1SDSA

Structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
115
structure length
115
Chain Sequence
AVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein/rna complex
molecule keywords box H/ACA sRNA
publication title Structure of Protein L7Ae Bound to a K-Turn Derived from an Archaeal Box H/ACA sRNA at 1.8 A Resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 38
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1sdsA00
4LCKA 3O85A 1YITF 2KG4A 1VQ8F 1E7KA 5FLXM 1VQ4F 1VQ5F 1GZ0A 3LWQC 1DT9A 3JAMM 3G6EF 4X3LA 3CCVF 2VGMA 3PLAC 3V7QA 3SIVA 3CG6A 3CC2F 1YJNF 1VQNF 1RA4A 3J81M 3NVKE 2LBWA 5IT9M 1JJ2F 2VGNA 1ZWZA 1VQPF 3PAFA 1W41A 2KTUA 2OHWA 4NUTA 1QVGF 1W42A 1NJIH 1KC8H 5GIPC 4TZZA 3LWOC 1CK2A 3OBYA 3N4YA 3N4ZA 3I55F 3CCRF 1YI2F 1IPAA 1K9MH 1VQ9F 3CCJF 3CCEF 2JNBA 3CCQF 1GO0A 1W40A 5GINC 5GANK 2CZWA 2QA4F 3E1YA 2OTLF 3CCLF 1NMUB 1Q81H 1W3EX 3NK7A 1X7OA 1Q7YH 3NK6A 3E20B 3JCMM 4BY9D 2FC3A 4BW0B 3MCAB 3OW2F 3HJWC 5GAPK 5DCVA 1M90H 2QI2A 1KQSF 1SDSA 3CC4F 2BO1A 5GIOC 3CCSF 1VQMF 1Q82H 2HVYD 3RA5A 3CMEF 3CCMF 3CC7F 5G4UC 3GYQA 3NMUC 3VMFB 1X52A 1YJ9F 1GO1A 3CPWF 2LBXA 2OZBA 3CD6F 3FFMA 3OBWA 3SIUA 1S72F 3AGKA 1Q86H 3G71F 1H7MA 4X3MA 3CPQA 3LFOA 3ON1A 3J80M 1RLGA 2AIFA 5G4VC 3CXCF 1VQ7F 3CMAF 1W2BF 3J7AR 1KD1H 1VQLF 1YHQF 3VI6A 5EWRA 1VQOF 1YJWF 1CN7A 3LWVC 1VQ6F 5EO3A 2KTVA 1N8RH 4C4WC 3IR9A 2QEXF 1T0KB 2ALEA 3RA6A 3V7EA 2I6DA 3NVIB 3WXMB 3LWRC 1K73H 2OTJF 1X7PA 1XBIA 3HAXD 1PXWA 3LWPC 5A2QM 1VQKF 5FJ4C 1M1KH 1K8AH 3G4SF 3I56F 1QVFF 1YIJF 3CCUF 2WALA
chains in the Genus database with same CATH superfamily
