2B33A

Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
MKRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords protein synthesis inhibitor, putative
publication title Crystal structure of Protein synthesis inhibitor, putative (tm0215) from THERMOTOGA MARITIMA at 2.30 A resolution
rcsb
source organism Thermotoga maritima
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2b33A00
2EWCA 3LYBA 3ZP7A 1QU9A 1QAHA 3L7QA 2DYYA 3K12A 1COMA 1DBFA 1UFYA 4ZK7A 3VCZA 1JD1A 3MQWA 2CHSA 3ZP4A 4NWOB 1J7HA 2CW4A 1PF5A 3K0TA 2UYNB 3ZOPA 2CHTA 1X25A 1QD9A 3I7TA 3QUWA 2CWJA 1FNJA 2UYKA 3KJKA 3R0PA 3I3FA 1ONIA 1XHOA 1NQ3A 2UYJA 3GTZA 3KJJA 3LMEA 3M1XA 5HP7A 3ZO8A 1XRGA 1UI9A 2B33A 2UYNA 2CVLA 2IG8A 2UYPA 1FNKA 1ODEA 3D01A 2CSLA 5HP8A 3V4DA 2OTMA 3M4SA
chains in the Genus database with same CATH superfamily
1W55A 1VK3A 2HP3A 3FD5A 4FFBB 3VOBA 2HS3A 1W41A 2QTPA 1Q81H 2CW4A 1VH8A 4RQOA 3HKEA 3B6NA 4O2BB 4YJ2A 2KGWA 1NQ3A 4X1YA 3HKCA 2VGNA 3NVIB 5HP8A 2UYPA 1FNKA 3T80A 2CSLA 3CCVF 2LBXA 2MQEA 2V9YA 3ZP7A 3NVKE 5A2QM 4ZI7B 1CK2A 2BTOA 5HY0A 3RYHA 3V3TA 3UT5A 1U3LA 1VQLF 5FNVB 5IJ0B 3RYIB 2Z01A 3CC2F 3I7TA 4O4LB 3VYTC 5LA6A 3I3FA 1YJ9F 4F6RA 2B33A 5LXTB 2PHNA 4IIJB 3CCRF 4U3JA 1W581 2Z1EA 5HWEA 3CCUF 3J81M 4I4TB 3WGKA 3LFOA 3L7QA 5J2UA 4G4VA 3K12A 2H6LA 3CCMF 3S06A 1M1KH 1H48A 5EB0A 3WJPA 5MN4A 5CA0A 2HS0A 3EORA 3N4YA 2AMTA 5EYPB 4O4IA 2I6DA 4HNAA 5JH7B 2QEXF 2ZAUA 3WJQA 1QD9A 1SA0B 4BVTA 2YYEA 1GZ0A 1PXWA 1X7OA 2BO1A 5IYZA 3RYCA 2UYNA 4C8EA 2IG8A 1JFFB 3K2XA 1YJNF 1VQ4F 3NMUC 3QTYA 4B45A 3RYFB 5LOVA 5J2TA 1QVGF 2HP0B 3AGKA 4TUYA 3RE3A 4O2AB 1X7PA 3NK7A 1YGYA 4BT6A 3P4EA 3ELCA 3CYQA 4NWOB 3F0DA 3MCAB 3TD3A 3C9UA 3VYUC 3CCQF 3CPWF 3V7EA 3P0ZA 3JALB 5EB1B 3KJJA 2ZODA 3GTZA 4EI9A 3IR9A 1H47A 1UI9A 3WXMB 2AIFA 1N8RH 1W5BA 4O2BA 2KTVA 3FPIA 1YITF 1K9MH 4ZHQB 4O4HB 1W3EX 4YJ3B 3C9TA 3PLAC 2HVYD 1IV3A 3GHZA 5KX5B 3LWPC 1YJWF 2BTUA 4X1IB 3J80M 1VQ9F 4G4ZA 2HQSC 3CCJF 4ZI7A 1Q82H 2VAPA 5LYJB 1U43A 2AIZP 2HRUA 3ESJA 4BVRA 2IAFA 3F0FA 5FNVA 5IJ0A 3RYIA 3V4DA 4O4LA 4B5CA 3IKFA 1KNKA 3LYBA 5HY1A 1QU9A 1VQ6F 4X20A 3VIUA 2KTUA 5FJ4C 1M90H 