1SDSA

Structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
115
structure length
115
Chain Sequence
AVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords box H/ACA sRNA
publication title Structure of Protein L7Ae Bound to a K-Turn Derived from an Archaeal Box H/ACA sRNA at 1.8 A Resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein/rna complex
total genus 38
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1sdsA00
1QVGF 3NK7A 1T0KB 5EWRA 3HJWC 2QEXF 2VGNA 1Q7YH 3LFOA 3N4ZA 2HVYD 1W42A 1YIJF 3CC7F 1ZWZA 3PAFA 3AGKA 1QVFF 1Q81H 1Q82H 3CXCF 1XBIA 3GYQA 3G6EF 5EO3A 3V7EA 3CMAF 3CCVF 1VQ8F 5G4VC 5GINC 3CD6F 2FC3A 3LWPC 3J81M 3CCMF 4LCKA 2KTUA 1H7MA 3CCJF 2OTJF 3SIVA 2KTVA 3CC2F 3ON1A 1YI2F 1E7KA 1NMUB 2CZWA 1YJWF 1Q86H 3I55F 1N8RH 3E20B 3RA6A 3V7QA 3MCAB 2LBWA 4BW0B 5FJ4C 1RA4A 1W3EX 3LWVC 5FLXM 1W41A 3NVIB 5GANK 1GZ0A 1SDSA 2OHWA 3CCUF 3CCQF 3SIUA 4C4WC 1VQ4F 3O85A 3CPQA 3I56F 3G4SF 2QA4F 3NMUC 1KC8H 1K73H 1RLGA 3CC4F 2KG4A 1VQNF 3LWQC 3LWRC 5GAPK 1DT9A 2OTLF 5DCVA 1S72F 3FFMA 4X3MA 1VQPF 1JJ2F 3NVKE 3NK6A 2BO1A 3HAXD 1IPAA 3OW2F 1W2BF 3WXMB 3CPWF 1M1KH 2OZBA 3J7AR 5IT9M 1GO1A 1YJNF 3E1YA 1YJ9F 2QI2A 3CCLF 3CCEF 2ALEA 1X52A 2VGMA 3OBWA 3G71F 1VQLF 2AIFA 1VQ7F 1KQSF 4NUTA 1NJIH 1W40A 1VQ6F 2JNBA 3LWOC 3CMEF 3CCSF 3OBYA 3JCMM 1VQKF 1VQ5F 1K9MH 3CG6A 1VQ9F 3VI6A 1CN7A 4BY9D 1M90H 3N4YA 3J80M 1YHQF 2WALA 1GO0A 3PLAC 1CK2A 4TZZA 3CCRF 1VQMF 3VMFB 2LBXA 1X7OA 3JAMM 5GIOC 2I6DA 5G4UC 3RA5A 5GIPC 1X7PA 3IR9A 4X3LA 1PXWA 1VQOF 1K8AH 5A2QM 1YITF 1KD1H
chains in the Genus database with same CATH superfamily
2L26A 2ZF8A 3CYQA 3OONA 3P4EA 4I55B 4I4TB 3P10A 3R0PA 3LFOA 3N4ZA 3I7TA 2HVYD 5C8YA 5ITZA 3UT5A 1YIJF 3CC7F 3ESJA 1UI9A 5JH7A 2UYNB 1W5AA 4ZHWA 4U39A 5JVDA 1W55A 3QTYA 3CCVF 1RQ7A 2UYPA 3TD5A 4G4VA 5GINC 3JASB 4ZI7B 5EYPB 4C8EA 5IJ0A 3CCMF 3S0WA 2OTJF 3RYCB 3SIVA 1SZQA 4ZOLA 3ON1A 1U3PA 4F6RB 2BTOA 1Q86H 2H8CA 3VYUC 5HY1A 2IQQA 5IJ9B 3V7QA 1QU9A 1Z5WA 1FFXA 4BW0B 1H48A 4BT7A 1JN1A 5EAZA 1W41A 1GZ0A 2RHLA 3CCUF 1IV3A 1Q8RA 3VCZA 1U43A 3RYHB 3SIUA 4C4WC 2UYKA 4O4IB 