2B33A

Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
MKRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein synthesis inhibitor, putative
publication title Crystal structure of Protein synthesis inhibitor, putative (tm0215) from THERMOTOGA MARITIMA at 2.30 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2b33A00
1DBFA 1FNJA 1FNKA 1UFYA 3ZOPA 1J7HA 2B33A 3KJKA 3V4DA 1NQ3A 1ONIA 2UYJA 5HP7A 3I7TA 1PF5A 3KJJA 4ZK7A 3R0PA 2UYPA 3LYBA 2UYKA 2OTMA 1XHOA 1X25A 3ZO8A 2IG8A 1COMA 1UI9A 2DYYA 3I3FA 2UYNA 3L7QA 1QD9A 3VCZA 3ZP7A 1QU9A 3K0TA 3LMEA 2CVLA 2CHSA 2CSLA 1QAHA 3K12A 3MQWA 1XRGA 2EWCA 3M1XA 5HP8A 3ZP4A 3D01A 1ODEA 2UYNB 3M4SA 2CHTA 4NWOB 2CW4A 2CWJA 1JD1A 3GTZA 3QUWA
chains in the Genus database with same CATH superfamily
5KMGA 5HY4A 3RA6A 1CK2A 5EWRA 5BMVB 3HAXD 3CYPB 1XBIA 3TD5A 1RQ7A 4X20A 3Q8HA 3PLAC 1XHOA 4R40B 4M8IA 3DDNA 3VO8A 1COMA 3HKBA 2DYYA 3K0TA 1H47A 3S03A 3J7AR 3S06A 1Q8RA 4XCQA 5A2QM 1W5BA 2Z1UA 3AGKA 1VQLF 3FPIA 5IJ0B 2CHTA 3G6EF 3JALB 2LCAA 1J7HA 4EI8A 2AIZP 3VIUA 3GYQA 3TD4A 2OHWA 4IIJA 3S0HA 2N48A 2LBWA 4O4IA 4BT2A 2Z1EA 2LBXA 1NJIH 5LP6A 1JFFA 3JCMM 3JARB 5HXUA 1IV1A 1YJWF 1VQ8F 4YJ3A 3IKFA 2YXZA 5GANK 2L26A 4IHJA 5JCOC 3WPWA 5J2UA 3RYCA 1Z5WA 1VQOF 3IEQA 5HP8A 1VQKF 2VAMA 2ZVZA 4NWOB 4ZI7B 1W5FA 1JD1A 3I56F 4BVQA 2HP3A 3NK6A 3HKCA 3JVHA 3NK7A 3LWQC 3CD6F 3VTIC 4BVRA 4I4TA 1W59A 3E20B 4O2BB 3T80A 4G88A 3RYFA 3VCZA 3L7QA 4G4YA 3N4ZA 4I50B 1H7MA 5LOVA 4C8IA 4ZHQB 3MCQA 3JATA 3RYHA 2H8CA 4I55A 1VQMF 2I6DA 3CCLF 5J2TA 3V7QA 1VQVA 4TZZA 3MBMA 5JVDB 3VYUC 4X1IA 5GONA 1PXWA 5LA6A 2Q1YA 3WXMB 1YJNF 3FD6A 2HP0A 1Q86H 4LCKA 3VYTC 1GO1A 5DCVA 2W8BC 4U3JB 1R1MA 3E1YA 4C4WC 1VK3A 3ZP7A 4G4ZA 1W2BF 2CSLA 5EB0A 3MCAB 5HY0A 1W41A 3CB2A 1W40A 4WBNB 3CCSF 1W581 3E22B 4X3MA 3HTNA 5IJ9B 1YJ9F 4DRXB 2AMTA 5FNVA 4B5CA 5GINC 3NMUC 1U43A 1U3LA 3GHZA 1RQ2A 4TV8A 1NQ3A 1PF5A 5EB1B 3JAMM 4ZHYB 4TUYA 2CZWA 3N2GB 4YJ2A 3RE3A 2IG8A 3S02A 3LWVC 4F6RA 4LNUA 5JQGB 3UT5A 3JASB 3PAFA 3WGLA 1XV2A 5KX5B 4X1KA 4RQOA 4O2AB 2ALEA 1Z5VA 4C82A 2Q1XA 3M1XA 3WGJA 2H8EA 1X7OA 2UYNB 3B6NA 3CPQA 3SIVA 3ZOPA 1K9MH 