3CMEF

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cmeF00
3GYQA 3NVIB 3CXCF 3E1YA 1KD1H 3NK6A 3CMAF 1GO1A 5FLXM 1K9MH 1YITF 1Q82H 3CC7F 4LCKA 1W3EX 3VI6A 2JNBA 3WXMB 3OBYA 3G71F 1Q7YH 1RA4A 3NVKE 1XBIA 4X3LA 2CZWA 3J80M 1VQ9F 3OBWA 2VGMA 1QVFF 3CG6A 1X52A 5GAPK 1YJWF 3CCMF 3N4ZA 4C4WC 3LFOA 3CCQF 1VQPF 3SIUA 1X7OA 1YI2F 3N4YA 5IT9M 1VQ8F 3CMEF 1S72F 3CPQA 2LBXA 3PLAC 1IPAA 3CD6F 3CC4F 3E20B 3LWOC 1YIJF 2KG4A 1GO0A 2LBWA 2KTUA 3NMUC 3HAXD 1QVGF 3JAMM 2AIFA 1N8RH 3J7AR 2BO1A 4BW0B 3CCEF 1CK2A 2ALEA 1GZ0A 3LWRC 2QA4F 1NMUB 1YJ9F 3V7QA 3I55F 2OTLF 5DCVA 3ON1A 5EO3A 3HJWC 1VQOF 3LWPC 1CN7A 3NK7A 5GANK 4NUTA 3V7EA 3SIVA 2OTJF 5GINC 1W2BF 1YJNF 1SDSA 3CCVF 1M1KH 1W41A 3OW2F 1ZWZA 2I6DA 2HVYD 3AGKA 1VQNF 2QI2A 3PAFA 1Q81H 1VQ5F 3J81M 3CC2F 3LWQC 1K8AH 1Q86H 3CCJF 2OHWA 3VMFB 1VQ7F 1PXWA 3CCSF 4X3MA 3FFMA 3CCLF 1VQ4F 1E7KA 1NJIH 5A2QM 1YHQF 1KQSF 4BY9D 5G4UC 3CCRF 2OZBA 5G4VC 1W42A 5EWRA 3LWVC 1VQMF 1VQ6F 3G6EF 2VGNA 1W40A 1T0KB 2QEXF 3RA5A 1DT9A 1H7MA 3G4SF 3CPWF 2WALA 3I56F 1K73H 4TZZA 3MCAB 1JJ2F 5GIPC 5GIOC 2KTVA 1KC8H 5FJ4C 3IR9A 1X7PA 3JCMM 3RA6A 1M90H 2FC3A 1RLGA 3CCUF 3O85A 1VQKF 1VQLF
chains in the Genus database with same CATH superfamily
3FD5A 4BT2A 3GYQA 5EZYA 2HRYA 3CMAF 4BT6A 3JALB 4LCKA 1XRGA 4TV8B 2P6YA 3G71F 3WGMA 1RA4A 3VYUC 1XBIA 4X3LA 3RYCA 2LBTA 2CHSA 2VGMA 5MN6A 1QVFF 1YJWF 1W5FA 3CCMF 1JFFA 3R0PA 3TD3A 1X7OA 2PHNA 3CMEF 2R6R1 1R1MA 2F9ZC 3I3FA 4I50A 3LDTA 4PWTA 2KTUA 3NMUC 1IV4A 4YJ3A 2H8EA 2AIFA 1U3LA 5J2UB 5LA6B 2HRUA 2UYKA 4O4IA 4C82A 2G9IA 5HP7A 1GZ0A 2UYNA 4B46A 3TD5A 2EWCA 3F6MA 3RYHA 3V7QA 5EZYB 4O4HA 5DCVA 2CVLA 2ZVZA 4ZI7A 3S06A 2RHHA 1VQOF 5MN5A 1CN7A 2B33A 5IYZA 4FFBA 3JASB 4X1KB 3RYCB 5GINC 1YJNF 3E22A 1W2BF 3C9SA 4M8IA 3FD6A 1U43A 2VAWA 1JFFB 2Q1YA 1VQ5F 4C8EA 3LWQC 3VMFB 5HY0A 4ZK7A 4NQ3A 1Q8RA 5BMVA 3FFMA 1W5AA 3QHDA 4I50B 4B5CA 1VQ4F 1E7KA 1NJIH 2Z1EA 5G4UC 4BY9D 4BT4A 5JH7A 2ZAUA 2CSLA 4YJ3B 5G4VC 2W8BC 5KX5A 1W42A 3MBMA 2Z1UA 4O4IB 3G6EF 2IG8A 1CLIA 2QEXF 3DC2A 1Z5VA 1QAHA 4ZHYB 3VO8A 