4BT3A 3CC4F 4PWTA 5DCVA 3WGLA 2VXYA 4O4LB 3JAWB 2HRYA 4X20B 5FNVB 5LXTB 1IV2A 3HAXD 2VAWA 2EWCA 3C8LA 5CA0B 3HKCB 3J7AR 1KNKA 5EB0A 3RYFB 1YGYA 4EI8A 2CWJA 1OFUA 1QAHA 2UZHA 2CVLA 4ZK7A 2H8EA 3RYIB 3JVHA 2GLZA 1W40A 2ZVZA 1VQ6F 5HY0A 4YJ2A 5MN5A 3MDOA 3JCMM 1CN7A 3IMPA 3VI6A 5HP7A 1FNJA 2HS0A 3WJPA 4NWOB 1IV1A 4TZZA 3CCRF 1TVKB 4EI7A 4X1IB 2VAMA 5CB4B 3MQWA 3ZP7A 3HKDB 2HP0A 4X1YA 3JAKA 3LYBA 1FNKA 4G88A 3VOBA 1YITF 5EIBC 3C9RA 4EB6B 2OTMA 1QVGF 3NK7A 1T0KB 2RB9A 2QEXF 5CA1B 5GONA 5LA6B 1U40A 1ZWZA 3PAFA 4IIJA 1XV2A 1T0AA 2QTPA 3K2XA 3GYQA 4BVSA 3CMAF 1VH8A 5BMVA 2IAFA 3D54A 3HKEB 3FPIA 3N2GA 4U3JB 2Z1UA 4C8IA 3Q8HA 3HKBB 4O2AA 4LCKA 3CCJF 5J2UB 3F0FA 3K14A 3ZOPA 5IYZB 3K12A 2BTUA 1ONIA 3S03A 1TUBB 3GHZA 3VYTC 2UYNA 4KWEA 2V9YA 4X1KA 5EZYA 5JCOA 4C82A 1RA4A 3LWVC 5FLXM 3NVIB 3HTNA 3N2KB 5GANK 2KGWA 3T80A 3VOAA 4FFBB 4DRXA 1SDSA 1VQ4F 3TD3A 3VO8A 3G4SF 2QA4F 3NMUC 2W8BC 5JCOC 1R1MA 1VQNF 2KG4A 4F6RA 3LWQC 3JATA 3WJQA 4TV9B 3C9SA 3CB2A 1XHOA 3WGMA 3S06A 5LOVA 1JD1A 3NK6A 2ZVYA 5C8YB 5ITZB 3UT5B 3ERNA 3L7QA 4YJ3A 2CHSA 1W2BF 3WXMB 2AMTA 3CPWF 5IT9M 1GO1A 1YJNF 4O4IA 2QI2A 3CCLF 1Z5VA 3U0OA 3CCEF 3G71F 1X52A 2VGMA 3OBWA 4RQOA 1VQ7F 5IJ0B 4EI9A 2ZAUA 3K0TA 5LP6A 4TUYA 3QUWA 3GTZA 3WPXA 2YYEA 4ZOLB 2HP3A 3LWOC 4B5CA 3OBYA 4BVQA 5JQGA 1K9MH 4BY9D 2RHJA 3J80M 1YHQF 3E22A 1GO0A 5LP6C 4ZHQA 1FFXB 2HS4A 1CK2A 3S0YA 1X7OA 4TV8A 4BT4A 5GIOC 5G4UC 5GIPC 3IR9A 4WBNA 1VQOF 3V4DA 1K8AH 4I50B 1W57A 1W59A 1VHAA 4ZHYB 2R751 2R6R1 4G4WA 5HP8A 3KJKA 5EWRA 2VGNA 4M8IA 1Q7YH 2RHOA 1SA0B 5AVMA 2LBTA 3IKEA 3C9UA 4HNAA 5HY2A 4X1IA 3VTIC 1Q82H 3CXCF 1RLUA 1XBIA 3WGNA 2HX0A 3F0GA 4ERHA 3G6EF 5EO3A 3V7EA 5KMGA 5KX5B 3TD4A 1VQ8F 5G4VC 4O4JB 4BT6A 1JFFB 2FC3A 3LDTA 3LWPC 1QD9A 2I6RA 1GX1A 1YQNA 1DBFA 2KTVA 3CC2F 2HRUA 1E7KA 4R40B 3I55F 4YJ2B 3RA6A 4B46A 1NQ3A 4O4HA 4C8GA 5J2TB 2CSLA 1W581 1VK3A 1W3EX 2Z01A 3HKEA 3JALA 3HWUA 5LYJA 3I3FA 1RQ2A 2Q1XA 3WGJA 3CCQF 3O85A 2GZLA 3I56F 1FSZA 2HP0B 4X1YB 3JAKB 4O2BA 1KC8H 2G9IA 4I55A 4I4TA 2OTLF 1S72F 1TUBA 2ZOVA 3FFMA 3KE1A 4LNUB 3LMEA 4X3MA 5GONB 2K1SA 1VQPF 