2B33A

Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
MKRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein synthesis inhibitor, putative
publication title Crystal structure of Protein synthesis inhibitor, putative (tm0215) from THERMOTOGA MARITIMA at 2.30 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2b33A00
1XHOA 5HP7A 1UI9A 2UYKA 1ONIA 1FNJA 2CHSA 4ZK7A 1QAHA 3M4SA 2IG8A 4NWOB 2UYPA 1JD1A 2UYJA 3GTZA 3K12A 1QD9A 3I3FA 3K0TA 1NQ3A 3QUWA 2CW4A 1COMA 3ZOPA 3V4DA 3ZP4A 1PF5A 3ZP7A 3D01A 1FNKA 3MQWA 3LYBA 1X25A 1UFYA 3KJKA 3KJJA 2UYNA 2DYYA 1QU9A 3LMEA 2UYNB 3L7QA 2B33A 3R0PA 2CWJA 2CHTA 3ZO8A 2CVLA 2OTMA 1DBFA 3VCZA 1J7HA 5HP8A 3I7TA 2EWCA 1XRGA 2CSLA 3M1XA 1ODEA
chains in the Genus database with same CATH superfamily
4O4JA 3LWRC 2FGYA 3N2KA 2H6LA 2IG8A 4EB6B 5J2TB 2UYJA 5CB4A 1GX1A 4X1KB 3NK7A 2BTOA 3N4YA 3M84A 4B5CA 3FPIA 1M1KH 3D01A 1W42A 4O4LA 5JH7A 5HWEA 4FFBB 5C8YA 4WBNA 3J80M 1H47A 3FFMA 3NK6A 3CMAF 3FD6A 2RB9A 3P4EA 4ZHQA 1VQVA 3LWQC 4NUTA 3S0HA 1IV2A 2OHWA 3WGKA 1U3LA 1TUBB 4G4VA 1RLGA 2P6YA 4O2AB 3I3FA 4HNAB 1VQPF 5G4VC 4IIJB 3IR9A 4X1IB 3MDOA 4YJ3A 3MQWA 3MBMA 1N8RH 3I56F 5ITZA 1QU9A 1FFXA 1RQ2A 1TVKB 3G71F 2LBWA 2CVLA 2RHLA 3LFOA 3ERNA 4ZOLA 2LCAA 3IMPA 4KWEA 3RYFA 3WJRA 4BT5A 1DT9A 3K14A 5HY2A 4BT2A 1U40A 5IJ9A 1SZQA 3S02A 3SIVA 2AIFA 3ON1A 3DDNA 1GO1A 1KNJA 5CA1A 3JARB 1VQLF 1W5EA 4BVSA 5MN6A 1IPAA 4B46A 2KGWA 3PAFA 4X1YA 2Z01A 3MCAB 3D00A 5FJ4C 3WGJA 4YJ2A 2CWJA 4F6RA 5LA6A 3I7TA 3JCMM 5LP6C 1VQMF 1XBIA 3VMFB 2AMTA 1IV1A 3JAKB 1T0AA 3RYIA 3TD4A 3CCEF 3U0OA 3M4SA 5CA0A 4ERHA 2HS4A 2ZVZA 3V7EA 2RHJA 5HXZA 5EIBD 4X3MA 1COMA 2Q1YA 3RYCA 1CN7A 3UT5A 2LBTA 5KMGB 1YITF 3LYBA 5GONA 4O2BB 2GVIA 3C9SA 3KHNA 1CK2A 2HQSC 4LCKA 2QTPA 1W40A 2RHOA 3VOAA 1KNKA 3LWPC 3OONA 1W59A 4IHJA 2GZLA 3ESJA 3HKCA 1YIJF 1K8AH 3WJQA 4XCQA 2HP0B 4TV9B 4I4TB 3LWOC 3IKFA 3RYHA 1QVGF 5JVDB 3CCVF 5J2TA 3B6NA 1Q8RA 1PXWA 4U39A 5MN5A 3IEWA 5JQGB 2HX0A 3QTYA 4RQOA 5HXUA 3E1YA 3VYTC 3CPWF 2UYNB 3R0PA 1GZ0A 4BT7A 2VAPA 4C8GA 1ZWZA 3F0EA 4FFBA 3IKEA 5BMVB 2V9YA 4O4HB 3S0YA 2ALEA 1VQ8F 2R751 3VYUC 3RA5A 1NJIH 