2UYNB 1DT9A 3S0YA 3RYHB 1RQ7A 4DRXA 2WALA 1K73H 4RQOA 1JJ2F 4O4HB 1KC8H 3GHZA 5FJ4C 3IR9A 1X7PA 3JCMM 4ZI7B 5FNVB 1FNKA 3RYFA 3D54A 5EB1B 2VAMA 4FFBB 5IYZB 3HKBA 3O85A 3D01A 2AMTA 3E22B 3HWUA 4G4YA 2MQEA 3E1YA 4TUYA 3NK6A 1X25A 3K14A 5EB0A 3WXMB 3IEWA 3C8LA 5C8YA 2CZWA 2YXZA 3F0GA 2HQSC 5B8FA 5BMVB 5JH7B 1U40A 3OONA 5KX5B 1VQPF 3SIUA 3IKFA 3N4YA 5EIBC 1XHOA 2PMPA 3HKEA 4BT7A 1VQ8F 3ZOPA 2LBXA 3CPQA 1IPAA 4O2BA 3MQWA 4HNAA 3HTNA 4B62A 1YIJF 3N2GB 3JVHA 4C81A 1QVGF 3P0ZA 1UFYA 1TUBA 4IIJA 3DDNA 3ESJA 5AVMA 1FNJA 3RYFB 2HS4A 1YQNA 2BTUA 3HKBB 1NMUB 3CYQA 4IHJA 3LYBA 1OAPA 2IQQA 2N48A 4TUYB 2OTLF 4BVTA 2Z1FA 2ZOVA 4WBNA 3P10A 5HY1A 3ON1A 4LNUA 4ZOLB 5C8YB 3UT5A 2V9YA 1U3PA 3B6NA 4G4XA 5LP6C 2OTJF 1SDSA 1M1KH 1GX1A 1W41A 3AGKA 3V4DA 4BVSA 3S03A 4TV9A 3C9TA 2CWJA 3HKEB 1W55A 1Q86H 2UZHA 4O2BB 1NQ3A 3CCSF 2CHTA 3CCLF 4HNAB 1COMA 5GONA 3WJPA 1YHQF 3CCRF 2HS3A 3WGNA 1TVKA 4X1IA 2IAFA 1VQMF 2FGYA 4EI7A 1TUBB 2OTMA 4IIJB 5LYJA 3KIZA 3K2XA 1H7MA 3CPWF 3I7TA 4IHJB 4TZZA 3MCAB 2KTVA 4BVRA 4WBNB 5IJ0A 5EIBD 3RYIA 1RLGA 3UT5B 3T80A 1VQKF 5CA0A 3NVIB 1GO1A 4XCQA 5FLXM 1FFXA 5HWEA 3M1XA 3WPXA 4BT5A 4ZHQA 5HXUA 5HY2A 1YITF 3CYPB 1Q82H 5JCOA 3CC7F 2CW4A 3VI6A 4ERHA 4TV9B 3OBYA 5HY4A 5CA1A 1SA0A 1W5EA 3ZP7A 1VQ9F 3F0FA 5HXZA 4DXDA 3CG6A 1X52A 3N4ZA 5GONB 1KNJA 2RHOA 1TVKB 2ZODA 4X1IB 1ONIA 1YI2F 5EAZA 4I4TA 4O2AA 5IT9M 3S02A 5LYJB 3PLAC 5HP8A 2H8CA 3E20B 3LWOC 2ZF8A 1GO0A 4U3JA 4E6EA 3JAKA 3JATA 3J7AR 4BW0B 2KGWA 2Z1TA 4TV8A 5KMGA 3CCEF 1CK2A 5IJ0B 2HP0A 5LP6A 2UYJA 3LWRC 3MDOA 3RYIB 4B45A 3VTIC 1VHAA 3U0OA 5CA0B 3I55F 3KE1A 2RHJA 5EYPA 2QTPA 1YGYA 1VH8A 5JCOC 4ZHQB 5IJ9A 1IV2A 3KJKA 3HJWC 3F0DA 1VQVA 5MN4A 3LWPC 1J7HA 3NK7A 5CA1B 1JD1A 4BVQA 3SIVA 2GLZA 1SA0B 1XV2A 1ODEA 3KJJA 3RE3A 2RHLA 3WJQA 4DRXB 3OW2F 3V3TA 3HKDA 1ZWZA 1W581 2I6DA 2HVYD 1VQNF 3WGJA 3L7QA 1JN1A 3PAFA 5ITZA 3J81M 3MCQA 3CC2F 1OFUA 4X1YA 3WJRA 5LXTA 1T0AA 4I4TB 4O2AB 5JVDA 2OHWA 3CCJF 1K8AH 1VQ7F 4R40B 1PXWA 4EI8A 3VOBA 4X3MA 4KWEA 3ZO8A 1W5BA 4U3JB 4EB6A 3JAKB 3JATB 2GZLA 1VQ6F 