2BO1A 2Z1FA 3C9TA 4XCQA 3OW2F 1ODEA 5HWEA 3JARB 4IHJB 2Z1TA 3F6MA 4C81A 1M1KH 2OZBA 4NQ3A 2UYJA 3JASA 4ZI7A 5EYPA 2HS3A 3VIUA 5BMVB 3RYCA 2ALEA 3N2GB 2RHHA 1VQLF 2AIFA 2B33A 2IG8A 4O2AB 2FGYA 4G4XA 3S0HA 5IJ9A 5HXZA 3V3TA 2NMUA 3CMEF 1VQKF 3CG6A 1OAPA 1W5FA 1M90H 1CLIA 2WALA 2GVIA 3DDNA 1XRGA 4X1KB 5EZYB 5JH7B 3VMFB 4RHAA 2LBXA 3RYHA 4BVRA 3JAMM 5JVDB 3F0DA 3RA5A 4DRXB 3MCQA 3KJJA 2PHNA 4E6EA 1KD1H 2MQEA 3KIZA 3M1XA 4B45A 3HJWC 3JATB 4O4LA 3JAWA 4X20A 5FNVA 5LXTA 2PMPA 4G4YA 1W42A 5LOVB 5EIBD 3AGKA 5CA0A 1QVFF 4G4ZA 3ELCA 3HKCA 3WPWA 1Q81H 3M84A 3RYFA 4YJ3B 2BTQB 3QHDA 4I50A 4B62A 4BT2A 3B6NA 3RYIA 3CD6F 3J81M 2H6LA 1VQVA 1UFYA 1H7MA 2KTUA 5EB1B 2AIZP 4DXDA 3F0EA 1YI2F 1NMUB 2CZWA 4TUYB 1SA0A 5LP6B 3M4SA 1YJWF 1KNJA 3IEWA 1N8RH 3E20B 3ZO8A 5JQGB 2YXZA 3MCAB 1J7HA 2LBWA 5FJ4C 1TVKA 3P0ZA 3IKFA 5KX5A 3E22B 4ZHQB 5CB4A 4O4JA 1JFFA 1H47A 3HKDA 2OHWA 3VYSC 4TV8B 3EORA 3CYPB 3CPQA 3S02A 4WBNB 1U3LA 2F9ZC 4EB6A 1K73H 1RLGA 3D00A 3LWRC 5GAPK 1DT9A 5CA1A 5LA6A 2ZODA 2Q1YA 5HY4A 3FD6A 4BVTA 2N48A 1JJ2F 5J2TA 1W5EA 3NVKE 2LCAA 3ZP4A 2DT4A 1IV4A 1IPAA 2VAPA 4HNAB 3KHNA 3WGKA 3D01A 2HQSC 2DYYA 3RE3A 3E1YA 1YJ9F 4U3JA 3DC2A 5KMGB 3HKBA 5J2UA 4BT5A 5IYZA 1KQSF 4NUTA 1NJIH 2Z1EA 4LNUA 2P6YA 1JY8A 2JNBA 3IEQA 3CCSF 3FD5A 1VQ5F 1PF5A 2CW4A 1VQ9F 3JARA 4IHJA 3N4YA 3BYQA 4ZHVA 5B8FA 3PLAC 3N2KA 4IIJB 4O4HB 4FFBA 2CHTA 1VQMF 3WJRA 3JALB 3FBAA 2I6DA 5MN4A 5LYJB 1COMA 1X7PA 4X3LA 1PXWA 5MN6A 3MBMA 5HXUA 5A2QM 1W5BA 1X25A 4TV9A 4O2BB
chains in the Genus database with same CATH topology
1QVGF 3NK7A 1T0KB 5EWRA 3HJWC 2QEXF 2VGNA 1Q7YH 3LFOA 3N4ZA 2HVYD 1W42A 1YIJF 3CC7F 1ZWZA 3PAFA 3AGKA 5HY2A 1QVFF 1Q81H 1Q82H 3CXCF 1XBIA 3GYQA 4BVSA 3G6EF 5EO3A 3V7EA 3CMAF 3CCVF 1VQ8F 5G4VC 5GINC 3CD6F 2FC3A 3LWPC 3J81M 3CCMF 4LCKA 2KTUA 1H7MA 3CCJF 2OTJF 3SIVA 2KTVA 3CC2F 3ON1A 1YI2F 1E7KA 1NMUB 2CZWA 1YJWF 1Q86H 5HY1A 3I55F 1N8RH 3E20B 3RA6A 3V7QA 3MCAB 2LBWA 4BW0B 5FJ4C 1RA4A 1W3EX 3LWVC 5FLXM 1W41A 3NVIB 5GANK 1GZ0A 1SDSA 2OHWA 3CCUF 3CCQF 3SIUA 4C4WC 1VQ4F 3O85A 3CPQA 3I56F 3G4SF 2QA4F 3NMUC 1KC8H 2F9ZC 1K73H 