3DC2A 4DXDA 3RYIB 4X1YB 5HY2A 5C8YB 1TVKA 5LXTB 4G4XA 3VYSC 3CXCF 2UYKA 2OTMA 3IKEA 5KMGB 1KC8H 1RA4A 1YQNA 2OZBA 3SIUA 1OFUA 2IAFA 4BVSA 3LWRC 2I6RA 3I3FA 3N2KB 1IV2A 1QU9A 4O4HA 3OW2F 1QAHA 4O4LA 2QTPA 2Z01A 5BMVA 3HKBB 1ODEA 3HKEB 4BY9D 5EYPA 1Q7YH 2G9IA 1GO0A 1JY8A 4U39A 2KTUA 3HWUA 4ERHA 2OTLF 2QEXF 4B45A 3S0WA 3F0DA 3CMAF 4EI9A 4BT6A 2VXYA 5LYJA 4ZOLA 1IPAA 2RHOA 4BT4A 1RLGA 4HNAA 3C9SA 1UI9A 4G4WA 3MDOA 1H48A 5B8FA 3WJQA 3F6MA 1JFFB 5LP6B 3K12A 1YI2F 3D01A 5MN5A 1X52A 4YJ3B 5GAPK 4NUTA 4IHJB 2CW4A 2GZLA 3JAWB 3V7EA 3GTZA 1FNKA 5J2UB 3RYCB 3JARA 5G4VC 2RHHA 3WGKA 2B33A 3KJKA 4EI7A 2UYJA 5HP7A 1TUBA 1S72F 3KIZA 3JAKB 1W3EX 1QD9A 4ZI7A 3WJPA 5EIBD 4I4TB 4O4JA 5CA1A 2BO1A 5EZYB 2ZF8A 1N8RH 4BT3A 3RYFB 2QI2A 2RHJA 4B62A 2VGMA 2UZHA 4FFBA 3CCMF 2HS3A 1DBFA 5GIOC 3CMEF 2BTOA 3D00A 1DT9A 2PMPA 4RHAA 3CC2F 5LP6C 1RLUA 3FFMA 4I50A 2H6LA 3RYHB 3CCJF 4I55B 4ZHQA 2BTUA 3QHDA 3HKDA 3C9RA 3ZO8A 4X1IB 5GONB 4X3LA 1YHQF 5ITZA 5LA6B 3K14A 5IYZA 2HP0B 2ZVYA 4G4VA 4ZHWA 1KQSF 3J81M 3ZP4A 4C8EA 3WJRA 3M84A 3NVKE 3OBWA 3C8LA 3U0OA 3VMFB 4BT7A 1CLIA 1T0AA 1X7PA 1W57A 5FNVB 1FFXA 1M1KH 4NQ3A 3VOAA 4C8GA 2WALA 1T0KB 1KD1H 5IJ9A 2HS4A 1GZ0A 2Z1TA 3LMEA 4KWEA 4TUYB 2VGNA 3NVIB 3ERNA 2EWCA 1GX1A 3C9TA 1SA0B 4F6RB 4LNUB 3UT5B 1YITF 2MQEA 1YIJF 3LFOA 1NMUB 5JH7A 4X1KB 1IV4A 2HRYA 3N2GA 2FC3A 3WPXA 1W42A 3CYQA 3OONA 2BTQB 3R0PA 2UYPA 5CA0A 2NMUA 1SDSA 3J80M 1TVKB 5CB4A 4TV9A 4EB6A 5FLXM 3VI6A 4X20B 3F0FA 3G4SF 3RYIA 4X1YA 1M90H 4O4HB 5JCOA 2CWJA 1VQ7F 3CCVF 3C9UA 4O4LB 1VQNF 5IT9M 3N2KA 3HJWC 2HQSC 5EYPB 2JNBA 3FBAA 1E7KA 3KJJA 3I55F 1X25A 3F0GA 3HKEA 1VQ4F 1OAPA 5IJ0A 2FGYA 1W5AA 4IIJB 3JALA 1VQ5F 4O4IB 5LYJB 4ZOLB 2HRUA 3RA5A 1VH8A 2RB9A 3CC4F 4HNAB 3CG6A 2VAPA 2ZAUA 5HWEA 5MN6A 3M4SA 5MN4A 5FJ4C 3QUWA 1FNJA 1UFYA 4B46A 4BT5A 3FD5A 1ONIA 1VHAA 2V9YA 3QTYA 3LWOC 1FSZA 1W55A 2DT4A 1K8AH 3CC7F 3HKCB 1TUBB 3JAWA 3MQWA 1SZQA 3ESJA 4O4JB 5EAZA 5CA1B 3IEWA 4E6EA 5HXZA 3JAKA 5LOVB 1JN1A 4O2BA 2K1SA 1YGYA 2GLZA 3S0YA 2HS0A 3JATB 4ZK7A 4FFBB 5EZYA 3EORA 2HX0A 5J2TB 1K73H 5G4UC 3IR9A 2Z1FA 3P0ZA 2F9ZC 2ZODA 2OTJF 1KNKA 3IMPA 2CHSA 