5KMGB 5JQGA 3JARA 1PF5A 1W40A 2HP0B 5LP6B 3K0TA 3JASA 2Z01A 1RLUA 4X1KA 3G4SF 4YJ2A 1DBFA 5J2TA 4G4ZA 3EORA 5EYPB 3HKCA 5GIOC 5GIPC 1VK3A 1QU9A 5IJ9B 4G4VA 3RA6A 3GTZA 3KHNA 2FC3A 1M90H 1H47A 3VCZA 1VQLF 2UYPA 3CXCF 5CB4A 3HKDB 1KD1H 3IMPA 2LCAA 1K9MH 1FSZA 4ZHVA 2HS0A 4O4JA 4C8IA 1W3EX 3VIUA 3WPWA 5ITZB 4F6RA 2JNBA 4X1YB 5LXTB 1Q7YH 3JAWA 5JVDB 3NVKE 2HP3A 3J80M 3BYQA 3OBWA 3P4EA 1IV3A 5GAPK 2YYEA 4C4WC 3LFOA 2BTQB 3CCQF 4EB6B 4LNUB 3VYSC 1UI9A 4RHAA 3CB2A 3FBAA 1S72F 5FNVA 5JQGB 3JARB 3CD6F 4G4WA 3CC4F 2KG4A 4YJ2B 2LBWA 3HAXD 5J2TB 3JAMM 1N8RH 2AIZP 3C9RA 2HX0A 4X20A 2BO1A 3HKCB 1W59A 2DT4A 5LOVA 2VXYA 3IKEA 2ALEA 3F0EA 3TD4A 4O4LA 2QA4F 3VOAA 1Z5WA 2NMUA 3C9UA 1YJ9F 4EI9A 2R751 5CB4B 4G88A 4I55A 3WGLA 4O4JB 3WGKA 3M84A 5EO3A 4F6RB 5GANK 3N2KA 4NUTA 4C8GA 3V7EA 3JAWB 3S0HA 3CCVF 4ZHWA 2BTOA 3N2GA 2ZVYA 3ELCA 2QI2A 1H48A 3JALA 4BT3A 1Q81H 1SZQA 1IV1A 1QD9A 3QUWA 1KNKA 2VAPA 3VYTC 3ZP4A 5A2QM 1FFXB 1KQSF 2I6RA 1W57A 3Q8HA 2OZBA 3IEQA 3LWVC 5EWRA 4X20B 5LOVB 4U39A 2VGNA 3FPIA 3D00A 1T0KB 2K1SA 3LMEA 4NWOB 3K12A 4O4LB 4ZOLA 3RA5A 3S0WA 1JY8A 2DYYA 2H6LA 3I56F 1RQ2A 2L26A 5LA6A 5J2UA 4I55B 2RB9A 2Q1XA 3QTYA 2GVIA 3M4SA 3N2KB 3CCUF 3ERNA
chains in the Genus database with same CATH topology
3GYQA 3NVIB 3CXCF 3E1YA 1KD1H 3NK6A 3CMAF 1GO1A 4XCQA 5FLXM 1K9MH 5HWEA 5HXUA 1YITF 5HY2A 1Q82H 3CC7F 4LCKA 1W3EX 3VI6A 2JNBA 3WXMB 3OBYA 5HY4A 3G71F 1Q7YH 1RA4A 3NVKE 1XBIA 4X3LA 2CZWA 3J80M 1VQ9F 3OBWA 5HXZA 2VGMA 1QVFF 3CG6A 1X52A 5GAPK 1YJWF 3CCMF 3N4ZA 4C4WC 3LFOA 3CCQF 1VQPF 3SIUA 1X7OA 1YI2F 3N4YA 5IT9M 1VQ8F 3CMEF 1S72F 3CPQA 2LBXA 3PLAC 1IPAA 2F9ZC 3CD6F 3CC4F 3E20B 3LWOC 1YIJF 2KG4A 1GO0A 2LBWA 2KTUA 3NMUC 3HAXD 1QVGF 3JAMM 2AIFA 1N8RH 3J7AR 2BO1A 4BW0B 3CCEF 1CK2A 2ALEA 1GZ0A 3LWRC 2QA4F 1NMUB 1YJ9F 4EI9A 3V7QA 3I55F 2OTLF 4BVTA 5DCVA 5HY1A 3ON1A 5EO3A 3HJWC 1VQOF 3LWPC 1CN7A 3NK7A 5GANK 4NUTA 3V7EA 3SIVA 4BVQA 2OTJF 2GLZA 5GINC 1W2BF 1YJNF 1SDSA 3CCVF 1M1KH 1W41A 3OW2F 3V3TA 1ZWZA 2I6DA 2HVYD 3AGKA 1VQNF 2QI2A 4BVSA 3PAFA 1Q81H 1VQ5F 