1RLGA 3CC4F 2KG4A 1VQNF 3LWQC 3D00A 3LWRC 5GAPK 1DT9A 2OTLF 5DCVA 1S72F 5HY4A 3FFMA 4X3MA 4BVTA 1VQPF 1JJ2F 3NVKE 3NK6A 2BO1A 4XCQA 3HAXD 1IPAA 3OW2F 5HWEA 1W2BF 3WXMB 3CPWF 1M1KH 2OZBA 4NQ3A 3J7AR 1GO1A 1YJNF 5IT9M 4EI8A 3E1YA 1YJ9F 2QI2A 3CCLF 3CCEF 2ALEA 1X52A 2VGMA 3OBWA 3G71F 1VQLF 2AIFA 1VQ7F 4EI9A 1KQSF 2FGYA 4NUTA 1NJIH 2GLZA 1W40A 1VQ6F 2JNBA 5HY0A 5HXZA 3V3TA 3LWOC 3CMEF 3CCSF 3OBYA 4BVQA 3JCMM 1VQKF 1VQ5F 1K9MH 3CG6A 1VQ9F 3VI6A 1CN7A 4BY9D 1M90H 3N4YA 3J80M 1YHQF 2WALA 1GO0A 3PLAC 1CK2A 4TZZA 4EI7A 3CCRF 1VQMF 3VMFB 2LBXA 1X7OA 4BVRA 3JAMM 5GIOC 2I6DA 5G4UC 3RA5A 5GIPC 1X7PA 3IR9A 4X3LA 1PXWA 1VQOF 1K8AH 5HXUA 5A2QM 1YITF 1KD1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG F;  3NK7 A;  1T0K B;  5EWR A;  3HJW C;  2QEX F;  2VGN A;  1Q7Y H;  3LFO A;  3N4Z A;  2HVY D;  1W42 A;  1YIJ F;  3CC7 F;  1ZWZ A;  3PAF A;  3AGK A;  1QVF F;  1Q81 H;  1Q82 H;  3CXC F;  1XBI A;  3GYQ A;  3G6E F;  5EO3 A;  3V7E A;  3CMA F;  3CCV F;  1VQ8 F;  5G4V C;  5GIN C;  3CD6 F;  2FC3 A;  3LWP C;  3J81 M;  3CCM F;  4LCK A;  2KTU A;  1H7M A;  3CCJ F;  2OTJ F;  3SIV A;  2KTV A;  3CC2 F;  3ON1 A;  1YI2 F;  1E7K A;  1NMU B;  2CZW A;  1YJW F;  1Q86 H;  3I55 F;  1N8R H;  3E20 B;  3RA6 A;  3V7Q A;  3MCA B;  2LBW A;  4BW0 B;  5FJ4 C;  1RA4 A;  1W3E X;  3LWV C;  5FLX M;  1W41 A;  3NVI B;  5GAN K;  1GZ0 A;  1SDS A;  2OHW A;  3CCU F;  3CCQ F;  3SIU A;  4C4W C;  1VQ4 F;  3O85 A;  3CPQ A;  3I56 F;  3G4S F;  2QA4 F;  3NMU C;  1KC8 H;  1K73 H;  1RLG A;  3CC4 F;  2KG4 A;  1VQN F;  3LWQ C;  3LWR C;  5GAP K;  1DT9 A;  2OTL F;  5DCV A;  1S72 F;  3FFM A;  4X3M A;  1VQP F;  1JJ2 F;  3NVK E;  3NK6 A;  2BO1 A;  3HAX D;  1IPA A;  3OW2 F;  1W2B F;  3WXM B;  3CPW F;  1M1K H;  2OZB A;  3J7A R;  5IT9 M;  1GO1 A;  1YJN F;  3E1Y A;  1YJ9 F;  2QI2 A;  3CCL F;  3CCE F;  2ALE A;  1X52 A;  2VGM A;  3OBW A;  3G71 F;  1VQL F;  2AIF A;  1VQ7 F;  1KQS F;  4NUT A;  1NJI H;  1W40 A;  1VQ6 F;  2JNB A;  3LWO C;  3CME F;  3CCS F;  3OBY A;  3JCM M;  1VQK F;  1VQ5 F;  1K9M H;  3CG6 A;  1VQ9 F;  3VI6 A;  1CN7 A;  4BY9 D;  1M90 H;  3N4Y A;  3J80 M;  1YHQ F;  2WAL A;  1GO0 A;  3PLA C;  1CK2 A;  4TZZ A;  3CCR F;  1VQM F;  3VMF B;  2LBX A;  1X7O A;  3JAM M;  5GIO C;  2I6D A;  5G4U C;  3RA5 A;  5GIP C;  1X7P A;  3IR9 A;  4X3L A;  1PXW A;  1VQO F;  1K8A H;  5A2Q M;  1YIT F;  1KD1 H; 
