2B33A

Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
MKRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Protein synthesis inhibitor, putative (tm0215) from THERMOTOGA MARITIMA at 2.30 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords protein synthesis inhibitor, putative
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2b33A00
3R0PA 2CWJA 2B33A 1QD9A 1ONIA 3I7TA 3ZOPA 1UI9A 3QUWA 2IG8A 1COMA 1PF5A 2UYNA 3D01A 2UYKA 1XRGA 3KJKA 3M1XA 2CHTA 3I3FA 2CSLA 5HP8A 1JD1A 2CW4A 1XHOA 2UYPA 3K0TA 3LMEA 4ZK7A 5HP7A 3K12A 2UYNB 1ODEA 4NWOB 1FNKA 1X25A 3KJJA 1J7HA 3LYBA 1QAHA 2OTMA 2UYJA 2DYYA 3L7QA 3VCZA 3M4SA 3ZP4A 3ZO8A 2EWCA 3GTZA 1NQ3A 1FNJA 2CHSA 3ZP7A 1DBFA 1QU9A 3MQWA 3V4DA 1UFYA 2CVLA
chains in the Genus database with same CATH superfamily
1NJIH 5LP6C 3JASB 2NMUA 5GINC 1W2BF 3JASA 1JFFA 2V9YA 1U3LA 2QTPA 2UZHA 3E22A 3M1XA 4EB6A 5B8FA 4R40B 1U3PA 5JH7B 2UYNB 1KNKA 5J2TA 3FFMA 1QAHA 1W581 3ZP4A 2FGYA 3IKEA 5KMGB 3TD3A 5HY4A 2EWCA 4G4YA 5KMGA 3BYQA 2HQSC 4ZHVA 3CPQA 3E1YA 3QTYA 3FBAA 2HS4A 3AGKA 2CWJA 1K8AH 3HWUA 1VQ7F 3DC2A 3KIZA 3CCQF 3DDNA 4PWTA 4NUTA 4TUYA 5FNVA 2YXZA 5HP8A 2N48A 1H7MA 3RYCB 4B45A 3VYUC 4TUYB 5FNVB 1XBIA 4G4ZA 5IJ0A 4LNUA 4I4TA 4XCQA 1VQ6F 3I55F 1X52A 3VCZA 1IV4A 1U43A 5HXZA 3JAKB 2OTLF 3NK6A 3C9RA 3ERNA 5C8YB 3V7QA 3VI6A 1DBFA 3V4DA 3RYFA 5LXTA 3D00A 4FFBA 1TUBB 5HXUA 3HAXD 3RYHA 2IG8A 5JH7A 2UYNA 1VQMF 3U0OA 3HKCB 3ESJA 5HP7A 4I50A 4BT2A 2ZF8A 1X25A 3CC4F 4U3JB 4IHJB 1VQ5F 3N2KB 3VMFB 3M4SA 3JALB 5EB1B 3NK7A 1DT9A 4O2AB 1QVFF 2ZOVA 4B5CA 3N2GB 1RQ2A 1XV2A 2B33A 1QD9A 3I7TA 3C9SA 3CCJF 4ZI7B 2CSLA 2BTOA 4YJ3A 3GHZA 4I55A 1VQLF 3CD6F 1VH8A 4EI9A 3CMEF 4BY9D 2DT4A 3KHNA 3CC7F 2QEXF 2BO1A 2IAFA 4C8EA 4ZHYB 2G9IA 1JN1A 2R6R1 3RYIB 3R0PA 3F6MA 4ZHQB 1RLUA 3CCEF 4I4TB 2AMTA 2LBXA 1YHQF 1H47A 4HNAB 3LDTA 2CHTA 3C9UA 4BW0B 3JALA 1GO1A 1S72F 1E7KA 2MQEA 3S02A 4NWOB 3WXMB 5EO3A 2RHLA 3FD5A 2F9ZC 2HX0A 3CMAF 3IEQA 1T0KB 5LA6B 4BT3A 1UFYA 2L26A 3FD6A 3NMUC 1IV2A 1Q82H 2HP0A 1COMA 5IYZA 3N2GA 4NQ3A 2LBWA 2HVYD 5EIBC 2LCAA 1W5AA 3HKEA 4M8IA 1VQOF 3WGNA 4ZI7A 3UT5A 3L7QA 5EB0A 1Z5WA 