3J81M 3CC2F 3LWQC 1K8AH 1Q86H 3CCJF 2OHWA 3VMFB 5HY0A 1VQ7F 4NQ3A 1PXWA 4EI8A 3CCSF 4X3MA 3FFMA 3CCLF 1VQ4F 1E7KA 1NJIH 5A2QM 1YHQF 1KQSF 4BY9D 5G4UC 3CCRF 2OZBA 5G4VC 1W42A 5EWRA 3LWVC 1VQMF 1VQ6F 2FGYA 4EI7A 3G6EF 2VGNA 1W40A 3D00A 1T0KB 2QEXF 3RA5A 1DT9A 1H7MA 3G4SF 3CPWF 2WALA 3I56F 1K73H 4TZZA 3MCAB 1JJ2F 5GIPC 5GIOC 2KTVA 1KC8H 5FJ4C 3IR9A 4BVRA 1X7PA 3JCMM 3RA6A 1M90H 2FC3A 1RLGA 3CCUF 3O85A 1VQKF 1VQLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYQ A;  3NVI B;  3CXC F;  3E1Y A;  1KD1 H;  3NK6 A;  3CMA F;  1GO1 A;  5FLX M;  1K9M H;  1YIT F;  1Q82 H;  3CC7 F;  4LCK A;  1W3E X;  3VI6 A;  2JNB A;  3WXM B;  3OBY A;  3G71 F;  1Q7Y H;  1RA4 A;  3NVK E;  1XBI A;  4X3L A;  2CZW A;  3J80 M;  1VQ9 F;  3OBW A;  2VGM A;  1QVF F;  3CG6 A;  1X52 A;  5GAP K;  1YJW F;  3CCM F;  3N4Z A;  4C4W C;  3LFO A;  3CCQ F;  1VQP F;  3SIU A;  1X7O A;  1YI2 F;  3N4Y A;  5IT9 M;  1VQ8 F;  3CME F;  1S72 F;  3CPQ A;  2LBX A;  3PLA C;  1IPA A;  3CD6 F;  3CC4 F;  3E20 B;  3LWO C;  1YIJ F;  2KG4 A;  1GO0 A;  2LBW A;  2KTU A;  3NMU C;  3HAX D;  1QVG F;  3JAM M;  2AIF A;  1N8R H;  3J7A R;  2BO1 A;  4BW0 B;  3CCE F;  1CK2 A;  2ALE A;  1GZ0 A;  3LWR C;  2QA4 F;  1NMU B;  1YJ9 F;  3V7Q A;  3I55 F;  2OTL F;  5DCV A;  3ON1 A;  5EO3 A;  3HJW C;  1VQO F;  3LWP C;  1CN7 A;  3NK7 A;  5GAN K;  4NUT A;  3V7E A;  3SIV A;  2OTJ F;  5GIN C;  1W2B F;  1YJN F;  1SDS A;  3CCV F;  1M1K H;  1W41 A;  3OW2 F;  1ZWZ A;  2I6D A;  2HVY D;  3AGK A;  1VQN F;  2QI2 A;  3PAF A;  1Q81 H;  1VQ5 F;  3J81 M;  3CC2 F;  3LWQ C;  1K8A H;  1Q86 H;  3CCJ F;  2OHW A;  3VMF B;  1VQ7 F;  1PXW A;  3CCS F;  4X3M A;  3FFM A;  3CCL F;  1VQ4 F;  1E7K A;  1NJI H;  5A2Q M;  1YHQ F;  1KQS F;  4BY9 D;  5G4U C;  3CCR F;  2OZB A;  5G4V C;  1W42 A;  5EWR A;  3LWV C;  1VQM F;  1VQ6 F;  3G6E F;  2VGN A;  1W40 A;  1T0K B;  2QEX F;  3RA5 A;  1DT9 A;  1H7M A;  3G4S F;  3CPW F;  2WAL A;  3I56 F;  1K73 H;  4TZZ A;  3MCA B;  1JJ2 F;  5GIP C;  5GIO C;  2KTV A;  1KC8 H;  5FJ4 C;  3IR9 A;  1X7P A;  3JCM M;  3RA6 A;  1M90 H;  2FC3 A;  1RLG A;  3CCU F;  3O85 A;  1VQK F;  1VQL F; 