2KG4A 1KNJA 3HKDB 3P4EA 2VAWA 5JVDA 3CPWF 3CCQF 5ITZB 3ELCA 3V3TA 1U3PA 2HVYD 1QVGF 2LBTA 5IYZB 1Q82H 1JJ2F 4U3JA 5EIBC 2KTVA 3V4DA 2R751 2GVIA 3O85A 4C81A 3WGNA 3D54A 4WBNA 4BVTA 3KE1A 3CCRF 3E22A 3N4YA 4TV8B 3KHNA 3G71F 1FFXB 4DRXA 3CCEF 2CVLA 2IQQA 3BYQA 4ZHVA 2ZOVA 2P6YA 3P10A 4YJ2B 3OBYA 3K2XA 1VQ9F 4PWTA 1IV3A 2AIFA 2QA4F 3F0EA 1W5EA 3LDTA 5AVMA 1VQPF 3LWPC 3I7TA 1VQ6F 5JQGA 5JH7B 3ON1A 3JASA 3CCUF 3LYBA 4BW0B 5KX5A 1ZWZA 2KGWA 4O2AA 3TD3A 1SA0A 2UYNA 1Q81H 2R6R1 3VOBA 2PHNA 5CA0B 5EO3A 1XRGA 5GIPC 2RHLA 1CN7A 5HY1A 1U40A 5CB4B 4TV9B 5C8YA 3WGMA 4EB6B 5LXTA 2YYEA 1QVFF
chains in the Genus database with same CATH topology
1DBFA 1FNJA 1FNKA 1UFYA 3ZOPA 1J7HA 2B33A 3KJKA 3V4DA 1NQ3A 1ONIA 2UYJA 5HP7A 3I7TA 1PF5A 3KJJA 4ZK7A 3R0PA 2UYPA 3LYBA 2UYKA 2OTMA 1XHOA 1X25A 3ZO8A 2IG8A 1COMA 1UI9A 2DYYA 3I3FA 2UYNA 3L7QA 1QD9A 3VCZA 3ZP7A 1QU9A 3K0TA 3LMEA 2CVLA 2CHSA 2CSLA 1QAHA 3K12A 3MQWA 1XRGA 2EWCA 3M1XA 5HP8A 3ZP4A 3D01A 1ODEA 2UYNB 3M4SA 2CHTA 4NWOB 2CW4A 2CWJA 1JD1A 3GTZA 3QUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBF A;  1FNJ A;  1FNK A;  1UFY A;  3ZOP A;  1J7H A;  2B33 A;  3KJK A;  3V4D A;  1NQ3 A;  1ONI A;  2UYJ A;  5HP7 A;  3I7T A;  1PF5 A;  3KJJ A;  4ZK7 A;  3R0P A;  2UYP A;  3LYB A;  2UYK A;  2OTM A;  1XHO A;  1X25 A;  3ZO8 A;  2IG8 A;  1COM A;  1UI9 A;  2DYY A;  3I3F A;  2UYN A;  3L7Q A;  1QD9 A;  3VCZ A;  3ZP7 A;  1QU9 A;  3K0T A;  3LME A;  2CVL A;  2CHS A;  2CSL A;  1QAH A;  3K12 A;  3MQW A;  1XRG A;  2EWC A;  3M1X A;  5HP8 A;  3ZP4 A;  3D01 A;  1ODE A;  2UYN B;  3M4S A;  2CHT A;  4NWO B;  2CW4 A;  2CWJ A;  1JD1 A;  3GTZ A;  3QUW A; 
#chains in the Genus database with same CATH topology
 5KMG A;  5HY4 A;  3RA6 A;  1CK2 A;  5EWR A;  5BMV B;  3HAX D;  3CYP B;  1XBI A;  3TD5 A;  1RQ7 A;  4X20 A;  3Q8H A;  3PLA C;  1XHO A;  4R40 B;  4M8I A;  3DDN A;  3VO8 A;  1COM A;  3HKB A;  2DYY A;  3K0T A;  1H47 A;  3S03 A;  3J7A R;  3S06 A;  1Q8R A;  4XCQ A;  5A2Q M;  1W5B A;  2Z1U A;  3AGK A;  1VQL F;  3FPI A;  5IJ0 B;  2CHT A;  3G6E F;  3JAL B;  2LCA A;  1J7H A;  4EI8 A;  2AIZ P;  3VIU A;  