3CMEF

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cmeF00
2KTVA 2QA4F 3SIUA 1GO0A 1CN7A 1VQPF 3J7AR 3RA5A 3CMAF 4TZZA 5IT9M 3LWPC 1QVFF 1PXWA 1W42A 2LBWA 2LBXA 3CMEF 3FFMA 3G6EF 1NMUB 3WXMB 3NK6A 1W41A 1T0KB 3I55F 3RA6A 3NMUC 3VMFB 1X7PA 3V7QA 3CCUF 1VQ6F 3E1YA 1YJNF 3G71F 1VQ5F 1NJIH 3J81M 1YITF 1K8AH 2OZBA 4X3LA 3CC4F 1RLGA 1VQLF 1VQ9F 5FJ4C 1SDSA 1VQNF 1YIJF 5GIPC 2JNBA 3J80M 3CCVF 1X52A 3G4SF 4X3MA 2AIFA 1W40A 3HAXD 3CCJF 1KC8H 2KG4A 3OBYA 1CK2A 1M1KH 3V7EA 3CPWF 1GO1A 3NK7A 3JCMM 5FLXM 1E7KA 1Q86H 1W2BF 1Q7YH 3E20B 2CZWA 2VGNA 3CCMF 1YHQF 3LFOA 2VGMA 1VQKF 1K73H 3CC2F 1IPAA 3CPQA 4BY9D 1S72F 1Q82H 5GINC 5DCVA 3GYQA 2WALA 3CC7F 3ON1A 1KQSF 2FC3A 4C4WC 3CCSF 1H7MA 1W3EX 1GZ0A 3CXCF 2KTUA 1KD1H 3OBWA 1DT9A 2ALEA 3N4ZA 5GIOC 3I56F 3NVIB 3VI6A 4NUTA 3JAMM 3AGKA 1ZWZA 3LWOC 1N8RH 3IR9A 4BW0B 1VQ7F 5G4UC 5EO3A 5EWRA 1K9MH 2OTLF 5G4VC 3CCLF 3CCQF 2QI2A 1X7OA 5GANK 3O85A 1VQMF 1QVGF 2I6DA 4LCKA 3OW2F 2OHWA 1YJ9F 3LWVC 5GAPK 1VQOF 3CCEF 1VQ4F 1Q81H 3NVKE 2HVYD 3SIVA 3LWQC 1M90H 1RA4A 3PAFA 3HJWC 2BO1A 1JJ2F 3N4YA 5A2QM 3LWRC 2QEXF 1YJWF 2OTJF 1XBIA 3CG6A 3CD6F 3MCAB 1YI2F 1VQ8F 3CCRF 3PLAC
chains in the Genus database with same CATH superfamily
4U3JB 2VAPA 3UT5A 2VAWA 4BT3A 3F0DA 2PMPA 1VQPF 4YJ3B 3WGMA 4ZHVA 4G4XA 3KIZA 4TZZA 3LMEA 2Q1XA 3K2XA 1PXWA 2LBXA 3I55F 1X7PA 2OTMA 3IKFA 5J2UB 2CWJA 3E1YA 2CW4A 2DYYA 4NQ3A 3VOBA 2HP0B 4EI8A 2ZODA 4LNUB 1KNKA 4ZHYB 4X1KB 4R40B 1UI9A 2RHJA 3VCZA 3Q8HA 3J80M 3L7QA 4U3JA 1JY8A 1QD9A 4O4JA 3P10A 4X1IB 1W40A 1KC8H 3R0PA 5EIBC 1FFXB 2BTOA 2UZHA 3IEQA 4LNUA 3JATA 3VYUC 5FLXM 3WGLA 1Q86H 3WPXA 2CZWA 3CCMF 5BMVB 4I4TB 2N48A 1K73H 3CPQA 4EI9A 2QTPA 1S72F 3V3TA 5HY2A 2RB9A 5GINC 3OONA 3ZO8A 5ITZB 1XRGA 1VHAA 3ON1A 3DDNA 2IG8A 1KNJA 3CXCF 3I56F 5EZYB 3V4DA 1TVKA 3C9RA 5LXTB 1TVKB 4BW0B 1VQ7F 3B6NA 2I6RA 5EO3A 3CCQF 2Q1YA 3C9UA 1VQMF 3HKDB 2R6R1 1QVGF 3OW2F 2OHWA 4DXDA 4O2BA 4ZOLA 1VQOF 3K14A 3QTYA 1COMA 2PHNA 1OAPA 5J2TB 2HVYD 4PWTA 3LWQC 2VXYA 1M90H 1UFYA 2BTUA 3ZP7A 4BVQA 1W55A 5LXTA 5MN6A 