#chains in the Genus database with same CATH topology
 3FD5 A;  4BT2 A;  3GYQ A;  5EZY A;  2HRY A;  3CMA F;  4BT6 A;  3JAL B;  4LCK A;  1XRG A;  4TV8 B;  2P6Y A;  3G71 F;  3WGM A;  1RA4 A;  3VYU C;  1XBI A;  4X3L A;  3RYC A;  2LBT A;  2CHS A;  2VGM A;  5MN6 A;  1QVF F;  1YJW F;  1W5F A;  3CCM F;  1JFF A;  3R0P A;  3TD3 A;  1X7O A;  2PHN A;  3CME F;  2R6R 1;  1R1M A;  2F9Z C;  3I3F A;  4I50 A;  3LDT A;  4PWT A;  2KTU A;  3NMU C;  1IV4 A;  4YJ3 A;  2H8E A;  2AIF A;  1U3L A;  5J2U B;  5LA6 B;  2HRU A;  2UYK A;  4O4I A;  4C82 A;  2G9I A;  5HP7 A;  1GZ0 A;  2UYN A;  4B46 A;  3TD5 A;  2EWC A;  3F6M A;  3RYH A;  3V7Q A;  5EZY B;  4O4H A;  5DCV A;  2CVL A;  2ZVZ A;  4ZI7 A;  3S06 A;  2RHH A;  1VQO F;  5MN5 A;  1CN7 A;  2B33 A;  5IYZ A;  4FFB A;  3JAS B;  4X1K B;  3RYC B;  5GIN C;  1YJN F;  3E22 A;  1W2B F;  3C9S A;  4M8I A;  3FD6 A;  1U43 A;  2VAW A;  1JFF B;  2Q1Y A;  1VQ5 F;  4C8E A;  3LWQ C;  3VMF B;  5HY0 A;  4ZK7 A;  4NQ3 A;  1Q8R A;  5BMV A;  3FFM A;  1W5A A;  3QHD A;  4I50 B;  4B5C A;  1VQ4 F;  1E7K A;  1NJI H;  2Z1E A;  5G4U C;  4BY9 D;  4BT4 A;  5JH7 A;  2ZAU A;  2CSL A;  4YJ3 B;  5G4V C;  2W8B C;  5KX5 A;  1W42 A;  3MBM A;  2Z1U A;  4O4I B;  3G6E F;  2IG8 A;  1CLI A;  2QEX F;  3DC2 A;  1Z5V A;  1QAH A;  4ZHY B;  3VO8 A;  2UYN B;  1DT9 A;  3S0Y A;  3RYH B;  1RQ7 A;  4DRX A;  2WAL A;  1K73 H;  4RQO A;  1JJ2 F;  4O4H B;  1KC8 H;  3GHZ A;  5FJ4 C;  3IR9 A;  1X7P A;  3JCM M;  4ZI7 B;  5FNV B;  1FNK A;  3RYF A;  3D54 A;  5EB1 B;  2VAM A;  4FFB B;  5IYZ B;  3HKB A;  3O85 A;  3D01 A;  2AMT A;  3E22 B;  3HWU A;  4G4Y A;  2MQE A;  3E1Y A;  4TUY A;  3NK6 A;  1X25 A;  3K14 A;  5EB0 A;  3WXM B;  3IEW A;  3C8L A;  5C8Y A;  2CZW A;  2YXZ A;  3F0G A;  2HQS C;  5B8F A;  5BMV B;  5JH7 B;  1U40 A;  3OON A;  5KX5 B;  1VQP F;  3SIU A;  3IKF A;  3N4Y A;  5EIB C;  1XHO A;  2PMP A;  3HKE A;  4BT7 A;  1VQ8 F;  3ZOP A;  2LBX A;  3CPQ A;  1IPA A;  4O2B A;  3MQW A;  4HNA A;  3HTN A;  