#chains in the Genus database with same CATH topology
 2L26 A;  2ZF8 A;  3CYQ A;  3OON A;  3P4E A;  4I55 B;  4I4T B;  3P10 A;  3R0P A;  3LFO A;  3N4Z A;  3I7T A;  2HVY D;  5C8Y A;  5ITZ A;  3UT5 A;  1YIJ F;  3CC7 F;  3ESJ A;  1UI9 A;  5JH7 A;  2UYN B;  1W5A A;  4ZHW A;  4U39 A;  5JVD A;  1W55 A;  3QTY A;  3CCV F;  1RQ7 A;  2UYP A;  3TD5 A;  4G4V A;  5GIN C;  3JAS B;  4ZI7 B;  5EYP B;  4C8E A;  5IJ0 A;  3CCM F;  3S0W A;  2OTJ F;  3RYC B;  3SIV A;  1SZQ A;  4ZOL A;  3ON1 A;  1U3P A;  4F6R B;  2BTO A;  1Q86 H;  2H8C A;  3VYU C;  5HY1 A;  2IQQ A;  5IJ9 B;  3V7Q A;  1QU9 A;  1Z5W A;  1FFX A;  4BW0 B;  1H48 A;  4BT7 A;  1JN1 A;  5EAZ A;  1W41 A;  1GZ0 A;  2RHL A;  3CCU F;  1IV3 A;  1Q8R A;  3VCZ A;  1U43 A;  3RYH B;  3SIU A;  4C4W C;  2UYK A;  4O4I B;  4BT3 A;  3CC4 F;  4PWT A;  5DCV A;  3WGL A;  2VXY A;  4O4L B;  3JAW B;  2HRY A;  4X20 B;  5FNV B;  5LXT B;  1IV2 A;  3HAX D;  2VAW A;  2EWC A;  3C8L A;  5CA0 B;  3HKC B;  3J7A R;  1KNK A;  5EB0 A;  3RYF B;  1YGY A;  4EI8 A;  2CWJ A;  1OFU A;  1QAH A;  2UZH A;  2CVL A;  4ZK7 A;  2H8E A;  3RYI B;  3JVH A;  2GLZ A;  1W40 A;  2ZVZ A;  1VQ6 F;  5HY0 A;  4YJ2 A;  5MN5 A;  3MDO A;  3JCM M;  1CN7 A;  3IMP A;  3VI6 A;  5HP7 A;  1FNJ A;  2HS0 A;  3WJP A;  4NWO B;  1IV1 A;  4TZZ A;  3CCR F;  1TVK B;  4EI7 A;  4X1I B;  2VAM A;  5CB4 B;  3MQW A;  3ZP7 A;  3HKD B;  2HP0 A;  4X1Y A;  3JAK A;  3LYB A;  1FNK A;  4G88 A;  3VOB A;  1YIT F;  5EIB C;  3C9R A;  4EB6 B;  2OTM A;  1QVG F;  3NK7 A;  1T0K B;  2RB9 A;  2QEX F;  5CA1 B;  5GON A;  5LA6 B;  1U40 A;  1ZWZ A;  3PAF A;  4IIJ A;  1XV2 A;  1T0A A;  2QTP A;  3K2X A;  3GYQ A;  4BVS A;  3CMA F;  1VH8 A;  5BMV A;  2IAF A;  3D54 A;  3HKE B;  3FPI A;  3N2G A;  4U3J B;  2Z1U A;  4C8I A;  3Q8H A;  3HKB B;  4O2A A;  4LCK A;  3CCJ F;  5J2U B;  3F0F A;  3K14 