3F0EA 1JFFB 5A2QM 3CG6A 4IIJA 4U39A 2AIZP 1YI2F 3FD5A 1VQ8F 4ZHQB 2NMUA 1GX1A 3WJPA 2FGYA 1XHOA 1GO0A 3IEWA 4C8GA 3RA5A 4DRXB 1YGYA 5HP7A 3LWPC 2ZVZA 3KJKA 1JFFA 4X20B 2HS4A 3G6EF 1NMUB 3WXMB 4B5CA 1Q8RA 1VH8A 4X20A 4O4LB 3IKEA 3M1XA 4BT2A 1H47A 3S0HA 4O4LA 1NJIH 1VQ5F 3ERNA 1Z5WA 3HKCA 4ZHQA 5CB4B 1TUBB 5ITZA 2HQSC 2UYPA 4ZK7A 3CC4F 5FJ4C 1VQLF 1VQ9F 5LP6C 1SDSA 2Z01A 4X1IA 1H48A 3BYQA 3DC2A 4I50B 5EB0A 3G4SF 2IQQA 3I3FA 2RHOA 2ZVYA 4BVSA 1M1KH 4FFBA 3JAKA 3V7EA 2HP0A 5AVMA 1GO1A 5HXZA 3RYFA 2UYNA 3WGNA 1E7KA 2HRUA 3D00A 1JN1A 2VGNA 3P4EA 2HRYA 1SA0B 4RQOA 1YHQF 3E22B 3VO8A 2VGMA 1W5AA 5LP6B 4ZHWA 3E22A 2BTQB 3N2GB 5CB4A 1TUBA 4TV9B 4O2BB 5JH7A 1JD1A 5DCVA 4HNAA 1CLIA 5JH7B 1H7MA 3LYBA 5C8YA 5B8FA 1W3EX 3JATB 1DBFA 4IHJB 4I50A 1OFUA 4BT7A 2UYJA 1DT9A 2H8EA 3NVIB 3RYFB 4BT4A 1N8RH 3U0OA 1FNJA 5EWRA 5CA1A 4G4YA 4X1YA 3HTNA 5EYPB 3MQWA 4M8IA 1X7OA 3S0WA 1U3LA 5GANK 2KGWA 1IV3A 1T0AA 1Z5VA 4LCKA 4TV9A 2L26A 1YJ9F 4F6RB 3F0GA 1VQ4F 3NVKE 4O4IA 2IAFA 1RA4A 5J2TA 1VK3A 4TUYB 5HY0A 3JARA 5CA0B 2HX0A 3FBAA 3N4YA 1U43A 4C82A 3WGJA 3LWRC 3VYTC 2OTJF 3KJJA 1W57A 3P0ZA 5JCOC 2G9IA 5LA6A 5KX5B 3PLAC 3JALB 3CYQA 1XV2A 2EWCA 2KTVA 2YXZA 3TD5A 3C8LA 5CA1B 1CN7A 3J7AR 1FNKA 4BT5A 4O4HB 4EB6B 1QVFF 1W42A 3CMEF 3FFMA 3NK6A 1W41A 5JVDA 1T0KB 3RA6A 3VMFB 2DT4A 4I55A 4ZI7B 2Z1TA 3V7QA 3CCUF 1VQ6F 2H6LA 5GONB 3S02A 1YJNF 4I55B 4ZI7A 2F9ZC 3JALA 3J81M 2R751 3ESJA 4WBNA 3D01A 1K8AH 3JAWA 4RHAA 4X3LA 4DRXA 3F6MA 5MN5A 3JAWB 4BT6A 5EAZA 5IJ0A 2JNBA 3N2KB 4BVTA 1X52A 2AIFA 2RHLA 3CCJF 3CYPB 1CK2A 1SA0A 3HKCB 3CPWF 3NK7A 5LYJA 4WBNB 1PF5A 1QAHA 1Q7YH 3E20B 3VYSC 4YJ2A 3K12A 3KHNA 3CC2F 1IPAA 4BY9D 5EYPA 5IJ0B 1U40A 5BMVA 1Q82H 1IV1A 3N2GA 2V9YA 5LOVB 2CSLA 3TD3A 3GYQA 3RE3A 3MDOA 3CC7F 2GZLA 4E6EA 3FPIA 2UYKA 1GZ0A 4B45A 3JARB 5CA0A 5C8YB 2Z1UA 4KWEA 3OBWA 1RQ2A 5GIOC 2ALEA 3N4ZA 3QHDA 2MQEA 5LP6A 5LYJB 5KMGB 3EORA 2LBTA 1ZWZA 2LCAA 4X1YB 3IR9A 5LA6B 3LWOC 3TD4A 1K9MH 2OTLF 5HY4A 3LDTA 5G4VC 4O2AB 3HKBA 1IV4A 3RYHB 4G4VA 3K0TA 2ZAUA 1IV2A 3LWVC 4IHJA 3CCEF 