2Z1FA 3SIUA 1JD1A 2ZOVA 1S72F 5EIBC 1TUBA 1W5BA 5EYPB 3N2GB 3V4DA 3ZP4A 3V7QA 1YJ9F 3E22B 4O2AA 4HNAA 1Z5WA 2MQEA 4IIJA 3VO8A 4X1IA 3WPWA 1T0KB 3QHDA 4X20B 3HKBA 3JATB 5JCOA 1J7HA 3CYPB 2ZAUA 1YGYA 4G4XA 5IYZB 1JY8A 2G9IA 1TVKA 4ZHWA 3JAWB 1GO0A 2UYKA 4ZK7A 4BVRA 1QAHA 4NQ3A 2VGNA 5JCOC 4BVQA 3K12A 3GYQA 5HY1A 1VQ6F 2OZBA 3ELCA 5GIPC 2I6RA 3AGKA 4BVTA 3JALA 4BW0B 3NMUC 3J7AR 3KJJA 5GAPK 3HWUA 1E7KA 3CB2A 2QA4F 5IJ0A 5EO3A 3ZO8A 4G4ZA 3JARA 3VTIC 3J81M 4ZHVA 5HP7A 3HAXD 2KG4A 5GIOC 4I55B 3JAKA 1W57A 1IV3A 3FBAA 3K0TA 4DXDA 3CCLF 4C8EA 1FNKA 4TUYA 1RA4A 5KX5B 1YQNA 1JJ2F 2B33A 5KMGA 5LOVB 5EZYB 4O2BA 4ZHYB 2WALA 4E6EA 3PLAC 1XRGA 2CSLA 3RYHB 5EWRA 1UI9A 2NMUA 1YHQF 1JFFB 1SA0B 3S0WA 2LBXA 2VGMA 4BT6A 2ZODA 5IT9M 2CZWA 5HY0A 5ITZB 2HP0A 3TD5A 1K73H 4TV9A 1VQ5F 4I4TA 5J2UB 2R6R1 3C9TA 4TV8B 5B8FA 5GINC 3NVKE 3EORA 3T80A 2YYEA 1W5AA 5LXTB 3CC2F 3S06A 4BT3A 3G6EF 3RYFB 3VCZA 3F0GA 3HKEA 5JQGA 1JN1A 2UYNA 5IJ9B 3JASB 3VOBA 5HY4A 1NMUB 2HP3A 1Q82H 2UYPA 3OBWA 5BMVA 4O4HA 3WGLA 2HS0A 3C9UA 2HVYD 2W8BC 5LP6B 5G4UC 1OAPA 2VXYA 4EB6A 2UZHA 1UFYA 3C9RA 4X1KA 3RA6A 5EYPA 2GLZA 3N2GA 3P0ZA 4RHAA 1U3PA 5LYJB 3S03A 5EAZA 2Z1TA 3CXCF 3HKDB 1YI2F 3LWVC 3M1XA 4X20A 3P10A 1XHOA 1KQSF 3JATA 4G4WA 3V3TA 1RLUA 2HRYA 5IYZA 4G88A 3JAWA 1Q7YH 3QUWA 2CW4A 1RQ7A 4B62A 4B45A 2HS3A 5FNVB 4I50B 3F0FA 2KTVA 5A2QM 1KC8H 4PWTA 4U3JB 4DRXB 3G4SF 3L7QA 4ZI7B 1VQOF 3CPQA 4LNUB 1VQKF 3JAMM 1FSZA 1H48A 4M8IA 2EWCA 4R40B 2HRUA 2AIZP 4C8IA 2OTLF 1VQNF 1YJWF 4NWOB 5AVMA 2YXZA 3GTZA 2BTUA 3HTNA 1VH8A 1W581 4O4IB 1IV4A 3RE3A 4EI7A 3DC2A 2PHNA 4I55A 3GHZA 1X25A 3CYQA 1KD1H 3KJKA 4C4WC 4C81A 1K9MH 2QI2A 3LMEA 4O4JB 5EB1B 3N2KB 3WGNA 2OTMA 1VQ7F 5KX5A 5HP8A 3FD5A 1W5FA 5CB4B 3Q8HA 3VIUA 5LOVA 1W3EX 5EZYA 1VK3A 1XV2A 3F6MA 1VHAA 2VAWA 1NQ3A 4O4LB 5JH7B 2RHHA 4WBNB 5C8YB 1JFFA 3JVHA 3CCRF 1PF5A 3ZP7A 1SA0A 3HKBB 4X3LA 4ZHQB 2FC3A 3CCQF 5J2UA 1OFUA 2VAMA 1CLIA 3KE1A 4TV8A 2CHTA 4G4YA 3CCJF 5MN4A 5LXTA 5FLXM 2H8CA 1ODEA 2Q1XA 2IAFA 1VQ4F 2IQQA 3F0DA 3WGMA 3CCSF 1VQ9F 2OTJF 3JALB 2F9ZC 3JASA 4YJ3B 3LDTA 3N4ZA 3TD3A 5IJ0B 1FFXB 1Q81H 3K2XA 3CD6F 1R1MA 