A;  3ZOP A;  5IYZ B;  3K12 A;  2BTU A;  1ONI A;  3S03 A;  1TUB B;  3GHZ A;  3VYT C;  2UYN A;  4KWE A;  2V9Y A;  4X1K A;  5EZY A;  5JCO A;  4C82 A;  1RA4 A;  3LWV C;  5FLX M;  3NVI B;  3HTN A;  3N2K B;  5GAN K;  2KGW A;  3T80 A;  3VOA A;  4FFB B;  4DRX A;  1SDS A;  1VQ4 F;  3TD3 A;  3VO8 A;  3G4S F;  2QA4 F;  3NMU C;  2W8B C;  5JCO C;  1R1M A;  1VQN F;  2KG4 A;  4F6R A;  3LWQ C;  3JAT A;  3WJQ A;  4TV9 B;  3C9S A;  3CB2 A;  1XHO A;  3WGM A;  3S06 A;  5LOV A;  1JD1 A;  3NK6 A;  2ZVY A;  5C8Y B;  5ITZ B;  3UT5 B;  3ERN A;  3L7Q A;  4YJ3 A;  2CHS A;  1W2B F;  3WXM B;  2AMT A;  3CPW F;  5IT9 M;  1GO1 A;  1YJN F;  4O4I A;  2QI2 A;  3CCL F;  1Z5V A;  3U0O A;  3CCE F;  3G71 F;  1X52 A;  2VGM A;  3OBW A;  4RQO A;  1VQ7 F;  5IJ0 B;  4EI9 A;  2ZAU A;  3K0T A;  5LP6 A;  4TUY A;  3QUW A;  3GTZ A;  3WPX A;  2YYE A;  4ZOL B;  2HP3 A;  3LWO C;  4B5C A;  3OBY A;  4BVQ A;  5JQG A;  1K9M H;  4BY9 D;  2RHJ A;  3J80 M;  1YHQ F;  3E22 A;  1GO0 A;  5LP6 C;  4ZHQ A;  1FFX B;  2HS4 A;  1CK2 A;  3S0Y A;  1X7O A;  4TV8 A;  4BT4 A;  5GIO C;  5G4U C;  5GIP C;  3IR9 A;  4WBN A;  1VQO F;  3V4D A;  1K8A H;  4I50 B;  1W57 A;  1W59 A;  1VHA A;  4ZHY B;  2R75 1;  2R6R 1;  4G4W A;  5HP8 A;  3KJK A;  5EWR A;  2VGN A;  4M8I A;  1Q7Y H;  2RHO A;  1SA0 B;  5AVM A;  2LBT A;  3IKE A;  3C9U A;  4HNA A;  5HY2 A;  4X1I A;  3VTI C;  1Q82 H;  3CXC F;  1RLU A;  1XBI A;  3WGN A;  2HX0 A;  3F0G A;  4ERH A;  3G6E F;  5EO3 A;  3V7E A;  5KMG A;  5KX5 B;  3TD4 A;  1VQ8 F;  5G4V C;  4O4J B;  4BT6 A;  1JFF B;  2FC3 A;  3LDT A;  3LWP C;  1QD9 A;  2I6R A;  1GX1 A;  1YQN A;  1DBF A;  2KTV A;  3CC2 F;  2HRU A;  1E7K A;  4R40 B;  3I55 F;  4YJ2 B;  3RA6 A;  4B46 A;  1NQ3 A;  4O4H A;  4C8G A;  5J2T B;  2CSL A;  1W58 1;  1VK3 A;  1W3E X;  2Z01 A;  3HKE A;  3JAL A;  3HWU A;  5LYJ A;  3I3F A;  1RQ2 A;  2Q1X A;  3WGJ A;  3CCQ F;  3O85 A;  2GZL A;  3I56 F;  1FSZ A;  2HP0 B;  4X1Y B;  3JAK B;  4O2B A;  1KC8 H;  2G9I A;  4I55 A;  4I4T A;  2OTL F;  1S72 F;  1TUB A;  2ZOV A;  3FFM A;  3KE1 A;  4LNU B;  3LME A;  4X3M A;  5GON B;  2K1S A;  1VQP