1Q81H 5JVDB 1ONIA 4F6RA 3SIVA 1J7HA 3PAFA 4O4IB 2GLZA 1X25A 1RLUA 5FNVB 2ZF8A 4TUYA 3RYIA 2QEXF 5KX5A 5EIBD 1YJWF 3CD6F 3JASB 3MCAB 3CCRF 1W5BA 4EB6A 4C81A 3N2KA 5JQGA 2QA4F 3S0YA 3SIUA 3T80A 4X1KA 2W8BC 4G4WA 3S03A 2CHTA 3WJRA 4C8EA 3CMAF 1NQ3A 5IT9M 3M84A 2LBWA 5GONA 4YJ3A 5HXUA 1QU9A 3RYCB 3NMUC 2HS0A 3HKEA 4ERHA 5HWEA 2GVIA 3G71F 3S06A 2CHSA 5EB1B 2Z1EA 3RYIB 3CB2A 1YITF 2K1SA 3ZP4A 5IYZB 2OZBA 4O4HA 4G4ZA 1RLGA 1YQNA 1VQNF 3WJQA 1YIJF 5GIPC 5IJ9A 1ODEA 4O4JB 4TV8A 3CCVF 4FFBB 3JAKB 3HKEB 5IJ9B 2UYNB 3HAXD 4X3MA 1FFXA 1W59A 2KG4A 3OBYA 2HS3A 3JVHA 4B46A 5KMGA 3JCMM 5MN4A 3C9TA 1W2BF 5HP8A 1RQ7A 1W581 5J2UA 3ELCA 3M4SA 4G88A 3LFOA 4NWOB 5JCOA 1VQKF 1W5FA 3MBMA 4EI7A 3RYHA 4TV8B 3IMPA 2CVLA 2WALA 2P6YA 5LOVA 1KQSF 2FC3A 4C4WC 3CCSF 3HWUA 1VQVA 4HNAB 3ZOPA 2KTUA 5EZYA 2B33A 2VAMA 1KD1H 4YJ2B 3VTIC 3GTZA 2AMTA 3KE1A 3VIUA 3VI6A 1W5EA 3F0FA 4NUTA 3I7TA 3FD6A 3JAMM 3QUWA 3AGKA 4C8IA 5G4UC 4XCQA 5JQGB 3WGKA 3UT5B 4I4TA 3CCLF 2YYEA 1SZQA 2HP3A 1U3PA 3D54A 5HY1A 2QI2A 4ZOLB 3O85A 2RHHA 2I6DA 4B62A 3C9SA 3GHZA 4BVRA 5GAPK 3RYCA 2ZOVA 2Z1FA 3HKDA 5FNVA 1R1MA 3WPWA 3HJWC 2BO1A 1JJ2F 2H8CA 3JASA 3VOAA 4IIJB 4O2AA 3HKBB 1XBIA 5IYZA 3MCQA 1FSZA
chains in the Genus database with same CATH topology
2KTVA 2FGYA 2QA4F 3SIUA 1GO0A 1CN7A 1VQPF 3J7AR 3RA5A 3CMAF 4TZZA 5IT9M 3LWPC 1QVFF 1PXWA 1W42A 2LBWA 2LBXA 3CMEF 5HXUA 3FFMA 3G6EF 1NMUB 3WXMB 3NK6A 1W41A 1T0KB 3I55F 3RA6A 3NMUC 3VMFB 1X7PA 3V7QA 3CCUF 1VQ6F 3E1YA 5HWEA 4NQ3A 1YJNF 3G71F 1VQ5F 1NJIH 2F9ZC 3J81M 4EI8A 1YITF 1K8AH 2OZBA 4X3LA 3CC4F 1RLGA 1VQLF 1VQ9F 5FJ4C 1SDSA 1VQNF 1YIJF 5GIPC 2JNBA 3J80M 3CCVF 4BVTA 1X52A 3G4SF 4X3MA 2AIFA 1W40A 3HAXD 3CCJF 1KC8H 4BVSA 2KG4A 3OBYA 1CK2A 1M1KH 3V7EA 3CPWF 1GO1A 5HXZA 3NK7A 3JCMM 5FLXM 1E7KA 1Q86H 1W2BF 1Q7YH 3D00A 3E20B 2CZWA 2VGNA 3CCMF 1YHQF 3LFOA 2VGMA 1VQKF 1K73H 3CC2F 1IPAA 3CPQA 4EI9A 4BY9D 1S72F 3V3TA 4EI7A 5HY2A 1Q82H 5GINC 5DCVA 3GYQA 2WALA 3CC7F 3ON1A 1KQSF 2FC3A 4C4WC 3CCSF 1H7MA 1W3EX 1GZ0A 3CXCF 2KTUA 1KD1H 3OBWA 1DT9A 2ALEA 3N4ZA 