1YJNF 5LP6A 4EI8A 1W41A 2Z1UA 5JVDA 4ZOLB 4EI9A 2H8EA 3CCUF 1Z5VA 5LYJA 1H7MA 3C8LA 1ONIA 3HKDA 2N48A 3NVIB 2PMPA 2ZVYA 4TUYB 3VI6A 3E20B 2QEXF 2KTUA 3OBYA 1X52A 5CA1B 3ZOPA 2JNBA 4X1YB 4YJ2B 3CCMF 2BO1A 3WPXA 1SDSA 4F6RB 5LA6B 3IEQA 3WXMB 3O85A 3I55F 3D54A 5FNVA 4I50A 3RYIB 3CC7F 3E22A 3CG6A 3WJPA 1DBFA 1QVFF 2K1SA 3BYQA 1X7OA 2I6DA 4U3JA 4C82A 4DRXA 5CA0B 3CC4F 4ZI7A 3KIZA 5EB0A 1FNJA 2CHSA 4LNUA 3RYCB 4BT4A 4TZZA 1W55A 1M90H 3UT5B 2ZF8A 2Z1EA 5GONB 1QD9A 2BTQB 5DCVA 3CMEF 3OW2F 1W2BF 5GANK 3HKEB 2L26A 4O4IA 3HJWC 4BY9D 2DYYA 4IHJB 3VYSC 1Q86H 3HKCB 3MCQA 1U43A 1X7PA 2DT4A
chains in the Genus database with same CATH topology
1XHOA 5HP7A 1UI9A 2UYKA 1ONIA 1FNJA 2CHSA 4ZK7A 1QAHA 3M4SA 2IG8A 4NWOB 2UYPA 1JD1A 2UYJA 3GTZA 3K12A 1QD9A 3I3FA 3K0TA 1NQ3A 3QUWA 2CW4A 1COMA 3ZOPA 3V4DA 3ZP4A 1PF5A 3ZP7A 3D01A 1FNKA 3MQWA 3LYBA 1X25A 1UFYA 3KJKA 3KJJA 2UYNA 2DYYA 1QU9A 3LMEA 2UYNB 3L7QA 2B33A 3R0PA 2CWJA 2CHTA 3ZO8A 2CVLA 2OTMA 1DBFA 3VCZA 1J7HA 5HP8A 3I7TA 2EWCA 1XRGA 2CSLA 3M1XA 1ODEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHO A;  5HP7 A;  1UI9 A;  2UYK A;  1ONI A;  1FNJ A;  2CHS A;  4ZK7 A;  1QAH A;  3M4S A;  2IG8 A;  4NWO B;  2UYP A;  1JD1 A;  2UYJ A;  3GTZ A;  3K12 A;  1QD9 A;  3I3F A;  3K0T A;  1NQ3 A;  3QUW A;  2CW4 A;  1COM A;  3ZOP A;  3V4D A;  3ZP4 A;  1PF5 A;  3ZP7 A;  3D01 A;  1FNK A;  3MQW A;  3LYB A;  1X25 A;  1UFY A;  3KJK A;  3KJJ A;  2UYN A;  2DYY A;  1QU9 A;  3LME A;  2UYN B;  3L7Q A;  2B33 A;  3R0P A;  2CWJ A;  2CHT A;  3ZO8 A;  2CVL A;  2OTM A;  1DBF A;  3VCZ A;  1J7H A;  5HP8 A;  3I7T A;  2EWC A;  1XRG A;  2CSL A;  3M1X A;  1ODE A; 
#chains in the Genus database with same CATH topology
 4O4J A;  3LWR C;  2FGY A;  3N2K A;  2H6L A;  2IG8 A;  4EB6 B;  5J2T B;  2UYJ A;  5CB4 A;  1GX1 A;  4X1K B;  3NK7 A;  2BTO A;  3N4Y A;  3M84 A;  4B5C A;  3FPI A;  1M1K H;  3D01 A;  1W42 A;  4O4L A;  5JH7 A;  5HWE A;  4FFB B;  5C8Y A;  4WBN A;  3J80 M;  1H47 A;  3FFM A;  3NK6 A;  3CMA F;  3FD6 A;  2RB9 A;  3P4E A;  4ZHQ A;  1VQV A;  3LWQ C;  4NUT A;  3S0H A;  1IV2 A;  2OHW A;  3WGK A;  1U3L A;  