3MDOA 1W5BA 1OFUA 1NMUB 3EORA 1GZ0A 4G4WA 5LA6A 1YQNA 4RHAA 4DXDA 3LFOA 4I55B 5A2QM 4F6RB 2RHHA 3TD5A 3OONA 2Q1YA 1IPAA 2Q1XA 1XHOA 2HS0A 4X3MA 4B46A 4E6EA 5LOVA 1KD1H 3Q8HA 3CPWF 2VAMA 4HNAA 4O4LA 5MN5A 4LNUB 3JCMM 2I6DA 5EYPA 4WBNA 1JFFB 3P4EA 3K2XA 3RYFB 5FLXM 5LXTB 3CCUF 4RQOA 1JY8A 2R751 1M90H 5DCVA 1Q86H 5KX5A 2IQQA 1T0AA 4BT4A 1XRGA 3O85A 2W8BC 3F0DA 3I3FA 3RYIA 1KQSF 4G4VA 3PAFA 3S0YA 3K12A 3JATA 5CA1A 3S06A 3RYCA 1N8RH 1VQ4F 1RA4A 5EAZA 1W59A 3HKEB 2RB9A 3HKDA 5J2TB 5EWRA 3VOBA 3VYSC 3GTZA 5JCOA 4ZHQA 4LCKA 2GLZA 3C8LA 4G88A 3JARA 5LP6B 3MCAB 1VQPF 1GO0A 4X3LA 3J7AR 2VAWA 3WPWA 3NVIB 1PF5A 2I6RA 2Z1FA 4X1IB 4BT6A 3JAKA 3CC2F 2KG4A 3B6NA 3WGLA 2KTVA 3K0TA 5GONB 5IJ9A 2QA4F 1FNKA 4O4HA 2PMPA 3RE3A 2JNBA 3CXCF 1YGYA 5CA0B 3CCSF 1YJ9F 1FFXB 1M1KH 2CHSA 3OBWA 4EI7A 5BMVB 4TZZA 3WGKA 1X7OA 4EI8A 4O2AA 2AIFA 1ONIA 3IKFA 4BT7A 4BVSA 2BTUA 4C8GA 1TUBA 2PHNA 4O4IA 3JVHA 3LWRC 2RHJA 2Z1EA 2CZWA 1RLGA 1JD1A 1CLIA 4X1KB 1W5EA 4O4IB 5JCOC 4C8IA 2VGMA 5G4VC 4G4XA 2ZODA 4U39A 5J2UB 2RHOA 1NQ3A 2Z01A 3HKDB 3QHDA 1FFXA 1ZWZA 1VQ8F 2P6YA 3CB2A 3WJQA 3JATB 5CA1B 3PLAC 3ZOPA 3JARB 5LP6A 2WALA 1W5FA 5IJ9B 3IMPA 4IIJA 3WGMA 1K73H 4O4LB 3E20B 2LBTA 4ZHWA 3CCRF 3FPIA 4X1YA 5ITZB 3RA6A 2BTQB 5BMVA 1OAPA 3UT5B 3MBMA 1Q8RA 5EZYA 3CCVF 2DYYA 2VGNA 4ZOLA 5C8YA 3HKCA 3G4SF 5J2UA 3I56F 5GONA 3VTIC 1W3EX 1QU9A 2Z1TA 2ZAUA 2CVLA 3G6EF 2VXYA 4BVQA 1YI2F 3HKBA 4X1KA 4C4WC 3V7EA 1FSZA 5JQGB 5GANK 3SIUA 1R1MA 3OW2F 2AIZP 3RA5A 1IV1A 3HKBB 1TVKA 5GAPK 4BVRA 3F0FA 3IEWA 5HY2A 3LWQC 1VQKF 3LWVC 2ZVYA 1JJ2F 2H8CA 2H8EA 3ELCA 2VAPA 3KJJA 4YJ3B 3ZO8A 2HRUA 4O2BA 5LYJA 5HY0A 1Q81H 5MN4A 1U40A 5JVDA 4I50B 2KTUA 5CB4A 5GIPC 5IT9M 1Z5VA 4C81A 3JAWA 2ALEA 4TV9B 5KX5B 2KGWA 3N4YA 3KJKA 1W55A 5IYZB 5GIOC 4ZOLB 2UYPA 1TVKB 3ON1A 5CA0A 1W42A 3N2KA 4BVTA 3CG6A 4KWEA 2H6LA 1YITF 1J7HA 2OTMA 4X1YB 5ITZA 3CCMF 3VOAA 4DRXB 2YYEA 4IIJB 1YJNF 1CK2A 3HTNA 2HS3A 3F0GA 5LOVB 3LWOC 1RQ7A 1KNJA 1KC8H 1W41A 1UI9A 3QUWA 3J81M 3V3TA 1SDSA 2OTJF 3P10A 3VYTC 3KE1A 1VK3A 5G4UC 3CYQA 3GYQA 1PXWA 1YIJF 3SIVA 4YJ2A 4X20A 3T80A 4ZK7A 2ZVZA 2HP3A 2HP0B 1ODEA 1X7PA 