5GIOC 3I56F 3NVIB 3VI6A 4NUTA 3JAMM 3AGKA 1ZWZA 3LWOC 1N8RH 3IR9A 4BW0B 1VQ7F 5G4UC 4XCQA 5EO3A 5EWRA 1K9MH 5HY4A 5G4VC 3CCLF 2OTLF 3CCQF 5HY1A 2QI2A 1X7OA 5GANK 3O85A 1VQMF 1QVGF 2I6DA 4LCKA 3OW2F 2OHWA 1YJ9F 4BVRA 5GAPK 3LWVC 1VQOF 3CCEF 1VQ4F 1Q81H 3NVKE 2HVYD 3SIVA 3LWQC 1M90H 1RA4A 3PAFA 4BVQA 3HJWC 2BO1A 2GLZA 5HY0A 1JJ2F 3N4YA 5A2QM 3LWRC 2QEXF 1YJWF 2OTJF 1XBIA 3CG6A 3CD6F 3MCAB 1YI2F 1VQ8F 3CCRF 3PLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KTV A;  2QA4 F;  3SIU A;  1GO0 A;  1CN7 A;  1VQP F;  3J7A R;  3RA5 A;  3CMA F;  4TZZ A;  5IT9 M;  3LWP C;  1QVF F;  1PXW A;  1W42 A;  2LBW A;  2LBX A;  3CME F;  3FFM A;  3G6E F;  1NMU B;  3WXM B;  3NK6 A;  1W41 A;  1T0K B;  3I55 F;  3RA6 A;  3NMU C;  3VMF B;  1X7P A;  3V7Q A;  3CCU F;  1VQ6 F;  3E1Y A;  1YJN F;  3G71 F;  1VQ5 F;  1NJI H;  3J81 M;  1YIT F;  1K8A H;  2OZB A;  4X3L A;  3CC4 F;  1RLG A;  1VQL F;  1VQ9 F;  5FJ4 C;  1SDS A;  1VQN F;  1YIJ F;  5GIP C;  2JNB A;  3J80 M;  3CCV F;  1X52 A;  3G4S F;  4X3M A;  2AIF A;  1W40 A;  3HAX D;  3CCJ F;  1KC8 H;  2KG4 A;  3OBY A;  1CK2 A;  1M1K H;  3V7E A;  3CPW F;  1GO1 A;  3NK7 A;  3JCM M;  5FLX M;  1E7K A;  1Q86 H;  1W2B F;  1Q7Y H;  3E20 B;  2CZW A;  2VGN A;  3CCM F;  1YHQ F;  3LFO A;  2VGM A;  1VQK F;  1K73 H;  3CC2 F;  1IPA A;  3CPQ A;  4BY9 D;  1S72 F;  1Q82 H;  5GIN C;  5DCV A;  3GYQ A;  2WAL A;  3CC7 F;  3ON1 A;  1KQS F;  2FC3 A;  4C4W C;  3CCS F;  1H7M A;  1W3E X;  1GZ0 A;  3CXC F;  2KTU A;  1KD1 H;  3OBW A;  1DT9 A;  2ALE A;  3N4Z A;  5GIO C;  3I56 F;  3NVI B;  3VI6 A;  4NUT A;  3JAM M;  3AGK A;  1ZWZ A;  3LWO C;  1N8R H;  3IR9 A;  4BW0 B;  1VQ7 F;  5G4U C;  5EO3 A;  5EWR A;  1K9M H;  2OTL F;  5G4V C;  3CCL F;  3CCQ F;  2QI2 A;  1X7O A;  5GAN K;  3O85 A;  1VQM F;  1QVG F;  2I6D A;  4LCK A;  3OW2 F;  2OHW A;  1YJ9 F;  3LWV C;  5GAP K;  1VQO F;  3CCE F;  1VQ4 F;  1Q81 H;  3NVK E;  2HVY D;  3SIV A;  3LWQ C;  1M90 H;  1RA4 A;  3PAF A;  3HJW C;  2BO1 A;  1JJ2 F;  3N4Y A;  5A2Q M;  3LWR C;  2QEX F;  1YJW F;  2OTJ F;  1XBI A;  3CG6 A;  3CD6 F;  3MCA B;  1YI2 F;  1VQ8 F;  3CCR F;  3PLA C; 