1YIJF 5GINC 2HX0A 4NQ3A 4C8GA 5LXTA 3C9SA 1W42A 4ZOLB 4IIJA 4ZK7A 3VCZA 2DT4A 5HXZA 2ZF8A 1NJIH 1H7MA 5BMVB 4X1KB 5EWRA 5C8YA 2LBWA 3CC4F 4DRXB 4BVQA 3OONA 1TUBB 3G4SF 3QUWA 4ZHYB 3OBWA 1SZQA 4X3LA 3S0HA 1W5EA 3TD5A 4E6EA 5JH7A 5IT9M 3JAKB 1IPAA 5CB4B 1SA0A 3RA6A 3S03A 4C8IA 1JJ2F 1YHQF 1IV1A 1QAHA 4I55B 3JAWB 1KNJA 4WBNB 1TVKB 2ZVZA 4EI7A 1JFFA 3E22B 2RHJA 1Q8RA 1JY8A 1VQNF 3RYFA 1IV4A 3N2KB 1YI2F 3OW2F 1Q7YH 2HP0A 4C4WC 2H8EA 3O85A 4O2AA 3KJKA 4I50B 4XCQA 3CXCF 3LMEA 2WALA 5HP7A 2PMPA 1RLGA 2OHWA 3WGLA 3JALA 3S0YA 5GONA 1K73H 2Z1UA 2ZOVA 3FFMA 2HS4A 3HKBB 3ZP4A 1W5FA 4O4HA 3JVHA 4ZHQA 4YJ3A 2LBTA 3CD6F 3CYPB 3IEQA 2F9ZC 2OZBA 3MBMA 4TV8B 3LWQC 1W57A 1KQSF 3JARB 3N2GB 1U40A 3WGJA 2R6R1 5HY2A 2LCAA 4U39A 3HWUA 1XV2A 3JAMM 3WPWA 3S02A 1UFYA 1GO0A 2VXYA 4C82A 2BTQB 5EAZA 4TV9A 1X52A 5EO3A 3LWOC 1VQPF 1XBIA 3IEWA 4FFBA 1RQ2A 1S72F 5HY4A 4ZOLA 5JQGB 5FLXM 5IJ9B 2H8CA 2RHHA 5BMVA 1XHOA 3PAFA 4X1KA 2FC3A 2RHOA 3E1YA 2CVLA 3OBYA 4PWTA 1ODEA 3JCMM 3BYQA 3CPQA 3WJRA 1OAPA 3UT5B 4M8IA 3VTIC 2KG4A 1GX1A 2JNBA 3KHNA 5CB4A 3G6EF 1CN7A 5GIOC 3SIVA 4I55A 4EB6B 3JAWA 4WBNA 1PF5A 1TVKA 3WPXA 1FFXB 4U3JB 3DC2A 5KMGB 1FSZA 5ITZB 2UYKA 3MDOA 3E22A 5J2UB 3D00A 1ONIA 4BT5A 5G4VC 3M1XA 2I6RA 1SDSA 3HAXD 4I50A 1NMUB 5EZYB 1W40A 5LP6B 5MN5A 3VOAA 1KD1H 3MQWA 4TZZA 2VAWA 3JATB 4DXDA 4I4TA 5IYZB 5GAPK 3WGNA 2NMUA 3CCEF 3HKBA 3S0WA 1VQKF 2R751 5EYPA 4BT3A 4R40B 1VQ8F 1YQNA 5HXUA 2RHLA 1VHAA 3U0OA 5JVDB 1W59A 1COMA 4TV8A 3N4ZA 2Q1XA 3CB2A 3QHDA 2P6YA 5B8FA 3JARA 3N2GA 2Z1FA 4G4WA 4NUTA 5G4UC 2CHSA 5CA1B 4O4JB 4LNUB 4G4YA 2GVIA 4RHAA 3ZOPA 3CMAF 3LWVC 3JASB 5JCOA 4X3MA 3ZO8A 4BVSA 4KWEA 3FD6A 2IQQA 2Z1TA 3IMPA 4ERHA 4IHJB 5JQGA 2OTLF 3V7QA 1CLIA 5IJ9A 2GZLA 3CC7F 4ZHVA 2ALEA 1RA4A 3VYSC 5GIPC 4B62A 1E7KA 5EIBD 3C9RA 3DDNA 3HKDB 3D54A 3VO8A 2Q1YA 3F6MA 4X20B 5KX5A 3CG6A 4EB6A 3TD4A 3LDTA 1R1MA 1FFXA 4X1IA 3VMFB 1JN1A 5KMGA 2FGYA 1VQ7F 2RB9A 2N48A 5ITZA 3KE1A 5DCVA 3WGMA 2QI2A 4G4XA 5LYJA 3GYQA 5C8YB 1GO1A 3KIZA 2DYYA 5JCOC 3I56F 3K14A 1ZWZA 3HKEB 3SIUA 1RLUA 2ZVYA 1W5AA 4YJ2B 4BY9D 1J7HA 3ERNA 4X1YB 2W8BC 3HKCB 5EZYA 5LP6A 2CHTA 3HTNA 2CWJA 