3CMEF

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cmeF00
4LCKA 5DCVA 1YITF 3J7AR 1E7KA 3AGKA 3CD6F 3I56F 3I55F 4BY9D 1T0KB 2KG4A 5GANK 1S72F 3LWOC 1Q86H 3LWPC 1K73H 1K9MH 1VQ5F 3OW2F 1VQ6F 1X7PA 3O85A 1Q82H 1NMUB 3CCJF 5GIOC 1H7MA 1W40A 4BW0B 1VQOF 1CN7A 2VGNA 1GO0A 5EWRA 3CG6A 3IR9A 1W2BF 3CCVF 3NVKE 2CZWA 1KC8H 1X7OA 3HAXD 2AIFA 1W3EX 1X52A 3J81M 3NMUC 4X3LA 5IT9M 5FLXM 1KD1H 2OZBA 1ZWZA 2JNBA 3FFMA 1VQMF 3SIVA 1Q7YH 1VQKF 1W41A 3CCUF 3RA5A 1RLGA 3CPWF 2VGMA 1VQ7F 5G4UC 3CCMF 3PLAC 1M1KH 5GAPK 3NK7A 3N4YA 3GYQA 3OBYA 5EO3A 2QI2A 3LFOA 3CC2F 3WXMB 3J80M 2FC3A 3G4SF 3CCEF 1NJIH 1VQLF 1IPAA 1YJ9F 1VQ4F 1VQNF 3E1YA 3G6EF 1VQ8F 3E20B 3V7QA 2LBXA 3LWRC 1DT9A 3CMEF 1YJNF 3ON1A 1RA4A 3V7EA 1W42A 1QVGF 3JCMM 3VMFB 2BO1A 3PAFA 3CPQA 3LWQC 1KQSF 1VQPF 3CC7F 5FJ4C 2OHWA 5A2QM 1YIJF 1VQ9F 2ALEA 4C4WC 4TZZA 3CCLF 1M90H 2LBWA 1QVFF 3LWVC 1XBIA 2HVYD 1Q81H 3NK6A 3CCSF 1JJ2F 2OTJF 5GIPC 1N8RH 3CXCF 5GINC 3N4ZA 1SDSA 2KTUA 1GO1A 3MCAB 3G71F 3CCQF 2QA4F 3RA6A 3JAMM 1GZ0A 1YJWF 2OTLF 3CMAF 3CC4F 1CK2A 2QEXF 1PXWA 1YI2F 3HJWC 4NUTA 1YHQF 3SIUA 2KTVA 3CCRF 2I6DA 4X3MA 2WALA 1K8AH 3VI6A 5G4VC 3OBWA 3NVIB
chains in the Genus database with same CATH superfamily
4ZOLA 4I50A 3LMEA 3RYHA 5IJ9B 5LA6A 4O4LB 3QHDA 3N2KA 3QUWA 4LNUA 5MN4A 3I55F 5CA0A 1T0KB 2KG4A 4R40B 3JALB 3LWOC 1Q86H 4O4JB 3VTIC 3VIUA 4X1IB 1FFXB 2DT4A 3JASB 3O85A 3CCJF 4BT2A 4I4TA 1SA0A 5CB4A 1CN7A 1RQ2A 4X20A 2RHHA 3D01A 4G4XA 3K12A 2CZWA 1KC8H 2UZHA 3NVKE 4X1YB 3J81M 3TD5A 5IT9M 5HP7A 1KD1H 2OZBA 3WJRA 4YJ3A 2GVIA 1VQKF 5CA1A 5ITZB 3IKFA 1RLGA 4BT6A 2VGMA 2GZLA 4O4HB 2H6LA 2AMTA 3PLAC 2HS3A 2VAWA 3JAWB 4PWTA 3OBYA 3JATA 5EO3A 2QI2A 4FFBA 3HKCA 5IJ0A 3WJQA 1KNKA 3S03A 3J80M 3G4SF 3F0DA 1YQNA 1JFFB 3E22B 1DT9A 3K2XA 3VO8A 1NQ3A 4NQ3A 1W581 2W8BC 5KMGA 3JCMM 3VMFB 5HXZA 2BO1A 1H48A 2UYNB 3PAFA 3CPQA 3UT5B 2B33A 3LWQC 4ZOLB 4I50B 3FBAA 3RYHB 4C4WC 4TZZA 3CCLF 5LA6B 1QVFF 3TD3A 2CHTA 1Q81H 1JJ2F 1U3LA 3N2KB 3S0WA 5GIPC 2BTOA 4LNUB 3CCSF 5CA0B 1W5BA 3VYSC 5GINC 3IEQA 2H8CA 2H8EA 