#chains in the Genus database with same CATH topology
 4U3J B;  2VAP A;  3UT5 A;  2VAW A;  4BT3 A;  3F0D A;  2PMP A;  1VQP F;  4YJ3 B;  3WGM A;  4ZHV A;  4G4X A;  3KIZ A;  4TZZ A;  3LME A;  2Q1X A;  3K2X A;  1PXW A;  2LBX A;  3I55 F;  1X7P A;  2OTM A;  3IKF A;  5J2U B;  2CWJ A;  3E1Y A;  2CW4 A;  2DYY A;  4NQ3 A;  3VOB A;  2HP0 B;  4EI8 A;  2ZOD A;  4LNU B;  1KNK A;  4ZHY B;  4X1K B;  4R40 B;  1UI9 A;  2RHJ A;  3VCZ A;  3Q8H A;  3J80 M;  3L7Q A;  4U3J A;  1JY8 A;  1QD9 A;  4O4J A;  3P10 A;  4X1I B;  1W40 A;  1KC8 H;  3R0P A;  5EIB C;  1FFX B;  2BTO A;  2UZH A;  3IEQ A;  4LNU A;  3JAT A;  3VYU C;  5FLX M;  3WGL A;  1Q86 H;  3WPX A;  2CZW A;  3CCM F;  5BMV B;  4I4T B;  2N48 A;  1K73 H;  3CPQ A;  4EI9 A;  2QTP A;  1S72 F;  3V3T A;  5HY2 A;  2RB9 A;  5GIN C;  3OON A;  3ZO8 A;  5ITZ B;  1XRG A;  1VHA A;  3ON1 A;  3DDN A;  2IG8 A;  1KNJ A;  3CXC F;  3I56 F;  5EZY B;  3V4D A;  1TVK A;  3C9R A;  5LXT B;  1TVK B;  4BW0 B;  1VQ7 F;  3B6N A;  2I6R A;  5EO3 A;  3CCQ F;  2Q1Y A;  3C9U A;  1VQM F;  3HKD B;  2R6R 1;  1QVG F;  3OW2 F;  2OHW A;  4DXD A;  4O2B A;  4ZOL A;  1VQO F;  3K14 A;  3QTY A;  1COM A;  2PHN A;  1OAP A;  5J2T B;  2HVY D;  4PWT A;  3LWQ C;  2VXY A;  1M90 H;  1UFY A;  2BTU A;  3ZP7 A;  4BVQ A;  1W55 A;  5LXT A;  5MN6 A;  3F0E A;  1JFF B;  5A2Q M;  3CG6 A;  4IIJ A;  4U39 A;  2AIZ P;  1YI2 F;  3FD5 A;  1VQ8 F;  4ZHQ B;  2NMU A;  1GX1 A;  3WJP A;  2FGY A;  1XHO A;  1GO0 A;  3IEW A;  4C8G A;  3RA5 A;  4DRX B;  1YGY A;  5HP7 A;  3LWP C;  2ZVZ A;  3KJK A;  1JFF A;  4X20 B;  2HS4 A;  3G6E F;  1NMU B;  3WXM B;  4B5C A;  1Q8R A;  1VH8 A;  4X20 A;  4O4L B;  3IKE A;  3M1X A;  4BT2 A;  1H47 A;  3S0H A;  4O4L A;  1NJI H;  1VQ5 F;  3ERN A;  1Z5W A;  3HKC A;  4ZHQ A;  5CB4 B;  1TUB B;  5ITZ A;  2HQS C;  2UYP A;  4ZK7 A;  3CC4 F;  5FJ4 C;  1VQL F;  1VQ9 F;  5LP6 C;  1SDS A;  2Z01 A;  4X1I A;  1H48 A;  3BYQ A;  3DC2 A;  4I50 B;  5EB0 A;  3G4S F;  2IQQ A;  3I3F A;  2RHO A;  