3GYQ A;  3TD4 A;  2OHW A;  4IIJ A;  3S0H A;  2N48 A;  2LBW A;  4O4I A;  4BT2 A;  2Z1E A;  2LBX A;  1NJI H;  5LP6 A;  1JFF A;  3JCM M;  3JAR B;  5HXU A;  1IV1 A;  1YJW F;  1VQ8 F;  4YJ3 A;  3IKF A;  2YXZ A;  5GAN K;  2L26 A;  4IHJ A;  5JCO C;  3WPW A;  5J2U A;  3RYC A;  1Z5W A;  1VQO F;  3IEQ A;  5HP8 A;  1VQK F;  2VAM A;  2ZVZ A;  4NWO B;  4ZI7 B;  1W5F A;  1JD1 A;  3I56 F;  4BVQ A;  2HP3 A;  3NK6 A;  3HKC A;  3JVH A;  3NK7 A;  3LWQ C;  3CD6 F;  3VTI C;  4BVR A;  4I4T A;  1W59 A;  3E20 B;  4O2B B;  3T80 A;  4G88 A;  3RYF A;  3VCZ A;  3L7Q A;  4G4Y A;  3N4Z A;  4I50 B;  1H7M A;  5LOV A;  4C8I A;  4ZHQ B;  3MCQ A;  3JAT A;  3RYH A;  2H8C A;  4I55 A;  1VQM F;  2I6D A;  3CCL F;  5J2T A;  3V7Q A;  1VQV A;  4TZZ A;  3MBM A;  5JVD B;  3VYU C;  4X1I A;  5GON A;  1PXW A;  5LA6 A;  2Q1Y A;  3WXM B;  1YJN F;  3FD6 A;  2HP0 A;  1Q86 H;  4LCK A;  3VYT C;  1GO1 A;  5DCV A;  2W8B C;  4U3J B;  1R1M A;  3E1Y A;  4C4W C;  1VK3 A;  3ZP7 A;  4G4Z A;  1W2B F;  2CSL A;  5EB0 A;  3MCA B;  5HY0 A;  1W41 A;  3CB2 A;  1W40 A;  4WBN B;  3CCS F;  1W58 1;  3E22 B;  4X3M A;  3HTN A;  5IJ9 B;  1YJ9 F;  4DRX B;  2AMT A;  5FNV A;  4B5C A;  5GIN C;  3NMU C;  1U43 A;  1U3L A;  3GHZ A;  1RQ2 A;  4TV8 A;  1NQ3 A;  1PF5 A;  5EB1 B;  3JAM M;  4ZHY B;  4TUY A;  2CZW A;  3N2G B;  4YJ2 A;  3RE3 A;  2IG8 A;  3S02 A;  3LWV C;  4F6R A;  4LNU A;  5JQG B;  3UT5 A;  3JAS B;  3PAF A;  3WGL A;  1XV2 A;  5KX5 B;  4X1K A;  4RQO A;  4O2A B;  2ALE A;  1Z5V A;  4C82 A;  2Q1X A;  3M1X A;  3WGJ A;  2H8E A;  1X7O A;  2UYN B;  3B6N A;  3CPQ A;  3SIV A;  3ZOP A;  1K9M H;  3DC2 A;  4DXD A;  3RYI B;  4X1Y B;  5HY2 A;  5C8Y B;  1TVK A;  5LXT B;  4G4X A;  3VYS C;  3CXC F;  2UYK A;  2OTM A;  3IKE A;  5KMG B;  1KC8 H;  1RA4 A;  1YQN A;  2OZB A;  3SIU A;  1OFU A;  2IAF A;  4BVS A;  3LWR C;  2I6R A;  3I3F A;  3N2K B;  1IV2 A;  1QU9 A;  4O4H A;  3OW2 F;  1QAH A;  4O4L A;  2QTP A;  2Z01 A;  5BMV A;  3HKB B;  1ODE A;  3HKE B;  4BY9 D;  5EYP A;  1Q7Y H;  2G9I A;  1GO0 A;  1JY8 A;  4U39 A;  2KTU A;  3HWU A;  4ERH A;  2OTL F;  2QEX F;  4B45 A;  3S0W A;  3F0D A;  3CMA F;  4EI9 