2Z1EA 5EYPA 3Q8HA 3ZP7A 4ZHWA 1GZ0A 1JN1A 1T0AA 5LP6A 3LYBA 2CHSA 5CB4B 4TV8A 3C8LA 2ZVYA 3C9UA 3HKEA 2UYJA 1CK2A 1PXWA 5LOVA 2G9IA 3VYUC 3CCRF 3EORA 4M8IA 2UYPA 4YJ3B 3NVIB 2UYKA 4LCKA 5CA1B 5HXUA 4ZHQA 2VAPA 5HY1A 1QU9A 4BT7A 2HS4A 3AGKA 4ZI7A 3KJKA 1Z5VA 4FFBB 3HKCB 4O2AA 1VQ5F 3GHZA 5JVDB 1VQ6F 1NMUB 1H7MA 1W40A 1W5EA 3M4SA 4BW0B 2LBTA 5EB1B 5LYJA 4B46A 3T80A 4BVRA 3RYCA 2L26A 3WJPA 2HRUA 5EB0A 5IYZA 4X3LA 1JY8A 5EZYA 5KMGB 5BMVA 5EIBD 4C82A 2HS0A 2JNBA 2ZAUA 3GTZA 2R6R1 4ERHA 4BVTA 3BYQA 2RHJA 3VOAA 3SIVA 1W41A 4U3JA 5LXTA 3CPWF 1TUBA 3RE3A 3V3TA 3JARA 2HX0A 5G4UC 1IV4A 4ZK7A 1U40A 2YXZA 3F0EA 5JH7A 5GAPK 3CB2A 2DYYA 1JD1A 3RYFA 3F6MA 3ZP4A 1ODEA 1TVKA 5MN6A 2HRYA 4WBNA 3WXMB 5EYPB 5HY4A 2Q1XA 2FC3A 1VQLF 3I3FA 4BT3A 1IV1A 5LP6B 4TV8B 3E20B 5J2UB 3KIZA 3HKEB 1XHOA 4BT5A 3LWRC 2F9ZC 2VXYA 5LOVB 2ZOVA 1QVGF 1KQSF 1Z5WA 3K14A 1YIJF 3K0TA 5AVMA 3KJJA 3CYQA 2LBWA 3DC2A 3LWVC 1UFYA 3VYTC 2N48A 2HVYD 2MQEA 2OTJF 2R751 2GLZA 3HWUA 2KTUA 1GO1A 5HP8A 4O2AB 4BVQA 2ZODA 3CCQF 3R0PA 1W5FA 1COMA 3M84A 1FSZA 4O4IA 3RYIA 4TUYB 5LYJB 1SZQA 3HKDA 3UT5A 1YI2F 3HJWC 1YHQF 3KHNA 5EZYB 4RQOA 4DXDA 2WALA 1XV2A 4KWEA 2BTUA 3P0ZA 4BT4A 2AIZP 2YYEA 5HWEA 1VK3A 5KX5A 5DCVA 2P6YA 1OFUA 3VOBA 1RQ7A 4C8EA 1TUBB 3J7AR 3JARB 3ZO8A 3CD6F 4F6RA 2HP0A 5JH7B 5J2UA 3I56F 3N2GA 2CVLA 3LDTA 2OTMA 2NMUA 1DBFA 4U39A 5JCOA 4EI8A 5GANK 1OAPA 4I4TB 1SA0B 1TVKB 4WBNB 1K73H 4X20B 2IQQA 2IAFA 1UI9A 1X7PA 2CSLA 1U43A 3WGKA 1VQOF 4O4JA 1CLIA 3WGNA 2CWJA 5EWRA 3CG6A 3MDOA 4IIJA 1W3EX 2RB9A 4C81A 5FLXM 4G88A 5B8FA 5EIBC 2V9YA 1VH8A 4BVSA 3CCUF 3RA5A 3JATB 4X1KA 5J2TA 2Z1TA 3FD5A 5IJ0B 1VHAA 5GONA 3NK7A 4RHAA 3N4YA 3KE1A 3WGMA 3V4DA 1RLUA 4EB6A 3LFOA 2HQSC 3JAKA 1NJIH 5C8YA 3RYIB 1IPAA 1YJ9F 1VQ4F 3QTYA 5FNVA 4C8GA 1VQNF 1VQ8F 2PHNA 3IMPA 2LBXA 1W55A 1KNJA 1YGYA 3ON1A 1RA4A 3V7EA 1W42A 3DDNA 5JQGA 1JFFA 5KX5B 3U0OA 1VQPF 2OHWA 5A2QM 1VQ9F 1M90H 4TV9A 1FNJA 4XCQA 4DRXA 2UYNA 3NK6A 4F6RB 2HP0B 3IEWA 3L7QA 4HNAA 1W57A 1N8RH 3N2GB 3N4ZA 4I55A 4B5CA 3G71F 2QA4F 3D00A 3RA6A 1FNKA 