3G71F 3R0PA 1VQ5F 3JATA 2L26A 3F0EA 5EIBC 3I55F 3HJWC 3J7AR 4LCKA 2HRYA 1Q86H 4DRXA 3Q8HA 4G88A 1TUBA 2EWCA 3RYHB 1IV2A 3CMEF 1OFUA 1VQOF 3RA5A 1DBFA 1QVFF 3CCLF 1RQ7A 3MCQA 3JAKA 1JD1A 1K8AH 4EI8A 3CCSF 5LA6B 4B46A 3F0GA 2UZHA 5JVDA 1VQMF 4F6RB 4ZHWA 4BW0B 1FNJA 5AVMA 3E20B 5GONB 1U3PA 5CA1A 4O4JA 3NK6A 4LNUA 4BT7A 1XRGA 1T0AA 3N2KA 5LP6C 5CA0B 3FBAA 3LWRC 3M4SA 2QA4F 4BT2A 3JASA 3VI6A 2GLZA 3M84A 3ON1A 4O4IB 2CZWA 4HNAB 2OTJF 1KC8H 2VAMA 2G9IA 1W2BF 4IHJA 3C8LA 2K1SA 3P10A 1Z5WA 5GANK 3K0TA 1DT9A 3RYCB 2UYNB 1X25A 4BT4A 3IKEA 1T0KB 2UYJA 2VGMA 5LOVB 1Z5VA 5J2TB 4C81A 2YXZA 5MN6A 4TUYB 1VQVA 3D01A 3HKDA 2OTMA 4TV9B
chains in the Genus database with same CATH topology
2EWCA 3LYBA 3ZP7A 1QU9A 1QAHA 3L7QA 2DYYA 3K12A 1COMA 1DBFA 1UFYA 4ZK7A 3VCZA 1JD1A 3MQWA 2CHSA 3ZP4A 4NWOB 1J7HA 2CW4A 1PF5A 3K0TA 2UYNB 3ZOPA 2CHTA 1X25A 1QD9A 3I7TA 3QUWA 2CWJA 1FNJA 2UYKA 3KJKA 3R0PA 3I3FA 1ONIA 1XHOA 1NQ3A 2UYJA 3GTZA 3KJJA 3LMEA 3M1XA 5HP7A 3ZO8A 1XRGA 1UI9A 2B33A 2UYNA 2CVLA 2IG8A 2UYPA 1FNKA 1ODEA 3D01A 2CSLA 5HP8A 3V4DA 2OTMA 3M4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWC A;  3LYB A;  3ZP7 A;  1QU9 A;  1QAH A;  3L7Q A;  2DYY A;  3K12 A;  1COM A;  1DBF A;  1UFY A;  4ZK7 A;  3VCZ A;  1JD1 A;  3MQW A;  2CHS A;  3ZP4 A;  4NWO B;  1J7H A;  2CW4 A;  1PF5 A;  3K0T A;  2UYN B;  3ZOP A;  2CHT A;  1X25 A;  1QD9 A;  3I7T A;  3QUW A;  2CWJ A;  1FNJ A;  2UYK A;  3KJK A;  3R0P A;  3I3F A;  1ONI A;  1XHO A;  1NQ3 A;  2UYJ A;  3GTZ A;  3KJJ A;  3LME A;  3M1X A;  5HP7 A;  3ZO8 A;  1XRG A;  1UI9 A;  2B33 A;  2UYN A;  2CVL A;  2IG8 A;  2UYP A;  1FNK A;  1ODE A;  3D01 A;  2CSL A;  5HP8 A;  3V4D A;  2OTM A;  3M4S A; 
#chains in the Genus database with same CATH topology
 1W55 A;  1VK3 A;  2HP3 A;  3FD5 A;  4FFB B;  3VOB A;  2HS3 A;  1W41 A;  2QTP A;  1Q81 H;  2CW4 A;  1VH8 A;  4RQO A;  3HKE A;  3B6N A;  4O2B B;  4YJ2 A;  2KGW A;  1NQ3 A;  4X1Y A;  3HKC A;  2VGN A;  3NVI B;  5HP8 A;  2UYP A;  1FNK A;  3T80 A;  2CSL A;  3CCV F;  2LBX A;  2MQE A;  2V9Y A;  3ZP7 A;  3NVK E;  5A2Q M;  4ZI7 B;  1CK2 A;  2BTO A;  5HY0 A;  3RYH A;  3V3T