2ZVY A;  4BVS A;  1M1K H;  4FFB A;  3JAK A;  3V7E A;  2HP0 A;  5AVM A;  1GO1 A;  5HXZ A;  3RYF A;  2UYN A;  3WGN A;  1E7K A;  2HRU A;  3D00 A;  1JN1 A;  2VGN A;  3P4E A;  2HRY A;  1SA0 B;  4RQO A;  1YHQ F;  3E22 B;  3VO8 A;  2VGM A;  1W5A A;  5LP6 B;  4ZHW A;  3E22 A;  2BTQ B;  3N2G B;  5CB4 A;  1TUB A;  4TV9 B;  4O2B B;  5JH7 A;  1JD1 A;  5DCV A;  4HNA A;  1CLI A;  5JH7 B;  1H7M A;  3LYB A;  5C8Y A;  5B8F A;  1W3E X;  3JAT B;  1DBF A;  4IHJ B;  4I50 A;  1OFU A;  4BT7 A;  2UYJ A;  1DT9 A;  2H8E A;  3NVI B;  3RYF B;  4BT4 A;  1N8R H;  3U0O A;  1FNJ A;  5EWR A;  5CA1 A;  4G4Y A;  4X1Y A;  3HTN A;  5EYP B;  3MQW A;  4M8I A;  1X7O A;  3S0W A;  1U3L A;  5GAN K;  2KGW A;  1IV3 A;  1T0A A;  1Z5V A;  4LCK A;  4TV9 A;  2L26 A;  1YJ9 F;  4F6R B;  3F0G A;  1VQ4 F;  3NVK E;  4O4I A;  2IAF A;  1RA4 A;  5J2T A;  1VK3 A;  4TUY B;  5HY0 A;  3JAR A;  5CA0 B;  2HX0 A;  3FBA A;  3N4Y A;  1U43 A;  4C82 A;  3WGJ A;  3LWR C;  3VYT C;  2OTJ F;  3KJJ A;  1W57 A;  3P0Z A;  5JCO C;  2G9I A;  5LA6 A;  5KX5 B;  3PLA C;  3JAL B;  3CYQ A;  1XV2 A;  2EWC A;  2KTV A;  2YXZ A;  3TD5 A;  3C8L A;  5CA1 B;  1CN7 A;  3J7A R;  1FNK A;  4BT5 A;  4O4H B;  4EB6 B;  1QVF F;  1W42 A;  3CME F;  3FFM A;  3NK6 A;  1W41 A;  5JVD A;  1T0K B;  3RA6 A;  3VMF B;  2DT4 A;  4I55 A;  4ZI7 B;  2Z1T A;  3V7Q A;  3CCU F;  1VQ6 F;  2H6L A;  5GON B;  3S02 A;  1YJN F;  4I55 B;  4ZI7 A;  2F9Z C;  3JAL A;  3J81 M;  2R75 1;  3ESJ A;  4WBN A;  3D01 A;  1K8A H;  3JAW A;  4RHA A;  4X3L A;  4DRX A;  3F6M A;  5MN5 A;  3JAW B;  4BT6 A;  5EAZ A;  5IJ0 A;  2JNB A;  3N2K B;  4BVT A;  1X52 A;  2AIF A;  2RHL A;  3CCJ F;  3CYP B;  1CK2 A;  1SA0 A;  3HKC B;  3CPW F;  3NK7 A;  5LYJ A;  4WBN B;  1PF5 A;  1QAH A;  1Q7Y H;  3E20 B;  3VYS C;  4YJ2 A;  3K12 A;  3KHN A;  3CC2 F;  1IPA A;  4BY9 D;  5EYP A;  5IJ0 B;  1U40 A;  5BMV A;  1Q82 H;  1IV1 A;  3N2G A;  2V9Y A;  5LOV B;  2CSL A;  3TD3 A;  3GYQ A;  3RE3 A;  3MDO A;  3CC7 F;  2GZL A;  4E6E A;  3FPI A;  2UYK A;  1GZ0 A;  4B45 A;  3JAR B;  5CA0 A;  5C8Y B;  