3JAMM 3MCQA 3ELCA 1IV3A 2CW4A 3P4EA 3CMAF 1U3PA 2Z01A 3CC4F 3CYPB 3P10A 4IIJB 4B62A 2QEXF 2KTVA 3F0FA 3C9RA 3JVHA 4NWOB 3S0HA 4X3MA 4G4ZA 4ZHQB 1K8AH 3HKBA 3TD4A 5MN5A 3S06A 1ONIA 4ZI7B 2I6RA 3VCZA 5J2TB 4X1KB 1YITF 2BTQB 3C9SA 4IHJA 1E7KA 5GONB 3S02A 4BY9D 1PF5A 1S72F 3F0GA 3LWPC 4EB6B 3JAKB 1K9MH 3ERNA 4G4VA 2ZVZA 3OW2F 3RYCB 3OONA 5C8YB 4YJ2A 1Q82H 3B6NA 5GIOC 5FNVB 1GX1A 5IYZB 5EAZA 5HY2A 5BMVB 1R1MA 2VGNA 1GO0A 3IR9A 2HP3A 4ZHVA 3CCVF 3FD6A 1W2BF 5JVDA 1X7OA 3HAXD 2AIFA 5JCOC 4G4WA 1X52A 4EI9A 3NMUC 5JQGB 4U3JB 5LP6C 5LXTB 3WPWA 5HY0A 1ZWZA 3ESJA 1IV2A 3FFMA 3M1XA 4O2BA 3WGLA 1VQMF 1Q7YH 4TV9B 3RYFB 4DRXB 1VQ7F 5IJ9A 4O4LA 4HNAB 3CCMF 2KGWA 3IKEA 1M1KH 2EWCA 4I55B 3GYQA 3JALA 3I7TA 4EI7A 3CC2F 4X1IA 1W59A 1FFXA 2QTPA 3JASA 3CCEF 1J7HA 1W5AA 1H47A 1QAHA 3E1YA 3G6EF 3V7QA 2RHLA 3MQWA 3HTNA 3CMEF 1YJNF 2Z1FA 4X1YA 2FGYA 1XRGA 3S0YA 1X25A 1QD9A 3HKBB 2ZF8A 3WPXA 3CC7F 5FJ4C 4ZHYB 2ALEA 3ZOPA 5ITZA 2RHOA 1XBIA 3MBMA 3D54A 4IHJB 4O4HA 2PMPA 2K1SA 3CXCF 1SDSA 4G4YA 4O4IB 3JAWA 4E6EA 3MCAB 2IG8A 4YJ2B 1Q8RA 3HKDB 4C8IA 1YJWF 3C9TA 1VQVA 2OTLF 3E22A 4NUTA 3SIUA 3FPIA 2Z1UA 2LCAA 2Q1YA 2I6DA 4TUYA 3VI6A 5G4VC 2VAMA 3OBWA 4B45A 4O2BB 3WGJA
chains in the Genus database with same CATH topology
4LCKA 5DCVA 5HXUA 1YITF 5HY1A 3J7AR 1E7KA 3AGKA 3CD6F 3I56F 3I55F 4BY9D 1T0KB 2KG4A 5GANK 1S72F 4EI8A 3LWOC 1Q86H 3LWPC 1K73H 1K9MH 1VQ5F 3OW2F 1VQ6F 1X7PA 3O85A 1Q82H 1NMUB 3CCJF 5GIOC 1H7MA 1W40A 4BW0B 1VQOF 5HY2A 1CN7A 2VGNA 1GO0A 5EWRA 3CG6A 3IR9A 4BVRA 3CCVF 1W2BF 2CZWA 1KC8H 3NVKE 1X7OA 3HAXD 2AIFA 1W3EX 1X52A 3J81M 4EI9A 3NMUC 4X3LA 5IT9M 5FLXM 5HY0A 1KD1H 2OZBA 1ZWZA 2JNBA 3FFMA 4BVTA 1VQMF 3SIVA 1Q7YH 1VQKF 1W41A 4BVSA 3CCUF 3RA5A 1RLGA 3CPWF 2VGMA 1VQ7F 3V3TA 5G4UC 3CCMF 3PLAC 1M1KH 5GAPK 3NK7A 3N4YA 3GYQA 3OBYA 5EO3A 2QI2A 3LFOA 4EI7A 3CC2F 3WXMB 5HY4A 3J80M 2FC3A 3G4SF 3CCEF 1NJIH 1VQLF 1IPAA 1YJ9F 1VQ4F 1VQNF 3E1YA 3G6EF 1VQ8F 3E20B 3V7QA 2LBXA 3LWRC 1DT9A 2F9ZC 3CMEF 1YJNF 3ON1A 4NQ3A 2FGYA 1RA4A 3V7EA 1W42A 1QVGF 3JCMM 3VMFB 5HXZA 