F;  2BO1 A;  2Z1F A;  3C9T A;  4XCQ A;  3OW2 F;  1ODE A;  5HWE A;  3JAR B;  4IHJ B;  2Z1T A;  3F6M A;  4C81 A;  1M1K H;  2OZB A;  4NQ3 A;  2UYJ A;  3JAS A;  4ZI7 A;  5EYP A;  2HS3 A;  3VIU A;  5BMV B;  3RYC A;  2ALE A;  3N2G B;  2RHH A;  1VQL F;  2AIF A;  2B33 A;  2IG8 A;  4O2A B;  2FGY A;  4G4X A;  3S0H A;  5IJ9 A;  5HXZ A;  3V3T A;  2NMU A;  3CME F;  1VQK F;  3CG6 A;  1OAP A;  1W5F A;  1M90 H;  1CLI A;  2WAL A;  2GVI A;  3DDN A;  1XRG A;  4X1K B;  5EZY B;  5JH7 B;  3VMF B;  4RHA A;  2LBX A;  3RYH A;  4BVR A;  3JAM M;  5JVD B;  3F0D A;  3RA5 A;  4DRX B;  3MCQ A;  3KJJ A;  2PHN A;  4E6E A;  1KD1 H;  2MQE A;  3KIZ A;  3M1X A;  4B45 A;  3HJW C;  3JAT B;  4O4L A;  3JAW A;  4X20 A;  5FNV A;  5LXT A;  2PMP A;  4G4Y A;  1W42 A;  5LOV B;  5EIB D;  3AGK A;  5CA0 A;  1QVF F;  4G4Z A;  3ELC A;  3HKC A;  3WPW A;  1Q81 H;  3M84 A;  3RYF A;  4YJ3 B;  2BTQ B;  3QHD A;  4I50 A;  4B62 A;  4BT2 A;  3B6N A;  3RYI A;  3CD6 F;  3J81 M;  2H6L A;  1VQV A;  1UFY A;  1H7M A;  2KTU A;  5EB1 B;  2AIZ P;  4DXD A;  3F0E A;  1YI2 F;  1NMU B;  2CZW A;  4TUY B;  1SA0 A;  5LP6 B;  3M4S A;  1YJW F;  1KNJ A;  3IEW A;  1N8R H;  3E20 B;  3ZO8 A;  5JQG B;  2YXZ A;  3MCA B;  1J7H A;  2LBW A;  5FJ4 C;  1TVK A;  3P0Z A;  3IKF A;  5KX5 A;  3E22 B;  4ZHQ B;  5CB4 A;  4O4J A;  1JFF A;  1H47 A;  3HKD A;  2OHW A;  3VYS C;  4TV8 B;  3EOR A;  3CYP B;  3CPQ A;  3S02 A;  4WBN B;  1U3L A;  2F9Z C;  4EB6 A;  1K73 H;  1RLG A;  3D00 A;  3LWR C;  5GAP K;  1DT9 A;  5CA1 A;  5LA6 A;  2ZOD A;  2Q1Y A;  5HY4 A;  3FD6 A;  4BVT A;  2N48 A;  1JJ2 F;  5J2T A;  1W5E A;  3NVK E;  2LCA A;  3ZP4 A;  2DT4 A;  1IV4 A;  1IPA A;  2VAP A;  4HNA B;  3KHN A;  3WGK A;  3D01 A;  2HQS C;  2DYY A;  3RE3 A;  3E1Y A;  1YJ9 F;  4U3J A;  3DC2 A;  5KMG B;  3HKB A;  5J2U A;  4BT5 A;  5IYZ A;  1KQS F;  4NUT A;  1NJI H;  2Z1E A;  4LNU A;  2P6Y A;  1JY8 A;  2JNB A;  3IEQ A;  3CCS F;  3FD5 A;  1VQ5 F;  1PF5 A;  2CW4 A;  1VQ9 F;  3JAR A;  4IHJ A;  3N4Y A;  3BYQ A;  4ZHV A;  5B8F A;  3PLA C;  3N2K A;  4IIJ B;  4O4H B;  4FFB A;  2CHT A;  1VQM F;  3WJR A;  3JAL B;  3FBA A;  2I6D A;  5MN4 A;  5LYJ B;  1COM A;  1X7P A;  4X3L A;  1PXW A;  5MN6 A;  3MBM A;  5HXU A;  5A2Q M;  1W5B A;  1X25 A;  4TV9 A;  4O2B B; 