5MN6A 4C82A 4ERHA 3WJPA 4U3JA 4O4HB 2Z1UA 3MCQA 1SZQA 4TV8A 2OZBA 5FJ4C 1FNJA 4WBNB 1QVGF 4DRXA 3WJRA 3S0WA 3OBYA 2HRYA 3WPXA 3E22B 4EB6B 3P0ZA 2FC3A 1K9MH 5JVDB 2UYKA 5EZYB 4O4JA 1VHAA 2GVIA 2CW4A 5HWEA 1W40A 3M84A 4YJ2B 3VIUA 4BT5A 3IR9A 4TV9A 3JAMM 3G71F 1H48A 2OHWA 3S0HA 1VQ9F 2UYJA 3JAWB 3F0EA 3S03A 3RYHB 3CCLF 3CYPB 3N4ZA 3TD4A 1YJWF 1VQNF 3MQWA 4IHJA 5JQGA 1IV3A 5EYPB 3LWPC 4X20B 3D01A 5AVMA 1GX1A 3HJWC 3NVKE 3VO8A 5IJ0B 5CB4B 4O4JB 3J80M 3LMEA 4TV8B 1Q7YH 5HY1A 3WGJA 1W57A 4F6RA 4O2BB 5LYJB 3LYBA 1CN7A 3D54A 2K1SA 3K14A 4B62A 1VQVA 1SA0B 3C9TA 2GZLA 3ZP7A 2QI2A 1SA0A 4FFBB 4X1IA 5EIBD
chains in the Genus database with same CATH topology
3R0PA 2CWJA 2B33A 1QD9A 1ONIA 3I7TA 3ZOPA 1UI9A 3QUWA 2IG8A 1COMA 1PF5A 2UYNA 3D01A 2UYKA 1XRGA 3KJKA 3M1XA 2CHTA 3I3FA 2CSLA 5HP8A 1JD1A 2CW4A 1XHOA 2UYPA 3K0TA 3LMEA 4ZK7A 5HP7A 3K12A 2UYNB 1ODEA 4NWOB 1FNKA 1X25A 3KJJA 1J7HA 3LYBA 1QAHA 2OTMA 2UYJA 2DYYA 3L7QA 3VCZA 3M4SA 3ZP4A 3ZO8A 2EWCA 3GTZA 1NQ3A 1FNJA 2CHSA 3ZP7A 1DBFA 1QU9A 3MQWA 3V4DA 1UFYA 2CVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0P A;  2CWJ A;  2B33 A;  1QD9 A;  1ONI A;  3I7T A;  3ZOP A;  1UI9 A;  3QUW A;  2IG8 A;  1COM A;  1PF5 A;  2UYN A;  3D01 A;  2UYK A;  1XRG A;  3KJK A;  3M1X A;  2CHT A;  3I3F A;  2CSL A;  5HP8 A;  1JD1 A;  2CW4 A;  1XHO A;  2UYP A;  3K0T A;  3LME A;  4ZK7 A;  5HP7 A;  3K12 A;  2UYN B;  1ODE A;  4NWO B;  1FNK A;  1X25 A;  3KJJ A;  1J7H A;  3LYB A;  1QAH A;  2OTM A;  2UYJ A;  2DYY A;  3L7Q A;  3VCZ A;  3M4S A;  3ZP4 A;  3ZO8 A;  2EWC A;  3GTZ A;  1NQ3 A;  1FNJ A;  2CHS A;  3ZP7 A;  1DBF A;  1QU9 A;  3MQW A;  3V4D A;  1UFY A;  2CVL A; 
#chains in the Genus database with same CATH topology
 1NJI H;  5LP6 C;  3JAS B;  2NMU A;  5GIN C;  1W2B F;  3JAS A;  1JFF A;  2V9Y A;  1U3L A;  2QTP A;  2UZH A;  3E22 A;  3M1X A;  4EB6 A;  5B8F A;  4R40 B;  1U3P A;  5JH7 B;  2UYN B;  1KNK A;  5J2T A;  3FFM A;  1QAH A;  1W58 1;  3ZP4 A;  2FGY A;  3IKE A;  5KMG B;  3TD3 A;  5HY4 A;  2EWC A;  4G4Y A;  5KMG A;  3BYQ A;  2HQS C;  4ZHV A;  3CPQ A;  3E1Y A;  3QTY A;  3FBA A;  2HS4 A;  3AGK A;  