1TUB B;  4G4V A;  1RLG A;  2P6Y A;  4O2A B;  3I3F A;  4HNA B;  1VQP F;  5G4V C;  4IIJ B;  3IR9 A;  4X1I B;  3MDO A;  4YJ3 A;  3MQW A;  3MBM A;  1N8R H;  3I56 F;  5ITZ A;  1QU9 A;  1FFX A;  1RQ2 A;  1TVK B;  3G71 F;  2LBW A;  2CVL A;  2RHL A;  3LFO A;  3ERN A;  4ZOL A;  2LCA A;  3IMP A;  4KWE A;  3RYF A;  3WJR A;  4BT5 A;  1DT9 A;  3K14 A;  5HY2 A;  4BT2 A;  1U40 A;  5IJ9 A;  1SZQ A;  3S02 A;  3SIV A;  2AIF A;  3ON1 A;  3DDN A;  1GO1 A;  1KNJ A;  5CA1 A;  3JAR B;  1VQL F;  1W5E A;  4BVS A;  5MN6 A;  1IPA A;  4B46 A;  2KGW A;  3PAF A;  4X1Y A;  2Z01 A;  3MCA B;  3D00 A;  5FJ4 C;  3WGJ A;  4YJ2 A;  2CWJ A;  4F6R A;  5LA6 A;  3I7T A;  3JCM M;  5LP6 C;  1VQM F;  1XBI A;  3VMF B;  2AMT A;  1IV1 A;  3JAK B;  1T0A A;  3RYI A;  3TD4 A;  3CCE F;  3U0O A;  3M4S A;  5CA0 A;  4ERH A;  2HS4 A;  2ZVZ A;  3V7E A;  2RHJ A;  5HXZ A;  5EIB D;  4X3M A;  1COM A;  2Q1Y A;  3RYC A;  1CN7 A;  3UT5 A;  2LBT A;  5KMG B;  1YIT F;  3LYB A;  5GON A;  4O2B B;  2GVI A;  3C9S A;  3KHN A;  1CK2 A;  2HQS C;  4LCK A;  2QTP A;  1W40 A;  2RHO A;  3VOA A;  1KNK A;  3LWP C;  3OON A;  1W59 A;  4IHJ A;  2GZL A;  3ESJ A;  3HKC A;  1YIJ F;  1K8A H;  3WJQ A;  4XCQ A;  2HP0 B;  4TV9 B;  4I4T B;  3LWO C;  3IKF A;  3RYH A;  1QVG F;  5JVD B;  3CCV F;  5J2T A;  3B6N A;  1Q8R A;  1PXW A;  4U39 A;  5MN5 A;  3IEW A;  5JQG B;  2HX0 A;  3QTY A;  4RQO A;  5HXU A;  3E1Y A;  3VYT C;  3CPW F;  2UYN B;  3R0P A;  1GZ0 A;  4BT7 A;  2VAP A;  4C8G A;  1ZWZ A;  3F0E A;  4FFB A;  3IKE A;  5BMV B;  2V9Y A;  4O4H B;  3S0Y A;  2ALE A;  1VQ8 F;  2R75 1;  3VYU C;  3RA5 A;  1NJI H;  2Z1F A;  3SIU A;  1JD1 A;  2ZOV A;  1S72 F;  5EIB C;  1TUB A;  1W5B A;  5EYP B;  3N2G B;  3V4D A;  3ZP4 A;  3V7Q A;  1YJ9 F;  3E22 B;  4O2A A;  4HNA A;  1Z5W A;  2MQE A;  4IIJ A;  3VO8 A;  4X1I A;  3WPW A;  1T0K B;  3QHD A;  4X20 B;  3HKB A;  3JAT B;  5JCO A;  1J7H A;  3CYP B;  2ZAU A;  1YGY A;  4G4X A;  5IYZ B;  1JY8 A;  2G9I A;  1TVK A;  4ZHW A;  3JAW B;  1GO0 A;  2UYK A;  4ZK7 A;  4BVR A;  1QAH A;  4NQ3 A;  2VGN A;  5JCO C;  4BVQ A;  3K12 A;  3GYQ A;  5HY1 A;  1VQ6 F;  2OZB A;  3ELC A;  5GIP