2Z1U A;  4KWE A;  3OBW A;  1RQ2 A;  5GIO C;  2ALE A;  3N4Z A;  3QHD A;  2MQE A;  5LP6 A;  5LYJ B;  5KMG B;  3EOR A;  2LBT A;  1ZWZ A;  2LCA A;  4X1Y B;  3IR9 A;  5LA6 B;  3LWO C;  3TD4 A;  1K9M H;  2OTL F;  5HY4 A;  3LDT A;  5G4V C;  4O2A B;  3HKB A;  1IV4 A;  3RYH B;  4G4V A;  3K0T A;  2ZAU A;  1IV2 A;  3LWV C;  4IHJ A;  3CCE F;  1Q81 H;  5JVD B;  1ONI A;  4F6R A;  3SIV A;  1J7H A;  3PAF A;  4O4I B;  2GLZ A;  1X25 A;  1RLU A;  5FNV B;  2ZF8 A;  4TUY A;  3RYI A;  2QEX F;  5KX5 A;  5EIB D;  1YJW F;  3CD6 F;  3JAS B;  3MCA B;  3CCR F;  1W5B A;  4EB6 A;  4C81 A;  3N2K A;  5JQG A;  2QA4 F;  3S0Y A;  3SIU A;  3T80 A;  4X1K A;  2W8B C;  4G4W A;  3S03 A;  2CHT A;  3WJR A;  4C8E A;  3CMA F;  1NQ3 A;  5IT9 M;  3M84 A;  2LBW A;  5GON A;  4YJ3 A;  5HXU A;  1QU9 A;  3RYC B;  3NMU C;  2HS0 A;  3HKE A;  4ERH A;  5HWE A;  2GVI A;  3G71 F;  3S06 A;  2CHS A;  5EB1 B;  2Z1E A;  3RYI B;  3CB2 A;  1YIT F;  2K1S A;  3ZP4 A;  5IYZ B;  2OZB A;  4O4H A;  4G4Z A;  1RLG A;  1YQN A;  1VQN F;  3WJQ A;  1YIJ F;  5GIP C;  5IJ9 A;  1ODE A;  4O4J B;  4TV8 A;  3CCV F;  4FFB B;  3JAK B;  3HKE B;  5IJ9 B;  2UYN B;  3HAX D;  4X3M A;  1FFX A;  1W59 A;  2KG4 A;  3OBY A;  2HS3 A;  3JVH A;  4B46 A;  5KMG A;  3JCM M;  5MN4 A;  3C9T A;  1W2B F;  5HP8 A;  1RQ7 A;  1W58 1;  5J2U A;  3ELC A;  3M4S A;  4G88 A;  3LFO A;  4NWO B;  5JCO A;  1VQK F;  1W5F A;  3MBM A;  4EI7 A;  3RYH A;  4TV8 B;  3IMP A;  2CVL A;  2WAL A;  2P6Y A;  5LOV A;  1KQS F;  2FC3 A;  4C4W C;  3CCS F;  3HWU A;  1VQV A;  4HNA B;  3ZOP A;  2KTU A;  5EZY A;  2B33 A;  2VAM A;  1KD1 H;  4YJ2 B;  3VTI C;  3GTZ A;  2AMT A;  3KE1 A;  3VIU A;  3VI6 A;  1W5E A;  3F0F A;  4NUT A;  3I7T A;  3FD6 A;  3JAM M;  3QUW A;  3AGK A;  4C8I A;  5G4U C;  4XCQ A;  5JQG B;  3WGK A;  3UT5 B;  4I4T A;  3CCL F;  2YYE A;  1SZQ A;  2HP3 A;  1U3P A;  3D54 A;  5HY1 A;  2QI2 A;  4ZOL B;  3O85 A;  2RHH A;  2I6D A;  4B62 A;  3C9S A;  3GHZ A;  4BVR A;  5GAP K;  3RYC A;  2ZOV A;  2Z1F A;  3HKD A;  5FNV A;  1R1M A;  3WPW A;  3HJW C;  2BO1 A;  1JJ2 F;  2H8C A;  3JAS A;  3VOA A;  4IIJ B;  4O2A A;  3HKB B;  1XBI A;  5IYZ A;  3MCQ A;  1FSZ A; 