2CWJ A;  1K8A H;  3HWU A;  1VQ7 F;  3DC2 A;  3KIZ A;  3CCQ F;  3DDN A;  4PWT A;  4NUT A;  4TUY A;  5FNV A;  2YXZ A;  5HP8 A;  2N48 A;  1H7M A;  3RYC B;  4B45 A;  3VYU C;  4TUY B;  5FNV B;  1XBI A;  4G4Z A;  5IJ0 A;  4LNU A;  4I4T A;  4XCQ A;  1VQ6 F;  3I55 F;  1X52 A;  3VCZ A;  1IV4 A;  1U43 A;  5HXZ A;  3JAK B;  2OTL F;  3NK6 A;  3C9R A;  3ERN A;  5C8Y B;  3V7Q A;  3VI6 A;  1DBF A;  3V4D A;  3RYF A;  5LXT A;  3D00 A;  4FFB A;  1TUB B;  5HXU A;  3HAX D;  3RYH A;  2IG8 A;  5JH7 A;  2UYN A;  1VQM F;  3U0O A;  3HKC B;  3ESJ A;  5HP7 A;  4I50 A;  4BT2 A;  2ZF8 A;  1X25 A;  3CC4 F;  4U3J B;  4IHJ B;  1VQ5 F;  3N2K B;  3VMF B;  3M4S A;  3JAL B;  5EB1 B;  3NK7 A;  1DT9 A;  4O2A B;  1QVF F;  2ZOV A;  4B5C A;  3N2G B;  1RQ2 A;  1XV2 A;  2B33 A;  1QD9 A;  3I7T A;  3C9S A;  3CCJ F;  4ZI7 B;  2CSL A;  2BTO A;  4YJ3 A;  3GHZ A;  4I55 A;  1VQL F;  3CD6 F;  1VH8 A;  4EI9 A;  3CME F;  4BY9 D;  2DT4 A;  3KHN A;  3CC7 F;  2QEX F;  2BO1 A;  2IAF A;  4C8E A;  4ZHY B;  2G9I A;  1JN1 A;  2R6R 1;  3RYI B;  3R0P A;  3F6M A;  4ZHQ B;  1RLU A;  3CCE F;  4I4T B;  2AMT A;  2LBX A;  1YHQ F;  1H47 A;  4HNA B;  3LDT A;  2CHT A;  3C9U A;  4BW0 B;  3JAL A;  1GO1 A;  1S72 F;  1E7K A;  2MQE A;  3S02 A;  4NWO B;  3WXM B;  5EO3 A;  2RHL A;  3FD5 A;  2F9Z C;  2HX0 A;  3CMA F;  3IEQ A;  1T0K B;  5LA6 B;  4BT3 A;  1UFY A;  2L26 A;  3FD6 A;  3NMU C;  1IV2 A;  1Q82 H;  2HP0 A;  1COM A;  5IYZ A;  3N2G A;  4NQ3 A;  2LBW A;  2HVY D;  5EIB C;  2LCA A;  1W5A A;  3HKE A;  4M8I A;  1VQO F;  3WGN A;  4ZI7 A;  3UT5 A;  3L7Q A;  5EB0 A;  1Z5W A;  3MDO A;  1W5B A;  1OFU A;  1NMU B;  3EOR A;  1GZ0 A;  4G4W A;  5LA6 A;  1YQN A;  4RHA A;  4DXD A;  3LFO A;  4I55 B;  5A2Q M;  4F6R B;  2RHH A;  3TD5 A;  3OON A;  2Q1Y A;  1IPA A;  2Q1X A;  1XHO A;  2HS0 A;  4X3M A;  4B46 A;  4E6E A;  5LOV A;  1KD1 H;  3Q8H A;  3CPW F;  2VAM A;  4HNA A;  4O4L A;  5MN5 A;  4LNU B;  3JCM M;  2I6D A;  5EYP A;  4WBN A;  1JFF B;  3P4E A;  3K2X A;  3RYF B;  5FLX M;  5LXT B;  3CCU F;  4RQO A;  1JY8 A;  2R75 1;  1M90 H;  5DCV A;  1Q86 H;  5KX5 A;  2IQQ A;  1T0A A;  4BT4 A;  1XRG A;  3O85 