A;  3UT5 A;  1U3L A;  1VQL F;  5FNV B;  5IJ0 B;  3RYI B;  2Z01 A;  3CC2 F;  3I7T A;  4O4L B;  3VYT C;  5LA6 A;  3I3F A;  1YJ9 F;  4F6R A;  2B33 A;  5LXT B;  2PHN A;  4IIJ B;  3CCR F;  4U3J A;  1W58 1;  2Z1E A;  5HWE A;  3CCU F;  3J81 M;  4I4T B;  3WGK A;  3LFO A;  3L7Q A;  5J2U A;  4G4V A;  3K12 A;  2H6L A;  3CCM F;  3S06 A;  1M1K H;  1H48 A;  5EB0 A;  3WJP A;  5MN4 A;  5CA0 A;  2HS0 A;  3EOR A;  3N4Y A;  2AMT A;  5EYP B;  4O4I A;  2I6D A;  4HNA A;  5JH7 B;  2QEX F;  2ZAU A;  3WJQ A;  1QD9 A;  1SA0 B;  4BVT A;  2YYE A;  1GZ0 A;  1PXW A;  1X7O A;  2BO1 A;  5IYZ A;  3RYC A;  2UYN A;  4C8E A;  2IG8 A;  1JFF B;  3K2X A;  1YJN F;  1VQ4 F;  3NMU C;  3QTY A;  4B45 A;  3RYF B;  5LOV A;  5J2T A;  1QVG F;  2HP0 B;  3AGK A;  4TUY A;  3RE3 A;  4O2A B;  1X7P A;  3NK7 A;  1YGY A;  4BT6 A;  3P4E A;  3ELC A;  3CYQ A;  4NWO B;  3F0D A;  3MCA B;  3TD3 A;  3C9U A;  3VYU C;  3CCQ F;  3CPW F;  3V7E A;  3P0Z A;  3JAL B;  5EB1 B;  3KJJ A;  2ZOD A;  3GTZ A;  4EI9 A;  3IR9 A;  1H47 A;  1UI9 A;  3WXM B;  2AIF A;  1N8R H;  1W5B A;  4O2B A;  2KTV A;  3FPI A;  1YIT F;  1K9M H;  4ZHQ B;  4O4H B;  1W3E X;  4YJ3 B;  3C9T A;  3PLA C;  2HVY D;  1IV3 A;  3GHZ A;  5KX5 B;  3LWP C;  1YJW F;  2BTU A;  4X1I B;  3J80 M;  1VQ9 F;  4G4Z A;  2HQS C;  3CCJ F;  4ZI7 A;  1Q82 H;  2VAP A;  5LYJ B;  1U43 A;  2AIZ P;  2HRU A;  3ESJ A;  4BVR A;  2IAF A;  3F0F A;  5FNV A;  5IJ0 A;  3RYI A;  3V4D A;  4O4L A;  4B5C A;  3IKF A;  1KNK A;  3LYB A;  5HY1 A;  1QU9 A;  1VQ6 F;  4X20 A;  3VIU A;  2KTU A;  5FJ4 C;  1M90 H;  1YIJ F;  5GIN C;  2HX0 A;  4NQ3 A;  4C8G A;  5LXT A;  3C9S A;  1W42 A;  4ZOL B;  4IIJ A;  4ZK7 A;  3VCZ A;  2DT4 A;  5HXZ A;  2ZF8 A;  1NJI H;  1H7M A;  5BMV B;  4X1K B;  5EWR A;  5C8Y A;  2LBW A;  3CC4 F;  4DRX B;  4BVQ A;  3OON A;  1TUB B;  3G4S F;  3QUW A;  4ZHY B;  3OBW A;  1SZQ A;  4X3L A;  3S0H A;  1W5E A;  3TD5 A;  4E6E A;  5JH7 A;  5IT9 M;  3JAK B;  1IPA A;  5CB4 B;  1SA0 A;  3RA6 A;  3S03 A;  4C8I A;  1JJ2 F;  1YHQ F;  1IV1 A;  1QAH A;  4I55 B;  3JAW B;  1KNJ A;  4WBN B;  1TVK B;  2ZVZ A;  4EI7 A;  1JFF A;  3E22 B;  2RHJ A;  1Q8R A;  1JY8 A;  