A;  4BT6 A;  2VXY A;  5LYJ A;  4ZOL A;  1IPA A;  2RHO A;  4BT4 A;  1RLG A;  4HNA A;  3C9S A;  1UI9 A;  4G4W A;  3MDO A;  1H48 A;  5B8F A;  3WJQ A;  3F6M A;  1JFF B;  5LP6 B;  3K12 A;  1YI2 F;  3D01 A;  5MN5 A;  1X52 A;  4YJ3 B;  5GAP K;  4NUT A;  4IHJ B;  2CW4 A;  2GZL A;  3JAW B;  3V7E A;  3GTZ A;  1FNK A;  5J2U B;  3RYC B;  3JAR A;  5G4V C;  2RHH A;  3WGK A;  2B33 A;  3KJK A;  4EI7 A;  2UYJ A;  5HP7 A;  1TUB A;  1S72 F;  3KIZ A;  3JAK B;  1W3E X;  1QD9 A;  4ZI7 A;  3WJP A;  5EIB D;  4I4T B;  4O4J A;  5CA1 A;  2BO1 A;  5EZY B;  2ZF8 A;  1N8R H;  4BT3 A;  3RYF B;  2QI2 A;  2RHJ A;  4B62 A;  2VGM A;  2UZH A;  4FFB A;  3CCM F;  2HS3 A;  1DBF A;  5GIO C;  3CME F;  2BTO A;  3D00 A;  1DT9 A;  2PMP A;  4RHA A;  3CC2 F;  5LP6 C;  1RLU A;  3FFM A;  4I50 A;  2H6L A;  3RYH B;  3CCJ F;  4I55 B;  4ZHQ A;  2BTU A;  3QHD A;  3HKD A;  3C9R A;  3ZO8 A;  4X1I B;  5GON B;  4X3L A;  1YHQ F;  5ITZ A;  5LA6 B;  3K14 A;  5IYZ A;  2HP0 B;  2ZVY A;  4G4V A;  4ZHW A;  1KQS F;  3J81 M;  3ZP4 A;  4C8E A;  3WJR A;  3M84 A;  3NVK E;  3OBW A;  3C8L A;  3U0O A;  3VMF B;  4BT7 A;  1CLI A;  1T0A A;  1X7P A;  1W57 A;  5FNV B;  1FFX A;  1M1K H;  4NQ3 A;  3VOA A;  4C8G A;  2WAL A;  1T0K B;  1KD1 H;  5IJ9 A;  2HS4 A;  1GZ0 A;  2Z1T A;  3LME A;  4KWE A;  4TUY B;  2VGN A;  3NVI B;  3ERN A;  2EWC A;  1GX1 A;  3C9T A;  1SA0 B;  4F6R B;  4LNU B;  3UT5 B;  1YIT F;  2MQE A;  1YIJ F;  3LFO A;  1NMU B;  5JH7 A;  4X1K B;  1IV4 A;  2HRY A;  3N2G A;  2FC3 A;  3WPX A;  1W42 A;  3CYQ A;  3OON A;  2BTQ B;  3R0P A;  2UYP A;  5CA0 A;  2NMU A;  1SDS A;  3J80 M;  1TVK B;  5CB4 A;  4TV9 A;  4EB6 A;  5FLX M;  3VI6 A;  4X20 B;  3F0F A;  3G4S F;  3RYI A;  4X1Y A;  1M90 H;  4O4H B;  5JCO A;  2CWJ A;  1VQ7 F;  3CCV F;  3C9U A;  4O4L B;  1VQN F;  5IT9 M;  3N2K A;  3HJW C;  2HQS C;  5EYP B;  2JNB A;  3FBA A;  1E7K A;  3KJJ A;  3I55 F;  1X25 A;  3F0G A;  3HKE A;  1VQ4 F;  1OAP A;  5IJ0 A;  2FGY A;  1W5A A;  4IIJ B;  3JAL A;  1VQ5 F;  4O4I B;  5LYJ B;  4ZOL B;  2HRU A;  3RA5 A;  1VH8 A;  2RB9 A;  3CC4 F;  4HNA B;  3CG6 A;  2VAP A;  2ZAU A;  5HWE A;  5MN6 A;  3M4S