C;  2I6R A;  3AGK A;  4BVT A;  3JAL A;  4BW0 B;  3NMU C;  3J7A R;  3KJJ A;  5GAP K;  3HWU A;  1E7K A;  3CB2 A;  2QA4 F;  5IJ0 A;  5EO3 A;  3ZO8 A;  4G4Z A;  3JAR A;  3VTI C;  3J81 M;  4ZHV A;  5HP7 A;  3HAX D;  2KG4 A;  5GIO C;  4I55 B;  3JAK A;  1W57 A;  1IV3 A;  3FBA A;  3K0T A;  4DXD A;  3CCL F;  4C8E A;  1FNK A;  4TUY A;  1RA4 A;  5KX5 B;  1YQN A;  1JJ2 F;  2B33 A;  5KMG A;  5LOV B;  5EZY B;  4O2B A;  4ZHY B;  2WAL A;  4E6E A;  3PLA C;  1XRG A;  2CSL A;  3RYH B;  5EWR A;  1UI9 A;  2NMU A;  1YHQ F;  1JFF B;  1SA0 B;  3S0W A;  2LBX A;  2VGM A;  4BT6 A;  2ZOD A;  5IT9 M;  2CZW A;  5HY0 A;  5ITZ B;  2HP0 A;  3TD5 A;  1K73 H;  4TV9 A;  1VQ5 F;  4I4T A;  5J2U B;  2R6R 1;  3C9T A;  4TV8 B;  5B8F A;  5GIN C;  3NVK E;  3EOR A;  3T80 A;  2YYE A;  1W5A A;  5LXT B;  3CC2 F;  3S06 A;  4BT3 A;  3G6E F;  3RYF B;  3VCZ A;  3F0G A;  3HKE A;  5JQG A;  1JN1 A;  2UYN A;  5IJ9 B;  3JAS B;  3VOB A;  5HY4 A;  1NMU B;  2HP3 A;  1Q82 H;  2UYP A;  3OBW A;  5BMV A;  4O4H A;  3WGL A;  2HS0 A;  3C9U A;  2HVY D;  2W8B C;  5LP6 B;  5G4U C;  1OAP A;  2VXY A;  4EB6 A;  2UZH A;  1UFY A;  3C9R A;  4X1K A;  3RA6 A;  5EYP A;  2GLZ A;  3N2G A;  3P0Z A;  4RHA A;  1U3P A;  5LYJ B;  3S03 A;  5EAZ A;  2Z1T A;  3CXC F;  3HKD B;  1YI2 F;  3LWV C;  3M1X A;  4X20 A;  3P10 A;  1XHO A;  1KQS F;  3JAT A;  4G4W A;  3V3T A;  1RLU A;  2HRY A;  5IYZ A;  4G88 A;  3JAW A;  1Q7Y H;  3QUW A;  2CW4 A;  1RQ7 A;  4B62 A;  4B45 A;  2HS3 A;  5FNV B;  4I50 B;  3F0F A;  2KTV A;  5A2Q M;  1KC8 H;  4PWT A;  4U3J B;  4DRX B;  3G4S F;  3L7Q A;  4ZI7 B;  1VQO F;  3CPQ A;  4LNU B;  1VQK F;  3JAM M;  1FSZ A;  1H48 A;  4M8I A;  2EWC A;  4R40 B;  2HRU A;  2AIZ P;  4C8I A;  2OTL F;  1VQN F;  1YJW F;  4NWO B;  5AVM A;  2YXZ A;  3GTZ A;  2BTU A;  3HTN A;  1VH8 A;  1W58 1;  4O4I B;  1IV4 A;  3RE3 A;  4EI7 A;  3DC2 A;  2PHN A;  4I55 A;  3GHZ A;  1X25 A;  3CYQ A;  1KD1 H;  3KJK A;  4C4W C;  4C81 A;  1K9M H;  2QI2 A;  3LME A;  4O4J B;  5EB1 B;  3N2K B;  3WGN A;  2OTM A;  1VQ7 F;  5KX5 A;  5HP8 A;  3FD5 A;  1W5F A;  5CB4 B;  3Q8H A;  3VIU A;  5LOV A;  1W3E X;  5EZY A;  1VK3 