1VQN F;  3RYF A;  1IV4 A;  3N2K B;  1YI2 F;  3OW2 F;  1Q7Y H;  2HP0 A;  4C4W C;  2H8E A;  3O85 A;  4O2A A;  3KJK A;  4I50 B;  4XCQ A;  3CXC F;  3LME A;  2WAL A;  5HP7 A;  2PMP A;  1RLG A;  2OHW A;  3WGL A;  3JAL A;  3S0Y A;  5GON A;  1K73 H;  2Z1U A;  2ZOV A;  3FFM A;  2HS4 A;  3HKB B;  3ZP4 A;  1W5F A;  4O4H A;  3JVH A;  4ZHQ A;  4YJ3 A;  2LBT A;  3CD6 F;  3CYP B;  3IEQ A;  2F9Z C;  2OZB A;  3MBM A;  4TV8 B;  3LWQ C;  1W57 A;  1KQS F;  3JAR B;  3N2G B;  1U40 A;  3WGJ A;  2R6R 1;  5HY2 A;  2LCA A;  4U39 A;  3HWU A;  1XV2 A;  3JAM M;  3WPW A;  3S02 A;  1UFY A;  1GO0 A;  2VXY A;  4C82 A;  2BTQ B;  5EAZ A;  4TV9 A;  1X52 A;  5EO3 A;  3LWO C;  1VQP F;  1XBI A;  3IEW A;  4FFB A;  1RQ2 A;  1S72 F;  5HY4 A;  4ZOL A;  5JQG B;  5FLX M;  5IJ9 B;  2H8C A;  2RHH A;  5BMV A;  1XHO A;  3PAF A;  4X1K A;  2FC3 A;  2RHO A;  3E1Y A;  2CVL A;  3OBY A;  4PWT A;  1ODE A;  3JCM M;  3BYQ A;  3CPQ A;  3WJR A;  1OAP A;  3UT5 B;  4M8I A;  3VTI C;  2KG4 A;  1GX1 A;  2JNB A;  3KHN A;  5CB4 A;  3G6E F;  1CN7 A;  5GIO C;  3SIV A;  4I55 A;  4EB6 B;  3JAW A;  4WBN A;  1PF5 A;  1TVK A;  3WPX A;  1FFX B;  4U3J B;  3DC2 A;  5KMG B;  1FSZ A;  5ITZ B;  2UYK A;  3MDO A;  3E22 A;  5J2U B;  3D00 A;  1ONI A;  4BT5 A;  5G4V C;  3M1X A;  2I6R A;  1SDS A;  3HAX D;  4I50 A;  1NMU B;  5EZY B;  1W40 A;  5LP6 B;  5MN5 A;  3VOA A;  1KD1 H;  3MQW A;  4TZZ A;  2VAW A;  3JAT B;  4DXD A;  4I4T A;  5IYZ B;  5GAP K;  3WGN A;  2NMU A;  3CCE F;  3HKB A;  3S0W A;  1VQK F;  2R75 1;  5EYP A;  4BT3 A;  4R40 B;  1VQ8 F;  1YQN A;  5HXU A;  2RHL A;  1VHA A;  3U0O A;  5JVD B;  1W59 A;  1COM A;  4TV8 A;  3N4Z A;  2Q1X A;  3CB2 A;  3QHD A;  2P6Y A;  5B8F A;  3JAR A;  3N2G A;  2Z1F A;  4G4W A;  4NUT A;  5G4U C;  2CHS A;  5CA1 B;  4O4J B;  4LNU B;  4G4Y A;  2GVI A;  4RHA A;  3ZOP A;  3CMA F;  3LWV C;  3JAS B;  5JCO A;  4X3M A;  3ZO8 A;  4BVS A;  4KWE A;  3FD6 A;  2IQQ A;  2Z1T A;  3IMP A;  4ERH A;  4IHJ B;  5JQG A;  2OTL F;  3V7Q A;  1CLI A;  5IJ9 A;  2GZL A;  3CC7 F;  4ZHV A;  2ALE A;  1RA4 A;  3VYS C;  5GIP C;  4B62 A;  1E7K A;  5EIB D;  3C9R A;  3DDN A;  3HKD B;  3D54 A;  3VO8 