A;  2W8B C;  3F0D A;  3I3F A;  3RYI A;  1KQS F;  4G4V A;  3PAF A;  3S0Y A;  3K12 A;  3JAT A;  5CA1 A;  3S06 A;  3RYC A;  1N8R H;  1VQ4 F;  1RA4 A;  5EAZ A;  1W59 A;  3HKE B;  2RB9 A;  3HKD A;  5J2T B;  5EWR A;  3VOB A;  3VYS C;  3GTZ A;  5JCO A;  4ZHQ A;  4LCK A;  2GLZ A;  3C8L A;  4G88 A;  3JAR A;  5LP6 B;  3MCA B;  1VQP F;  1GO0 A;  4X3L A;  3J7A R;  2VAW A;  3WPW A;  3NVI B;  1PF5 A;  2I6R A;  2Z1F A;  4X1I B;  4BT6 A;  3JAK A;  3CC2 F;  2KG4 A;  3B6N A;  3WGL A;  2KTV A;  3K0T A;  5GON B;  5IJ9 A;  2QA4 F;  1FNK A;  4O4H A;  2PMP A;  3RE3 A;  2JNB A;  3CXC F;  1YGY A;  5CA0 B;  3CCS F;  1YJ9 F;  1FFX B;  1M1K H;  2CHS A;  3OBW A;  4EI7 A;  5BMV B;  4TZZ A;  3WGK A;  1X7O A;  4EI8 A;  4O2A A;  2AIF A;  1ONI A;  3IKF A;  4BT7 A;  4BVS A;  2BTU A;  4C8G A;  1TUB A;  2PHN A;  4O4I A;  3JVH A;  3LWR C;  2RHJ A;  2Z1E A;  2CZW A;  1RLG A;  1JD1 A;  1CLI A;  4X1K B;  1W5E A;  4O4I B;  5JCO C;  4C8I A;  2VGM A;  5G4V C;  4G4X A;  2ZOD A;  4U39 A;  5J2U B;  2RHO A;  1NQ3 A;  2Z01 A;  3HKD B;  3QHD A;  1FFX A;  1ZWZ A;  1VQ8 F;  2P6Y A;  3CB2 A;  3WJQ A;  3JAT B;  5CA1 B;  3PLA C;  3ZOP A;  3JAR B;  5LP6 A;  2WAL A;  1W5F A;  5IJ9 B;  3IMP A;  4IIJ A;  3WGM A;  1K73 H;  4O4L B;  3E20 B;  2LBT A;  4ZHW A;  3CCR F;  3FPI A;  4X1Y A;  5ITZ B;  3RA6 A;  2BTQ B;  5BMV A;  1OAP A;  3UT5 B;  3MBM A;  1Q8R A;  5EZY A;  3CCV F;  2DYY A;  2VGN A;  4ZOL A;  5C8Y A;  3HKC A;  3G4S F;  5J2U A;  3I56 F;  5GON A;  3VTI C;  1W3E X;  1QU9 A;  2Z1T A;  2ZAU A;  2CVL A;  3G6E F;  2VXY A;  4BVQ A;  1YI2 F;  3HKB A;  4X1K A;  4C4W C;  3V7E A;  1FSZ A;  5JQG B;  5GAN K;  3SIU A;  1R1M A;  3OW2 F;  2AIZ P;  3RA5 A;  1IV1 A;  3HKB B;  1TVK A;  5GAP K;  4BVR A;  3F0F A;  3IEW A;  5HY2 A;  3LWQ C;  1VQK F;  3LWV C;  2ZVY A;  1JJ2 F;  2H8C A;  2H8E A;  3ELC A;  2VAP A;  3KJJ A;  4YJ3 B;  3ZO8 A;  2HRU A;  4O2B A;  5LYJ A;  5HY0 A;  1Q81 H;  5MN4 A;  1U40 A;  5JVD A;  4I50 B;  2KTU A;  5CB4 A;  5GIP C;  5IT9 M;  1Z5V A;  4C81 A;  3JAW A;  2ALE A;  4TV9 B;  5KX5 B;  2KGW A;  3N4Y A;  3KJK A;  1W55 A;  5IYZ B;  5GIO C;  4ZOL B;  2UYP A;  