2BO1A 3PAFA 3CPQA 3LWQC 1KQSF 1VQPF 3CC7F 5FJ4C 2OHWA 5A2QM 1YIJF 1VQ9F 2ALEA 4C4WC 4TZZA 3CCLF 1M90H 2LBWA 1QVFF 3LWVC 1XBIA 4XCQA 2HVYD 1Q81H 3NK6A 3CCSF 1JJ2F 2OTJF 5GIPC 1N8RH 3CXCF 2GLZA 5GINC 3N4ZA 1SDSA 2KTUA 1GO1A 4BVQA 3MCAB 3G71F 3CCQF 2QA4F 3D00A 3RA6A 3JAMM 1GZ0A 1YJWF 2OTLF 3CMAF 3CC4F 1CK2A 2QEXF 1PXWA 1YI2F 3HJWC 4NUTA 1YHQF 3SIUA 2KTVA 3CCRF 2I6DA 4X3MA 2WALA 1K8AH 3VI6A 5G4VC 3OBWA 3NVIB 5HWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCK A;  5DCV A;  1YIT F;  3J7A R;  1E7K A;  3AGK A;  3CD6 F;  3I56 F;  3I55 F;  4BY9 D;  1T0K B;  2KG4 A;  5GAN K;  1S72 F;  3LWO C;  1Q86 H;  3LWP C;  1K73 H;  1K9M H;  1VQ5 F;  3OW2 F;  1VQ6 F;  1X7P A;  3O85 A;  1Q82 H;  1NMU B;  3CCJ F;  5GIO C;  1H7M A;  1W40 A;  4BW0 B;  1VQO F;  1CN7 A;  2VGN A;  1GO0 A;  5EWR A;  3CG6 A;  3IR9 A;  1W2B F;  3CCV F;  3NVK E;  2CZW A;  1KC8 H;  1X7O A;  3HAX D;  2AIF A;  1W3E X;  1X52 A;  3J81 M;  3NMU C;  4X3L A;  5IT9 M;  5FLX M;  1KD1 H;  2OZB A;  1ZWZ A;  2JNB A;  3FFM A;  1VQM F;  3SIV A;  1Q7Y H;  1VQK F;  1W41 A;  3CCU F;  3RA5 A;  1RLG A;  3CPW F;  2VGM A;  1VQ7 F;  5G4U C;  3CCM F;  3PLA C;  1M1K H;  5GAP K;  3NK7 A;  3N4Y A;  3GYQ A;  3OBY A;  5EO3 A;  2QI2 A;  3LFO A;  3CC2 F;  3WXM B;  3J80 M;  2FC3 A;  3G4S F;  3CCE F;  1NJI H;  1VQL F;  1IPA A;  1YJ9 F;  1VQ4 F;  1VQN F;  3E1Y A;  3G6E F;  1VQ8 F;  3E20 B;  3V7Q A;  2LBX A;  3LWR C;  1DT9 A;  3CME F;  1YJN F;  3ON1 A;  1RA4 A;  3V7E A;  1W42 A;  1QVG F;  3JCM M;  3VMF B;  2BO1 A;  3PAF A;  3CPQ A;  3LWQ C;  1KQS F;  1VQP F;  3CC7 F;  5FJ4 C;  2OHW A;  5A2Q M;  1YIJ F;  1VQ9 F;  2ALE A;  4C4W C;  4TZZ A;  3CCL F;  1M90 H;  2LBW A;  1QVF F;  3LWV C;  1XBI A;  2HVY D;  1Q81 H;  3NK6 A;  3CCS F;  1JJ2 F;  2OTJ F;  5GIP C;  1N8R H;  3CXC F;  5GIN C;  3N4Z A;  1SDS A;  2KTU A;  1GO1 A;  3MCA B;  3G71 F;  3CCQ F;  2QA4 F;  3RA6 A;  3JAM M;  1GZ0 A;  1YJW F;  2OTL F;  3CMA F;  3CC4 F;  1CK2 A;  2QEX F;  1PXW A;  1YI2 F;  3HJW C;  4NUT A;  1YHQ F;  3SIU A;  2KTV A;  3CCR F;  2I6D A;  4X3M A;  2WAL A;  1K8A H;  3VI6 A;  5G4V C;  3OBW A;  3NVI B; 