A;  1XV2 A;  3F6M A;  1VHA A;  2VAW A;  1NQ3 A;  4O4L B;  5JH7 B;  2RHH A;  4WBN B;  5C8Y B;  1JFF A;  3JVH A;  3CCR F;  1PF5 A;  3ZP7 A;  1SA0 A;  3HKB B;  4X3L A;  4ZHQ B;  2FC3 A;  3CCQ F;  5J2U A;  1OFU A;  2VAM A;  1CLI A;  3KE1 A;  4TV8 A;  2CHT A;  4G4Y A;  3CCJ F;  5MN4 A;  5LXT A;  5FLX M;  2H8C A;  1ODE A;  2Q1X A;  2IAF A;  1VQ4 F;  2IQQ A;  3F0D A;  3WGM A;  3CCS F;  1VQ9 F;  2OTJ F;  3JAL B;  2F9Z C;  3JAS A;  4YJ3 B;  3LDT A;  3N4Z A;  3TD3 A;  5IJ0 B;  1FFX B;  1Q81 H;  3K2X A;  3CD6 F;  1R1M A;  1YJN F;  5LP6 A;  4EI8 A;  1W41 A;  2Z1U A;  5JVD A;  4ZOL B;  4EI9 A;  2H8E A;  3CCU F;  1Z5V A;  5LYJ A;  1H7M A;  3C8L A;  1ONI A;  3HKD A;  2N48 A;  3NVI B;  2PMP A;  2ZVY A;  4TUY B;  3VI6 A;  3E20 B;  2QEX F;  2KTU A;  3OBY A;  1X52 A;  5CA1 B;  3ZOP A;  2JNB A;  4X1Y B;  4YJ2 B;  3CCM F;  2BO1 A;  3WPX A;  1SDS A;  4F6R B;  5LA6 B;  3IEQ A;  3WXM B;  3O85 A;  3I55 F;  3D54 A;  5FNV A;  4I50 A;  3RYI B;  3CC7 F;  3E22 A;  3CG6 A;  3WJP A;  1DBF A;  1QVF F;  2K1S A;  3BYQ A;  1X7O A;  2I6D A;  4U3J A;  4C82 A;  4DRX A;  5CA0 B;  3CC4 F;  4ZI7 A;  3KIZ A;  5EB0 A;  1FNJ A;  2CHS A;  4LNU A;  3RYC B;  4BT4 A;  4TZZ A;  1W55 A;  1M90 H;  3UT5 B;  2ZF8 A;  2Z1E A;  5GON B;  1QD9 A;  2BTQ B;  5DCV A;  3CME F;  3OW2 F;  1W2B F;  5GAN K;  3HKE B;  2L26 A;  4O4I A;  3HJW C;  4BY9 D;  2DYY A;  4IHJ B;  3VYS C;  1Q86 H;  3HKC B;  3MCQ A;  1U43 A;  1X7P A;  2DT4 A; 
#chains in the Genus database with same CATH homology
 1XHO A;  5HP7 A;  1UI9 A;  2UYK A;  1ONI A;  1FNJ A;  2CHS A;  4ZK7 A;  1QAH A;  3M4S A;  2IG8 A;  4NWO B;  2UYP A;  1JD1 A;  2UYJ A;  3GTZ A;  3K12 A;  1QD9 A;  3I3F A;  3K0T A;  1NQ3 A;  3QUW A;  2CW4 A;  1COM A;  3ZOP A;  3V4D A;  3ZP4 A;  1PF5 A;  3ZP7 A;  3D01 A;  1FNK A;  3MQW A;  3LYB A;  1X25 A;  1UFY A;  3KJK A;  3KJJ A;  2UYN A;  2DYY A;  1QU9 A;  3LME A;  2UYN B;  3L7Q A;  2B33 A;  3R0P A;  2CWJ A;  2CHT A;  3ZO8 A;  2CVL A;  2OTM A;  1DBF A;  3VCZ A;  1J7H A;  5HP8 A;  3I7T A;  2EWC A;  1XRG A;  2CSL A;  3M1X A;  1ODE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...