A;  2Q1Y A;  3F6M A;  4X20 B;  5KX5 A;  3CG6 A;  4EB6 A;  3TD4 A;  3LDT A;  1R1M A;  1FFX A;  4X1I A;  3VMF B;  1JN1 A;  5KMG A;  2FGY A;  1VQ7 F;  2RB9 A;  2N48 A;  5ITZ A;  3KE1 A;  5DCV A;  3WGM A;  2QI2 A;  4G4X A;  5LYJ A;  3GYQ A;  5C8Y B;  1GO1 A;  3KIZ A;  2DYY A;  5JCO C;  3I56 F;  3K14 A;  1ZWZ A;  3HKE B;  3SIU A;  1RLU A;  2ZVY A;  1W5A A;  4YJ2 B;  4BY9 D;  1J7H A;  3ERN A;  4X1Y B;  2W8B C;  3HKC B;  5EZY A;  5LP6 A;  2CHT A;  3HTN A;  2CWJ A;  3G71 F;  3R0P A;  1VQ5 F;  3JAT A;  2L26 A;  3F0E A;  5EIB C;  3I55 F;  3HJW C;  3J7A R;  4LCK A;  2HRY A;  1Q86 H;  4DRX A;  3Q8H A;  4G88 A;  1TUB A;  2EWC A;  3RYH B;  1IV2 A;  3CME F;  1OFU A;  1VQO F;  3RA5 A;  1DBF A;  1QVF F;  3CCL F;  1RQ7 A;  3MCQ A;  3JAK A;  1JD1 A;  1K8A H;  4EI8 A;  3CCS F;  5LA6 B;  4B46 A;  3F0G A;  2UZH A;  5JVD A;  1VQM F;  4F6R B;  4ZHW A;  4BW0 B;  1FNJ A;  5AVM A;  3E20 B;  5GON B;  1U3P A;  5CA1 A;  4O4J A;  3NK6 A;  4LNU A;  4BT7 A;  1XRG A;  1T0A A;  3N2K A;  5LP6 C;  5CA0 B;  3FBA A;  3LWR C;  3M4S A;  2QA4 F;  4BT2 A;  3JAS A;  3VI6 A;  2GLZ A;  3M84 A;  3ON1 A;  4O4I B;  2CZW A;  4HNA B;  2OTJ F;  1KC8 H;  2VAM A;  2G9I A;  1W2B F;  4IHJ A;  3C8L A;  2K1S A;  3P10 A;  1Z5W A;  5GAN K;  3K0T A;  1DT9 A;  3RYC B;  2UYN B;  1X25 A;  4BT4 A;  3IKE A;  1T0K B;  2UYJ A;  2VGM A;  5LOV B;  1Z5V A;  5J2T B;  4C81 A;  2YXZ A;  5MN6 A;  4TUY B;  1VQV A;  3D01 A;  3HKD A;  2OTM A;  4TV9 B; 
#chains in the Genus database with same CATH homology
 2EWC A;  3LYB A;  3ZP7 A;  1QU9 A;  1QAH A;  3L7Q A;  2DYY A;  3K12 A;  1COM A;  1DBF A;  1UFY A;  4ZK7 A;  3VCZ A;  1JD1 A;  3MQW A;  2CHS A;  3ZP4 A;  4NWO B;  1J7H A;  2CW4 A;  1PF5 A;  3K0T A;  2UYN B;  3ZOP A;  2CHT A;  1X25 A;  1QD9 A;  3I7T A;  3QUW A;  2CWJ A;  1FNJ A;  2UYK A;  3KJK A;  3R0P A;  3I3F A;  1ONI A;  1XHO A;  1NQ3 A;  2UYJ A;  3GTZ A;  3KJJ A;  3LME A;  3M1X A;  5HP7 A;  3ZO8 A;  1XRG A;  1UI9 A;  2B33 A;  2UYN A;  2CVL A;  2IG8 A;  2UYP A;  1FNK A;  1ODE A;  3D01 A;  2CSL A;  5HP8 A;  3V4D A;  2OTM A;  3M4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...