#chains in the Genus database with same CATH topology
 4ZOL A;  4I50 A;  3LME A;  3RYH A;  5IJ9 B;  5LA6 A;  4O4L B;  3QHD A;  3N2K A;  3QUW A;  4LNU A;  5MN4 A;  3I55 F;  5CA0 A;  1T0K B;  2KG4 A;  4R40 B;  3JAL B;  3LWO C;  1Q86 H;  4O4J B;  3VTI C;  3VIU A;  4X1I B;  1FFX B;  2DT4 A;  3JAS B;  3O85 A;  3CCJ F;  4BT2 A;  4I4T A;  1SA0 A;  5CB4 A;  1CN7 A;  1RQ2 A;  4X20 A;  2RHH A;  3D01 A;  4G4X A;  3K12 A;  2CZW A;  1KC8 H;  2UZH A;  3NVK E;  4X1Y B;  3J81 M;  3TD5 A;  5IT9 M;  5HP7 A;  1KD1 H;  2OZB A;  3WJR A;  4YJ3 A;  2GVI A;  1VQK F;  5CA1 A;  5ITZ B;  3IKF A;  1RLG A;  4BT6 A;  2VGM A;  2GZL A;  4O4H B;  2H6L A;  2AMT A;  3PLA C;  2HS3 A;  2VAW A;  3JAW B;  4PWT A;  3OBY A;  3JAT A;  5EO3 A;  2QI2 A;  4FFB A;  3HKC A;  5IJ0 A;  3WJQ A;  1KNK A;  3S03 A;  3J80 M;  3G4S F;  3F0D A;  1YQN A;  1JFF B;  3E22 B;  1DT9 A;  3K2X A;  3VO8 A;  1NQ3 A;  4NQ3 A;  1W58 1;  2W8B C;  5KMG A;  3JCM M;  3VMF B;  5HXZ A;  2BO1 A;  1H48 A;  2UYN B;  3PAF A;  3CPQ A;  3UT5 B;  2B33 A;  3LWQ C;  4ZOL B;  4I50 B;  3FBA A;  3RYH B;  4C4W C;  4TZZ A;  3CCL F;  5LA6 B;  1QVF F;  3TD3 A;  2CHT A;  1Q81 H;  1JJ2 F;  1U3L A;  3N2K B;  3S0W A;  5GIP C;  2BTO A;  4LNU B;  3CCS F;  5CA0 B;  1W5B A;  3VYS C;  5GIN C;  3IEQ A;  2H8C A;  2H8E A;  2Z1E A;  5EYP A;  3Q8H A;  3ZP7 A;  4ZHW A;  1GZ0 A;  1JN1 A;  1T0A A;  5LP6 A;  3LYB A;  2CHS A;  5CB4 B;  4TV8 A;  3C8L A;  2ZVY A;  3C9U A;  3HKE A;  2UYJ A;  1CK2 A;  1PXW A;  5LOV A;  2G9I A;  3VYU C;  3CCR F;  3EOR A;  4M8I A;  2UYP A;  4YJ3 B;  3NVI B;  2UYK A;  4LCK A;  5CA1 B;  5HXU A;  4ZHQ A;  2VAP A;  5HY1 A;  1QU9 A;  4BT7 A;  2HS4 A;  3AGK A;  4ZI7 A;  3KJK A;  1Z5V A;  4FFB B;  3HKC B;  4O2A A;  1VQ5 F;  3GHZ A;  5JVD B;  1VQ6 F;  1NMU B;  1H7M A;  1W40 A;  1W5E A;  3M4S A;  4BW0 B;  2LBT A;  5EB1 B;  5LYJ A;  4B46 A;  3T80 A;  4BVR A;  3RYC A;  2L26 A;  3WJP A;  2HRU A;  5EB0 A;  5IYZ A;  4X3L A;  1JY8 A;  5EZY A;  5KMG B;  