1TVK B;  3ON1 A;  5CA0 A;  1W42 A;  3N2K A;  4BVT A;  3CG6 A;  4KWE A;  2H6L A;  1YIT F;  1J7H A;  2OTM A;  4X1Y B;  5ITZ A;  3CCM F;  3VOA A;  4DRX B;  2YYE A;  4IIJ B;  1YJN F;  1CK2 A;  3HTN A;  2HS3 A;  3F0G A;  5LOV B;  3LWO C;  1RQ7 A;  1KNJ A;  1KC8 H;  1W41 A;  1UI9 A;  3QUW A;  3J81 M;  3V3T A;  1SDS A;  2OTJ F;  3P10 A;  3VYT C;  3KE1 A;  1VK3 A;  5G4U C;  3CYQ A;  3GYQ A;  1PXW A;  1YIJ F;  3SIV A;  4YJ2 A;  4X20 A;  3T80 A;  4ZK7 A;  2ZVZ A;  2HP3 A;  2HP0 B;  1ODE A;  1X7P A;  5MN6 A;  4C82 A;  4ERH A;  3WJP A;  4U3J A;  4O4H B;  2Z1U A;  3MCQ A;  1SZQ A;  4TV8 A;  2OZB A;  5FJ4 C;  1FNJ A;  4WBN B;  1QVG F;  4DRX A;  3WJR A;  3S0W A;  3OBY A;  2HRY A;  3WPX A;  3E22 B;  4EB6 B;  3P0Z A;  2FC3 A;  1K9M H;  5JVD B;  2UYK A;  5EZY B;  4O4J A;  1VHA A;  2GVI A;  2CW4 A;  5HWE A;  1W40 A;  3M84 A;  4YJ2 B;  3VIU A;  4BT5 A;  3IR9 A;  4TV9 A;  3JAM M;  3G71 F;  1H48 A;  2OHW A;  3S0H A;  1VQ9 F;  2UYJ A;  3JAW B;  3F0E A;  3S03 A;  3RYH B;  3CCL F;  3CYP B;  3N4Z A;  3TD4 A;  1YJW F;  1VQN F;  3MQW A;  4IHJ A;  5JQG A;  1IV3 A;  5EYP B;  3LWP C;  4X20 B;  3D01 A;  5AVM A;  1GX1 A;  3HJW C;  3NVK E;  3VO8 A;  5IJ0 B;  5CB4 B;  4O4J B;  3J80 M;  3LME A;  4TV8 B;  1Q7Y H;  5HY1 A;  3WGJ A;  1W57 A;  4F6R A;  4O2B B;  5LYJ B;  3LYB A;  1CN7 A;  3D54 A;  2K1S A;  3K14 A;  4B62 A;  1VQV A;  1SA0 B;  3C9T A;  2GZL A;  3ZP7 A;  2QI2 A;  1SA0 A;  4FFB B;  4X1I A;  5EIB D; 
#chains in the Genus database with same CATH homology
 3R0P A;  2CWJ A;  2B33 A;  1QD9 A;  1ONI A;  3I7T A;  3ZOP A;  1UI9 A;  3QUW A;  2IG8 A;  1COM A;  1PF5 A;  2UYN A;  3D01 A;  2UYK A;  1XRG A;  3KJK A;  3M1X A;  2CHT A;  3I3F A;  2CSL A;  5HP8 A;  1JD1 A;  2CW4 A;  1XHO A;  2UYP A;  3K0T A;  3LME A;  4ZK7 A;  5HP7 A;  3K12 A;  2UYN B;  1ODE A;  4NWO B;  1FNK A;  1X25 A;  3KJJ A;  1J7H A;  3LYB A;  1QAH A;  2OTM A;  2UYJ A;  2DYY A;  3L7Q A;  3VCZ A;  3M4S A;  3ZP4 A;  3ZO8 A;  2EWC A;  3GTZ A;  1NQ3 A;  1FNJ A;  2CHS A;  3ZP7 A;  1DBF A;  1QU9 A;  3MQW A;  3V4D A;  1UFY A;  2CVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...