A;  5MN4 A;  5FJ4 C;  3QUW A;  1FNJ A;  1UFY A;  4B46 A;  4BT5 A;  3FD5 A;  1ONI A;  1VHA A;  2V9Y A;  3QTY A;  3LWO C;  1FSZ A;  1W55 A;  2DT4 A;  1K8A H;  3CC7 F;  3HKC B;  1TUB B;  3JAW A;  3MQW A;  1SZQ A;  3ESJ A;  4O4J B;  5EAZ A;  5CA1 B;  3IEW A;  4E6E A;  5HXZ A;  3JAK A;  5LOV B;  1JN1 A;  4O2B A;  2K1S A;  1YGY A;  2GLZ A;  3S0Y A;  2HS0 A;  3JAT B;  4ZK7 A;  4FFB B;  5EZY A;  3EOR A;  2HX0 A;  5J2T B;  1K73 H;  5G4U C;  3IR9 A;  2Z1F A;  3P0Z A;  2F9Z C;  2ZOD A;  2OTJ F;  1KNK A;  3IMP A;  2CHS A;  2KG4 A;  1KNJ A;  3HKD B;  3P4E A;  2VAW A;  5JVD A;  3CPW F;  3CCQ F;  5ITZ B;  3ELC A;  3V3T A;  1U3P A;  2HVY D;  1QVG F;  2LBT A;  5IYZ B;  1Q82 H;  1JJ2 F;  4U3J A;  5EIB C;  2KTV A;  3V4D A;  2R75 1;  2GVI A;  3O85 A;  4C81 A;  3WGN A;  3D54 A;  4WBN A;  4BVT A;  3KE1 A;  3CCR F;  3E22 A;  3N4Y A;  4TV8 B;  3KHN A;  3G71 F;  1FFX B;  4DRX A;  3CCE F;  2CVL A;  2IQQ A;  3BYQ A;  4ZHV A;  2ZOV A;  2P6Y A;  3P10 A;  4YJ2 B;  3OBY A;  3K2X A;  1VQ9 F;  4PWT A;  1IV3 A;  2AIF A;  2QA4 F;  3F0E A;  1W5E A;  3LDT A;  5AVM A;  1VQP F;  3LWP C;  3I7T A;  1VQ6 F;  5JQG A;  5JH7 B;  3ON1 A;  3JAS A;  3CCU F;  3LYB A;  4BW0 B;  5KX5 A;  1ZWZ A;  2KGW A;  4O2A A;  3TD3 A;  1SA0 A;  2UYN A;  1Q81 H;  2R6R 1;  3VOB A;  2PHN A;  5CA0 B;  5EO3 A;  1XRG A;  5GIP C;  2RHL A;  1CN7 A;  5HY1 A;  1U40 A;  5CB4 B;  4TV9 B;  5C8Y A;  3WGM A;  4EB6 B;  5LXT A;  2YYE A;  1QVF F; 
#chains in the Genus database with same CATH homology
 1DBF A;  1FNJ A;  1FNK A;  1UFY A;  3ZOP A;  1J7H A;  2B33 A;  3KJK A;  3V4D A;  1NQ3 A;  1ONI A;  2UYJ A;  5HP7 A;  3I7T A;  1PF5 A;  3KJJ A;  4ZK7 A;  3R0P A;  2UYP A;  3LYB A;  2UYK A;  2OTM A;  1XHO A;  1X25 A;  3ZO8 A;  2IG8 A;  1COM A;  1UI9 A;  2DYY A;  3I3F A;  2UYN A;  3L7Q A;  1QD9 A;  3VCZ A;  3ZP7 A;  1QU9 A;  3K0T A;  3LME A;  2CVL A;  2CHS A;  2CSL A;  1QAH A;  3K12 A;  3MQW A;  1XRG A;  2EWC A;  3M1X A;  5HP8 A;  3ZP4 A;  3D01 A;  1ODE A;  2UYN B;  3M4S A;  2CHT A;  4NWO B;  2CW4 A;  2CWJ A;  1JD1 A;  3GTZ A;  3QUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...