#chains in the Genus database with same CATH homology
 1QVG F;  3NK7 A;  1T0K B;  5EWR A;  3HJW C;  2QEX F;  2VGN A;  1Q7Y H;  3LFO A;  3N4Z A;  2HVY D;  1W42 A;  1YIJ F;  3CC7 F;  1ZWZ A;  3PAF A;  3AGK A;  5HY2 A;  1QVF F;  1Q81 H;  1Q82 H;  3CXC F;  1XBI A;  3GYQ A;  4BVS A;  3G6E F;  5EO3 A;  3V7E A;  3CMA F;  3CCV F;  1VQ8 F;  5G4V C;  5GIN C;  3CD6 F;  2FC3 A;  3LWP C;  3J81 M;  3CCM F;  4LCK A;  2KTU A;  1H7M A;  3CCJ F;  2OTJ F;  3SIV A;  2KTV A;  3CC2 F;  3ON1 A;  1YI2 F;  1E7K A;  1NMU B;  2CZW A;  1YJW F;  1Q86 H;  5HY1 A;  3I55 F;  1N8R H;  3E20 B;  3RA6 A;  3V7Q A;  3MCA B;  2LBW A;  4BW0 B;  5FJ4 C;  1RA4 A;  1W3E X;  3LWV C;  5FLX M;  1W41 A;  3NVI B;  5GAN K;  1GZ0 A;  1SDS A;  2OHW A;  3CCU F;  3CCQ F;  3SIU A;  4C4W C;  1VQ4 F;  3O85 A;  3CPQ A;  3I56 F;  3G4S F;  2QA4 F;  3NMU C;  1KC8 H;  2F9Z C;  1K73 H;  1RLG A;  3CC4 F;  2KG4 A;  1VQN F;  3LWQ C;  3D00 A;  3LWR C;  5GAP K;  1DT9 A;  2OTL F;  5DCV A;  1S72 F;  5HY4 A;  3FFM A;  4X3M A;  4BVT A;  1VQP F;  1JJ2 F;  3NVK E;  3NK6 A;  2BO1 A;  4XCQ A;  3HAX D;  1IPA A;  3OW2 F;  5HWE A;  1W2B F;  3WXM B;  3CPW F;  1M1K H;  2OZB A;  4NQ3 A;  3J7A R;  1GO1 A;  1YJN F;  5IT9 M;  4EI8 A;  3E1Y A;  1YJ9 F;  2QI2 A;  3CCL F;  3CCE F;  2ALE A;  1X52 A;  2VGM A;  3OBW A;  3G71 F;  1VQL F;  2AIF A;  1VQ7 F;  4EI9 A;  1KQS F;  2FGY A;  4NUT A;  1NJI H;  2GLZ A;  1W40 A;  1VQ6 F;  2JNB A;  5HY0 A;  5HXZ A;  3V3T A;  3LWO C;  3CME F;  3CCS F;  3OBY A;  4BVQ A;  3JCM M;  1VQK F;  1VQ5 F;  1K9M H;  3CG6 A;  1VQ9 F;  3VI6 A;  1CN7 A;  4BY9 D;  1M90 H;  3N4Y A;  3J80 M;  1YHQ F;  2WAL A;  1GO0 A;  3PLA C;  1CK2 A;  4TZZ A;  4EI7 A;  3CCR F;  1VQM F;  3VMF B;  2LBX A;  1X7O A;  4BVR A;  3JAM M;  5GIO C;  2I6D A;  5G4U C;  3RA5 A;  5GIP C;  1X7P A;  3IR9 A;  4X3L A;  1PXW A;  1VQO F;  1K8A H;  5HXU A;  5A2Q M;  1YIT F;  1KD1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...