4B62 A;  1YIJ F;  3N2G B;  3JVH A;  4C81 A;  1QVG F;  3P0Z A;  1UFY A;  1TUB A;  4IIJ A;  3DDN A;  3ESJ A;  5AVM A;  1FNJ A;  3RYF B;  2HS4 A;  1YQN A;  2BTU A;  3HKB B;  1NMU B;  3CYQ A;  4IHJ A;  3LYB A;  1OAP A;  2IQQ A;  2N48 A;  4TUY B;  2OTL F;  4BVT A;  2Z1F A;  2ZOV A;  4WBN A;  3P10 A;  5HY1 A;  3ON1 A;  4LNU A;  4ZOL B;  5C8Y B;  3UT5 A;  2V9Y A;  1U3P A;  3B6N A;  4G4X A;  5LP6 C;  2OTJ F;  1SDS A;  1M1K H;  1GX1 A;  1W41 A;  3AGK A;  3V4D A;  4BVS A;  3S03 A;  4TV9 A;  3C9T A;  2CWJ A;  3HKE B;  1W55 A;  1Q86 H;  2UZH A;  4O2B B;  1NQ3 A;  3CCS F;  2CHT A;  3CCL F;  4HNA B;  1COM A;  5GON A;  3WJP A;  1YHQ F;  3CCR F;  2HS3 A;  3WGN A;  1TVK A;  4X1I A;  2IAF A;  1VQM F;  2FGY A;  4EI7 A;  1TUB B;  2OTM A;  4IIJ B;  5LYJ A;  3KIZ A;  3K2X A;  1H7M A;  3CPW F;  3I7T A;  4IHJ B;  4TZZ A;  3MCA B;  2KTV A;  4BVR A;  4WBN B;  5IJ0 A;  5EIB D;  3RYI A;  1RLG A;  3UT5 B;  3T80 A;  1VQK F;  5CA0 A;  3NVI B;  1GO1 A;  4XCQ A;  5FLX M;  1FFX A;  5HWE A;  3M1X A;  3WPX A;  4BT5 A;  4ZHQ A;  5HXU A;  5HY2 A;  1YIT F;  3CYP B;  1Q82 H;  5JCO A;  3CC7 F;  2CW4 A;  3VI6 A;  4ERH A;  4TV9 B;  3OBY A;  5HY4 A;  5CA1 A;  1SA0 A;  1W5E A;  3ZP7 A;  1VQ9 F;  3F0F A;  5HXZ A;  4DXD A;  3CG6 A;  1X52 A;  3N4Z A;  5GON B;  1KNJ A;  2RHO A;  1TVK B;  2ZOD A;  4X1I B;  1ONI A;  1YI2 F;  5EAZ A;  4I4T A;  4O2A A;  5IT9 M;  3S02 A;  5LYJ B;  3PLA C;  5HP8 A;  2H8C A;  3E20 B;  3LWO C;  2ZF8 A;  1GO0 A;  4U3J A;  4E6E A;  3JAK A;  3JAT A;  3J7A R;  4BW0 B;  2KGW A;  2Z1T A;  4TV8 A;  5KMG A;  3CCE F;  1CK2 A;  5IJ0 B;  2HP0 A;  5LP6 A;  2UYJ A;  3LWR C;  3MDO A;  3RYI B;  4B45 A;  3VTI C;  1VHA A;  3U0O A;  5CA0 B;  3I55 F;  3KE1 A;  2RHJ A;  5EYP A;  2QTP A;  1YGY A;  1VH8 A;  5JCO C;  4ZHQ B;  5IJ9 A;  1IV2 A;  3KJK A;  3HJW C;  3F0D A;  1VQV A;  5MN4 A;  3LWP C;  1J7H A;  3NK7 A;  5CA1 B;  1JD1 A;  4BVQ A;  3SIV A;  2GLZ A;  1SA0 B;  1XV2 A;  1ODE A;  3KJJ A;  3RE3 A;  2RHL A;  3WJQ A;  4DRX B;  3OW2 F;  3V3T A;  3HKD A;  1ZWZ A;  1W58 1;  