2UZHA 3ZOPA 3P0ZA 5JH7A 5LP6B 1YITF 1J7HA 1R1MA 1VQ5F 1GZ0A 4I50A 3WPWA 3LWQC 1DT9A 5CA0A 3JARB 1QU9A 4EB6A 4X3LA 3D54A 5CB4A 5JCOC 1W5FA 3UT5B 3CC2F 1VQNF 3J81M 3RYIA 1IV2A 3M4SA 1JJ2F 2VGNA 1ZWZA 3VYUC 3PAFA 1NJIH 1KC8H 3LWOC 3I7TA 5EIBD 1CK2A 3F6MA 4RQOA 1JFFB 5BMVB 5IJ9B 3OBYA 4O2BB 3N4YA 3N4ZA 4X1YB 4C8EA 2Q1YA 1W5EA 3IKFA 1VQ9F 1X25A 3N2KB 3HKDB 3JASB 2QA4F 4I4TA 5LXTA 1Q81H 4I55A 5IYZB 5J2UA 1X7OA 2V9YA 2HP0B 4NQ3A 2Z01A 4ZHWA 4BVRA 5HXUA 5HWEA 4NWOB 3RYHB 1W55A 2GZLA 3WPXA 2H8EA 2CHTA 3HKCA 5HY0A 2RHHA 2BTUA 1OAPA 4G4YA 5GIOC 4BT4A 3CCSF 2YYEA 4IHJA 1Q82H 3QUWA 4TV8B 1W59A 1IV4A 3CCMF 4I50B 3C9RA 5EAZA 5G4UC 5CA0B 3GYQA 3NMUC 3VMFB 5LYJA 5CB4B 3CPWF 2LBXA 3N2GA 5MN6A 3M84A 5EZYB 3OBWA 3JALB 3AGKA 3RYFB 3V3TA 3VO8A 4X3MA 3D01A 3ON1A 4C81A 3J80M 3U0OA 3CXCF 3C9TA 3CMAF 3VYTC 1Q8RA 3FBAA 2Q1XA 1YHQF 3IEQA 1YJWF 4EI8A 3M1XA 2Z1UA 3LWVC 5MN5A 1VQ6F 5EO3A 1T0KB 4I4TB 3UT5A 1QAHA 1K73H 2DYYA 4ZHQA 3ZP7A 3FD6A 3HAXD 1VK3A 4B5CA 3TD5A 2DT4A 1M1KH 5FJ4C 3G4SF 4X1KA 5BMVA 1JFFA 1QVFF 1YIJF 3CCUF 3RE3A 3P10A 3HKEA 4X1YA 2KG4A 1OFUA 1VQ8F 4G4WA 3N2KA 1IV3A 4F6RA 2ZVZA 3LYBA 3HKDA 5JVDB 4ZK7A 3JAMM 4YJ3A 4IIJB 2H8CA 4R40B 3JATB 2MQEA 3JAWB 1KNKA 1YJNF 1KNJA 2HP0A 4C8GA 1RQ7A 1W41A 2KTUA 4O4HA 4ZI7B 5GIPC 2CWJA 3VOAA 4PWTA 3CCRF 2BTQB 1YI2F 2Z1FA 3EORA 3KHNA 3F0DA 3WGJA 4TV8A 3CCEF 2JNBA 4WBNA 3CCQF 1GO0A 4BVQA 5GANK 2VAPA 2CZWA 5HP7A 4KWEA 2OTLF 4X1IB 3V4DA 4O4JA 1Z5WA 1Q7YH 5EZYA 3JALA 2LBTA 3RYFA 4ZHQB 3LDTA 1UFYA 1RLUA 1FNJA 2RHOA 1TVKA 4X1KB 5LA6A 2QTPA 4X20A 3HKEB 2HQSC 4C8IA 2I6RA 3RA5A 3CMEF 2ZAUA 4F6RB 2K1SA 1XRGA 4YJ3B 2RHJA 2VAWA 2FGYA 3SIUA 2W8BC 1IV1A 3HWUA 3QTYA 3KIZA 3QHDA 1XV2A 5J2TB 1Z5VA 4O4HB 4FFBB 1JD1A 5HY4A 5CA1A 1W2BF 3T80A 3J7AR 1KD1H 1VQLF 1ONIA 4O4LB 2UYKA 1W581 5JCOA 3VTIC 1TUBB 4EI7A 5JVDA 4WBNB 4IIJA 1W5BA 3K2XA 2ALEA 3JATA 3RA6A 3IMPA 5ITZB 1RQ2A 3V7EA 2OTMA 2I6DA 3JAWA 3WXMB 4B45A 4BT7A 4DRXA 4O4JB 2HRYA 5JQGA 3BYQA 4G88A 1VQKF 4ZI7A 1VH8A 3P4EA 4TV9B 2YXZA 5AVMA 2AIZP 4ZHYB 4G4ZA 2WALA 1TVKB 5LA6B 2HS4A 4X20B 5FLXM 4ZOLB 1VQ4F 2UYPA 2EWCA 3WGLA 3VYSC 2RHLA 3IEWA 3G6EF 3CYPB 1T0AA 4X1IA 3PLAC 3DC2A 2G9IA 3S0WA 3SIVA 