5BMV A;  5EIB D;  4C82 A;  2HS0 A;  2JNB A;  2ZAU A;  3GTZ A;  2R6R 1;  4ERH A;  4BVT A;  3BYQ A;  2RHJ A;  3VOA A;  3SIV A;  1W41 A;  4U3J A;  5LXT A;  3CPW F;  1TUB A;  3RE3 A;  3V3T A;  3JAR A;  2HX0 A;  5G4U C;  1IV4 A;  4ZK7 A;  1U40 A;  2YXZ A;  3F0E A;  5JH7 A;  5GAP K;  3CB2 A;  2DYY A;  1JD1 A;  3RYF A;  3F6M A;  3ZP4 A;  1ODE A;  1TVK A;  5MN6 A;  2HRY A;  4WBN A;  3WXM B;  5EYP B;  5HY4 A;  2Q1X A;  2FC3 A;  1VQL F;  3I3F A;  4BT3 A;  1IV1 A;  5LP6 B;  4TV8 B;  3E20 B;  5J2U B;  3KIZ A;  3HKE B;  1XHO A;  4BT5 A;  3LWR C;  2F9Z C;  2VXY A;  5LOV B;  2ZOV A;  1QVG F;  1KQS F;  1Z5W A;  3K14 A;  1YIJ F;  3K0T A;  5AVM A;  3KJJ A;  3CYQ A;  2LBW A;  3DC2 A;  3LWV C;  1UFY A;  3VYT C;  2N48 A;  2HVY D;  2MQE A;  2OTJ F;  2R75 1;  2GLZ A;  3HWU A;  2KTU A;  1GO1 A;  5HP8 A;  4O2A B;  4BVQ A;  2ZOD A;  3CCQ F;  3R0P A;  1W5F A;  1COM A;  3M84 A;  1FSZ A;  4O4I A;  3RYI A;  4TUY B;  5LYJ B;  1SZQ A;  3HKD A;  3UT5 A;  1YI2 F;  3HJW C;  1YHQ F;  3KHN A;  5EZY B;  4RQO A;  4DXD A;  2WAL A;  1XV2 A;  4KWE A;  2BTU A;  3P0Z A;  4BT4 A;  2AIZ P;  2YYE A;  5HWE A;  1VK3 A;  5KX5 A;  5DCV A;  2P6Y A;  1OFU A;  3VOB A;  1RQ7 A;  4C8E A;  1TUB B;  3J7A R;  3JAR B;  3ZO8 A;  3CD6 F;  4F6R A;  2HP0 A;  5JH7 B;  5J2U A;  3I56 F;  3N2G A;  2CVL A;  3LDT A;  2OTM A;  2NMU A;  1DBF A;  4U39 A;  5JCO A;  4EI8 A;  5GAN K;  1OAP A;  4I4T B;  1SA0 B;  1TVK B;  4WBN B;  1K73 H;  4X20 B;  2IQQ A;  2IAF A;  1UI9 A;  1X7P A;  2CSL A;  1U43 A;  3WGK A;  1VQO F;  4O4J A;  1CLI A;  3WGN A;  2CWJ A;  5EWR A;  3CG6 A;  3MDO A;  4IIJ A;  1W3E X;  2RB9 A;  4C81 A;  5FLX M;  4G88 A;  5B8F A;  5EIB C;  2V9Y A;  1VH8 A;  4BVS A;  3CCU F;  3RA5 A;  3JAT B;  4X1K A;  5J2T A;  2Z1T A;  3FD5 A;  5IJ0 B;  1VHA A;  5GON A;  3NK7 A;  4RHA A;  3N4Y A;  3KE1 A;  3WGM A;  3V4D A;  1RLU A;  4EB6 A;  3LFO A;  2HQS C;  3JAK A;  1NJI H;  5C8Y A;  3RYI B;  1IPA A;  1YJ9 F;  1VQ4 F;  3QTY A;  5FNV A;  4C8G A;  1VQN F;  1VQ8 F;  2PHN A;  3IMP A;  2LBX A;  1W55 A;  1KNJ A;  