#chains in the Genus database with same CATH homology
 2KTV A;  2FGY A;  2QA4 F;  3SIU A;  1GO0 A;  1CN7 A;  1VQP F;  3J7A R;  3RA5 A;  3CMA F;  4TZZ A;  5IT9 M;  3LWP C;  1QVF F;  1PXW A;  1W42 A;  2LBW A;  2LBX A;  3CME F;  5HXU A;  3FFM A;  3G6E F;  1NMU B;  3WXM B;  3NK6 A;  1W41 A;  1T0K B;  3I55 F;  3RA6 A;  3NMU C;  3VMF B;  1X7P A;  3V7Q A;  3CCU F;  1VQ6 F;  3E1Y A;  5HWE A;  4NQ3 A;  1YJN F;  3G71 F;  1VQ5 F;  1NJI H;  2F9Z C;  3J81 M;  4EI8 A;  1YIT F;  1K8A H;  2OZB A;  4X3L A;  3CC4 F;  1RLG A;  1VQL F;  1VQ9 F;  5FJ4 C;  1SDS A;  1VQN F;  1YIJ F;  5GIP C;  2JNB A;  3J80 M;  3CCV F;  4BVT A;  1X52 A;  3G4S F;  4X3M A;  2AIF A;  1W40 A;  3HAX D;  3CCJ F;  1KC8 H;  4BVS A;  2KG4 A;  3OBY A;  1CK2 A;  1M1K H;  3V7E A;  3CPW F;  1GO1 A;  5HXZ A;  3NK7 A;  3JCM M;  5FLX M;  1E7K A;  1Q86 H;  1W2B F;  1Q7Y H;  3D00 A;  3E20 B;  2CZW A;  2VGN A;  3CCM F;  1YHQ F;  3LFO A;  2VGM A;  1VQK F;  1K73 H;  3CC2 F;  1IPA A;  3CPQ A;  4EI9 A;  4BY9 D;  1S72 F;  3V3T A;  4EI7 A;  5HY2 A;  1Q82 H;  5GIN C;  5DCV A;  3GYQ A;  2WAL A;  3CC7 F;  3ON1 A;  1KQS F;  2FC3 A;  4C4W C;  3CCS F;  1H7M A;  1W3E X;  1GZ0 A;  3CXC F;  2KTU A;  1KD1 H;  3OBW A;  1DT9 A;  2ALE A;  3N4Z A;  5GIO C;  3I56 F;  3NVI B;  3VI6 A;  4NUT A;  3JAM M;  3AGK A;  1ZWZ A;  3LWO C;  1N8R H;  3IR9 A;  4BW0 B;  1VQ7 F;  5G4U C;  4XCQ A;  5EO3 A;  5EWR A;  1K9M H;  5HY4 A;  5G4V C;  3CCL F;  2OTL F;  3CCQ F;  5HY1 A;  2QI2 A;  1X7O A;  5GAN K;  3O85 A;  1VQM F;  1QVG F;  2I6D A;  4LCK A;  3OW2 F;  2OHW A;  1YJ9 F;  4BVR A;  5GAP K;  3LWV C;  1VQO F;  3CCE F;  1VQ4 F;  1Q81 H;  3NVK E;  2HVY D;  3SIV A;  3LWQ C;  1M90 H;  1RA4 A;  3PAF A;  4BVQ A;  3HJW C;  2BO1 A;  2GLZ A;  5HY0 A;  1JJ2 F;  3N4Y A;  5A2Q M;  3LWR C;  2QEX F;  1YJW F;  2OTJ F;  1XBI A;  3CG6 A;  3CD6 F;  3MCA B;  1YI2 F;  1VQ8 F;  3CCR F;  3PLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...