2I6D A;  2HVY D;  1VQN F;  3WGJ A;  3L7Q A;  1JN1 A;  3PAF A;  5ITZ A;  3J81 M;  3MCQ A;  3CC2 F;  1OFU A;  4X1Y A;  3WJR A;  5LXT A;  1T0A A;  4I4T B;  4O2A B;  5JVD A;  2OHW A;  3CCJ F;  1K8A H;  1VQ7 F;  4R40 B;  1PXW A;  4EI8 A;  3VOB A;  4X3M A;  4KWE A;  3ZO8 A;  1W5B A;  4U3J B;  4EB6 A;  3JAK B;  3JAT B;  2GZL A;  1VQ6 F;  5KMG B;  5JQG A;  3JAR A;  1PF5 A;  1W40 A;  2HP0 B;  5LP6 B;  3K0T A;  3JAS A;  2Z01 A;  1RLU A;  4X1K A;  3G4S F;  4YJ2 A;  1DBF A;  5J2T A;  4G4Z A;  3EOR A;  5EYP B;  3HKC A;  5GIO C;  5GIP C;  1VK3 A;  1QU9 A;  5IJ9 B;  4G4V A;  3RA6 A;  3GTZ A;  3KHN A;  2FC3 A;  1M90 H;  1H47 A;  3VCZ A;  1VQL F;  2UYP A;  3CXC F;  5CB4 A;  3HKD B;  1KD1 H;  3IMP A;  2LCA A;  1K9M H;  1FSZ A;  4ZHV A;  2HS0 A;  4O4J A;  4C8I A;  1W3E X;  3VIU A;  3WPW A;  5ITZ B;  4F6R A;  2JNB A;  4X1Y B;  5LXT B;  1Q7Y H;  3JAW A;  5JVD B;  3NVK E;  2HP3 A;  3J80 M;  3BYQ A;  3OBW A;  3P4E A;  1IV3 A;  5GAP K;  2YYE A;  4C4W C;  3LFO A;  2BTQ B;  3CCQ F;  4EB6 B;  4LNU B;  3VYS C;  1UI9 A;  4RHA A;  3CB2 A;  3FBA A;  1S72 F;  5FNV A;  5JQG B;  3JAR B;  3CD6 F;  4G4W A;  3CC4 F;  2KG4 A;  4YJ2 B;  2LBW A;  3HAX D;  5J2T B;  3JAM M;  1N8R H;  2AIZ P;  3C9R A;  2HX0 A;  4X20 A;  2BO1 A;  3HKC B;  1W59 A;  2DT4 A;  5LOV A;  2VXY A;  3IKE A;  2ALE A;  3F0E A;  3TD4 A;  4O4L A;  2QA4 F;  3VOA A;  1Z5W A;  2NMU A;  3C9U A;  1YJ9 F;  4EI9 A;  2R75 1;  5CB4 B;  4G88 A;  4I55 A;  3WGL A;  4O4J B;  3WGK A;  3M84 A;  5EO3 A;  4F6R B;  5GAN K;  3N2K A;  4NUT A;  4C8G A;  3V7E A;  3JAW B;  3S0H A;  3CCV F;  4ZHW A;  2BTO A;  3N2G A;  2ZVY A;  3ELC A;  2QI2 A;  1H48 A;  3JAL A;  4BT3 A;  1Q81 H;  1SZQ A;  1IV1 A;  1QD9 A;  3QUW A;  1KNK A;  2VAP A;  3VYT C;  3ZP4 A;  5A2Q M;  1FFX B;  1KQS F;  2I6R A;  1W57 A;  3Q8H A;  2OZB A;  3IEQ A;  3LWV C;  5EWR A;  4X20 B;  5LOV B;  4U39 A;  2VGN A;  3FPI A;  3D00 A;  1T0K B;  2K1S A;  3LME A;  4NWO B;  3K12 A;  4O4L B;  4ZOL A;  3RA5 A;  3S0W A;  1JY8 A;  2DYY A;  2H6L A;  3I56 F;  1RQ2 A;  2L26 A;  5LA6 A;  5J2U A;  4I55 B;  2RB9 A;  2Q1X A;  3QTY A;  2GVI A;  3M4S A;  3N2K B;  3CCU F;  3ERN A; 