1YGY A;  3ON1 A;  1RA4 A;  3V7E A;  1W42 A;  3DDN A;  5JQG A;  1JFF A;  5KX5 B;  3U0O A;  1VQP F;  2OHW A;  5A2Q M;  1VQ9 F;  1M90 H;  4TV9 A;  1FNJ A;  4XCQ A;  4DRX A;  2UYN A;  3NK6 A;  4F6R B;  2HP0 B;  3IEW A;  3L7Q A;  4HNA A;  1W57 A;  1N8R H;  3N2G B;  3N4Z A;  4I55 A;  4B5C A;  3G71 F;  2QA4 F;  3D00 A;  3RA6 A;  1FNK A;  3JAM M;  3MCQ A;  3ELC A;  1IV3 A;  2CW4 A;  3P4E A;  3CMA F;  1U3P A;  2Z01 A;  3CC4 F;  3CYP B;  3P10 A;  4IIJ B;  4B62 A;  2QEX F;  2KTV A;  3F0F A;  3C9R A;  3JVH A;  4NWO B;  3S0H A;  4X3M A;  4G4Z A;  4ZHQ B;  1K8A H;  3HKB A;  3TD4 A;  5MN5 A;  3S06 A;  1ONI A;  4ZI7 B;  2I6R A;  3VCZ A;  5J2T B;  4X1K B;  1YIT F;  2BTQ B;  3C9S A;  4IHJ A;  1E7K A;  5GON B;  3S02 A;  4BY9 D;  1PF5 A;  1S72 F;  3F0G A;  3LWP C;  4EB6 B;  3JAK B;  1K9M H;  3ERN A;  4G4V A;  2ZVZ A;  3OW2 F;  3RYC B;  3OON A;  5C8Y B;  4YJ2 A;  1Q82 H;  3B6N A;  5GIO C;  5FNV B;  1GX1 A;  5IYZ B;  5EAZ A;  5HY2 A;  5BMV B;  1R1M A;  2VGN A;  1GO0 A;  3IR9 A;  2HP3 A;  4ZHV A;  3CCV F;  3FD6 A;  1W2B F;  5JVD A;  1X7O A;  3HAX D;  2AIF A;  5JCO C;  4G4W A;  1X52 A;  4EI9 A;  3NMU C;  5JQG B;  4U3J B;  5LP6 C;  5LXT B;  3WPW A;  5HY0 A;  1ZWZ A;  3ESJ A;  1IV2 A;  3FFM A;  3M1X A;  4O2B A;  3WGL A;  1VQM F;  1Q7Y H;  4TV9 B;  3RYF B;  4DRX B;  1VQ7 F;  5IJ9 A;  4O4L A;  4HNA B;  3CCM F;  2KGW A;  3IKE A;  1M1K H;  2EWC A;  4I55 B;  3GYQ A;  3JAL A;  3I7T A;  4EI7 A;  3CC2 F;  4X1I A;  1W59 A;  1FFX A;  2QTP A;  3JAS A;  3CCE F;  1J7H A;  1W5A A;  1H47 A;  1QAH A;  3E1Y A;  3G6E F;  3V7Q A;  2RHL A;  3MQW A;  3HTN A;  3CME F;  1YJN F;  2Z1F A;  4X1Y A;  2FGY A;  1XRG A;  3S0Y A;  1X25 A;  1QD9 A;  3HKB B;  2ZF8 A;  3WPX A;  3CC7 F;  5FJ4 C;  4ZHY B;  2ALE A;  3ZOP A;  5ITZ A;  2RHO A;  1XBI A;  3MBM A;  3D54 A;  4IHJ B;  4O4H A;  2PMP A;  2K1S A;  3CXC F;  1SDS A;  4G4Y A;  4O4I B;  3JAW A;  4E6E A;  3MCA B;  2IG8 A;  4YJ2 B;  1Q8R A;  3HKD B;  4C8I A;  1YJW F;  3C9T A;  1VQV A;  2OTL F;  3E22 A;  4NUT A;  3SIU A;  3FPI A;  2Z1U A;  2LCA A;  2Q1Y A;  2I6D A;  4TUY A;  3VI6 A;  5G4V C;  2VAM A;  3OBW A;  4B45 A;  4O2B B;  3WGJ A; 
