 H;  5GON A;  3JAS B;  4DXD A;  2VAP A;  3V7E A;  4X3L A;  3MCQ A;  4TV9 B;  1VQK F;  3HKC B;  3D54 A;  3NK6 A;  3RYH B;  5IYZ A;  2RB9 A;  4I4T A;  4O4J B;  5HP7 A;  1QVF F;  1KNJ A;  2EWC A;  3K0T A;  4X3M A;  5HXU A;  4YJ2 A;  3MQW A;  4G4W A;  3RA6 A;  3LFO A;  3FD6 A;  4KWE A;  1H47 A;  4B46 A;  2N48 A;  1TUB B;  3RYI B;  4BVS A;  5EO3 A;  3WGN A;  5HWE A;  2R6R 1;  1CK2 A; 
#chains in the Genus database with same CATH homology
 4ZK7 A;  1J7H A;  3I7T A;  1DBF A;  2UYK A;  1ODE A;  3KJK A;  2OTM A;  2CW4 A;  3GTZ A;  1NQ3 A;  1COM A;  2CVL A;  3KJJ A;  1PF5 A;  3R0P A;  3VCZ A;  3M1X A;  5HP7 A;  2UYN A;  2EWC A;  2B33 A;  5HP8 A;  2CWJ A;  2IG8 A;  2UYP A;  3K0T A;  3ZP7 A;  3ZO8 A;  2DYY A;  3LME A;  3M4S A;  1XRG A;  1QAH A;  3MQW A;  3K12 A;  2CHS A;  2CSL A;  1UI9 A;  3D01 A;  3V4D A;  1JD1 A;  1XHO A;  2CHT A;  3ZOP A;  1FNK A;  3I3F A;  1X25 A;  3LYB A;  3L7Q A;  1ONI A;  2UYJ A;  4NWO B;  3QUW A;  1UFY A;  1QD9 A;  3ZP4 A;  1FNJ A;  2UYN B;  1QU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...