#chains in the Genus database with same CATH homology
 3GYQ A;  3NVI B;  3CXC F;  3E1Y A;  1KD1 H;  3NK6 A;  3CMA F;  1GO1 A;  4XCQ A;  5FLX M;  1K9M H;  5HWE A;  5HXU A;  1YIT F;  5HY2 A;  1Q82 H;  3CC7 F;  4LCK A;  1W3E X;  3VI6 A;  2JNB A;  3WXM B;  3OBY A;  5HY4 A;  3G71 F;  1Q7Y H;  1RA4 A;  3NVK E;  1XBI A;  4X3L A;  2CZW A;  3J80 M;  1VQ9 F;  3OBW A;  5HXZ A;  2VGM A;  1QVF F;  3CG6 A;  1X52 A;  5GAP K;  1YJW F;  3CCM F;  3N4Z A;  4C4W C;  3LFO A;  3CCQ F;  1VQP F;  3SIU A;  1X7O A;  1YI2 F;  3N4Y A;  5IT9 M;  1VQ8 F;  3CME F;  1S72 F;  3CPQ A;  2LBX A;  3PLA C;  1IPA A;  2F9Z C;  3CD6 F;  3CC4 F;  3E20 B;  3LWO C;  1YIJ F;  2KG4 A;  1GO0 A;  2LBW A;  2KTU A;  3NMU C;  3HAX D;  1QVG F;  3JAM M;  2AIF A;  1N8R H;  3J7A R;  2BO1 A;  4BW0 B;  3CCE F;  1CK2 A;  2ALE A;  1GZ0 A;  3LWR C;  2QA4 F;  1NMU B;  1YJ9 F;  4EI9 A;  3V7Q A;  3I55 F;  2OTL F;  4BVT A;  5DCV A;  5HY1 A;  3ON1 A;  5EO3 A;  3HJW C;  1VQO F;  3LWP C;  1CN7 A;  3NK7 A;  5GAN K;  4NUT A;  3V7E A;  3SIV A;  4BVQ A;  2OTJ F;  2GLZ A;  5GIN C;  1W2B F;  1YJN F;  1SDS A;  3CCV F;  1M1K H;  1W41 A;  3OW2 F;  3V3T A;  1ZWZ A;  2I6D A;  2HVY D;  3AGK A;  1VQN F;  2QI2 A;  4BVS A;  3PAF A;  1Q81 H;  1VQ5 F;  3J81 M;  3CC2 F;  3LWQ C;  1K8A H;  1Q86 H;  3CCJ F;  2OHW A;  3VMF B;  5HY0 A;  1VQ7 F;  4NQ3 A;  1PXW A;  4EI8 A;  3CCS F;  4X3M A;  3FFM A;  3CCL F;  1VQ4 F;  1E7K A;  1NJI H;  5A2Q M;  1YHQ F;  1KQS F;  4BY9 D;  5G4U C;  3CCR F;  2OZB A;  5G4V C;  1W42 A;  5EWR A;  3LWV C;  1VQM F;  1VQ6 F;  2FGY A;  4EI7 A;  3G6E F;  2VGN A;  1W40 A;  3D00 A;  1T0K B;  2QEX F;  3RA5 A;  1DT9 A;  1H7M A;  3G4S F;  3CPW F;  2WAL A;  3I56 F;  1K73 H;  4TZZ A;  3MCA B;  1JJ2 F;  5GIP C;  5GIO C;  2KTV A;  1KC8 H;  5FJ4 C;  3IR9 A;  4BVR A;  1X7P A;  3JCM M;  3RA6 A;  1M90 H;  2FC3 A;  1RLG A;  3CCU F;  3O85 A;  1VQK F;  1VQL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...