#chains in the Genus database with same CATH homology
 4LCK A;  5DCV A;  5HXU A;  1YIT F;  5HY1 A;  3J7A R;  1E7K A;  3AGK A;  3CD6 F;  3I56 F;  3I55 F;  4BY9 D;  1T0K B;  2KG4 A;  5GAN K;  1S72 F;  4EI8 A;  3LWO C;  1Q86 H;  3LWP C;  1K73 H;  1K9M H;  1VQ5 F;  3OW2 F;  1VQ6 F;  1X7P A;  3O85 A;  1Q82 H;  1NMU B;  3CCJ F;  5GIO C;  1H7M A;  1W40 A;  4BW0 B;  1VQO F;  5HY2 A;  1CN7 A;  2VGN A;  1GO0 A;  5EWR A;  3CG6 A;  3IR9 A;  4BVR A;  3CCV F;  1W2B F;  2CZW A;  1KC8 H;  3NVK E;  1X7O A;  3HAX D;  2AIF A;  1W3E X;  1X52 A;  3J81 M;  4EI9 A;  3NMU C;  4X3L A;  5IT9 M;  5FLX M;  5HY0 A;  1KD1 H;  2OZB A;  1ZWZ A;  2JNB A;  3FFM A;  4BVT A;  1VQM F;  3SIV A;  1Q7Y H;  1VQK F;  1W41 A;  4BVS A;  3CCU F;  3RA5 A;  1RLG A;  3CPW F;  2VGM A;  1VQ7 F;  3V3T A;  5G4U C;  3CCM F;  3PLA C;  1M1K H;  5GAP K;  3NK7 A;  3N4Y A;  3GYQ A;  3OBY A;  5EO3 A;  2QI2 A;  3LFO A;  4EI7 A;  3CC2 F;  3WXM B;  5HY4 A;  3J80 M;  2FC3 A;  3G4S F;  3CCE F;  1NJI H;  1VQL F;  1IPA A;  1YJ9 F;  1VQ4 F;  1VQN F;  3E1Y A;  3G6E F;  1VQ8 F;  3E20 B;  3V7Q A;  2LBX A;  3LWR C;  1DT9 A;  2F9Z C;  3CME F;  1YJN F;  3ON1 A;  4NQ3 A;  2FGY A;  1RA4 A;  3V7E A;  1W42 A;  1QVG F;  3JCM M;  3VMF B;  5HXZ A;  2BO1 A;  3PAF A;  3CPQ A;  3LWQ C;  1KQS F;  1VQP F;  3CC7 F;  5FJ4 C;  2OHW A;  5A2Q M;  1YIJ F;  1VQ9 F;  2ALE A;  4C4W C;  4TZZ A;  3CCL F;  1M90 H;  2LBW A;  1QVF F;  3LWV C;  1XBI A;  4XCQ A;  2HVY D;  1Q81 H;  3NK6 A;  3CCS F;  1JJ2 F;  2OTJ F;  5GIP C;  1N8R H;  3CXC F;  2GLZ A;  5GIN C;  3N4Z A;  1SDS A;  2KTU A;  1GO1 A;  4BVQ A;  3MCA B;  3G71 F;  3CCQ F;  2QA4 F;  3D00 A;  3RA6 A;  3JAM M;  1GZ0 A;  1YJW F;  2OTL F;  3CMA F;  3CC4 F;  1CK2 A;  2QEX F;  1PXW A;  1YI2 F;  3HJW C;  4NUT A;  1YHQ F;  3SIU A;  2KTV A;  3CCR F;  2I6D A;  4X3M A;  2WAL A;  1K8A H;  3VI6 A;  5G4V C;  3OBW A;  3NVI B;  5HWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...