1U40A 1W5AA 3VOBA 2LBWA 3JAKB 2CSLA 1FSZA 2ZVYA 2IG8A 1GX1A 2VXYA 4NUTA 2OHWA 1QVGF 1JY8A 1CLIA 4BVTA 3I55F 2R6R1 3B6NA 3F0GA 3TD3A 5HP8A 2P6YA 5CA1B 1U3LA 5HXZA 3D00A 2ZF8A 4B46A 5MN4A 2HRUA 1W40A 3CCLF 2UYNB 4U39A 3DDNA 1W3EX 3NK7A 3S0YA 4DRXB 4BT5A 5JQGB 2PHNA 3E20B 2FC3A 4BW0B 3L7QA 1W57A 4BT6A 5J2TA 5GAPK 4FFBA 3MCQA 5DCVA 2GLZA 1M90H 2QI2A 1KQSF 1SDSA 4O4LA 2BO1A 5HY1A 5EB1B 3I3FA 5EIBC 1TUBA 4B62A 3CC7F 1SZQA 2IQQA 4BT3A 5ITZA 1JN1A 1XHOA 3Q8HA 3WGMA 4YJ2A 3LMEA 2OZBA 5HY2A 3CD6F 3WJQA 1SA0A 3E22B 3KJJA 1FFXA 4TV9A 2HX0A 2Z1TA 3LFOA 1RLGA 2RB9A 1H48A 1VQ7F 4ZOLA 3C9SA 3ELCA 3S03A 3VI6A 5EWRA 3HKBB 5EYPA 5KMGA 4C4WC 2KTVA 2QEXF 4BT2A 4C82A 3IKEA 2B33A 3FD5A 1VQVA 4O4IB 3K14A 1QD9A 4ERHA 1X7PA 3JAKA 2R751 5GONB 2ZODA 3LWPC 3FPIA 3I56F 4U3JA 5LOVA 1PF5A 2LCAA 4HNAA 3O85A 4LCKA 1COMA 1E7KA 3VCZA 1UI9A 3S0HA 5LP6C 5KX5A 1U3PA 2N48A 4DXDA 3GHZA 4M8IA 3ZP4A 3KE1A 3CCVF 2VGMA 2UYNA 3V7QA 5C8YA 1FNKA 3CG6A 3F0FA 4YJ2B 3R0PA 1RA4A 3NVKE 1H47A 1VHAA 2UYJA 3GTZA 5IT9M 3WJPA 3VIUA 3RYCA 1SA0B 1VQPF 2H6LA 1YGYA 1DBFA 1W42A 4BVSA 4O2AA 1FFXB 4TZZA 4G4XA 5FNVA 2F9ZC 4TUYB 3WGNA 4U3JB 5JH7B 1IPAA 1K9MH 1YQNA 2Z1EA 3CCJF 2HS0A 5IJ0A 5B8FA 5EYPB 5KMGB 5GINC 2L26A 4EB6B 3HTNA 3E1YA 1NMUB 1ODEA 3ESJA 3MQWA 4LNUA 2HP3A 2ZOVA 3E22A 3RYIB 3TD4A 4G4VA 2CHSA 3NK6A 3MBMA 4BY9D 3JCMM 3MCAB 3OW2F 3HJWC 2AMTA 3K0TA 3MDOA 4EI9A 5LP6A 5LOVB 3CC4F 4HNAB 1VQMF 2HS3A 3JARA 3HKBA 2HVYD 3ERNA 3WJRA 4E6EA 5KX5B 4RHAA 3WGKA 3F0EA 1X52A 1YJ9F 4O4IA 1GO1A 2IAFA 4I55B 5J2UB 5LXTB 5C8YB 3FFMA 3KJKA 1S72F 1Q86H 5GONA 3G71F 2KGWA 3RYCB 1H7MA 3CPQA 2NMUA 2GVIA 3ZO8A 5IJ9A 2AIFA 4O2BA 3HKCB 4O2AB 5G4VC 5FNVB 5EB0A 3S02A 1U43A 3CYQA 3OONA 4IHJB 1VQOF 1CN7A 3JASA 5IJ0B 1N8RH 3IR9A 2CVLA 1NQ3A 3C9UA 2BTOA 5IYZA 5LYJB 3NVIB 3LWRC 3K12A 3N2GB 2PMPA 3C8LA 2OTJF 1XBIA 4LNUB 3RYHA 1PXWA 4XCQA 5A2QM 2VAMA 1K8AH 3S06A 3JVHA 2CW4A 4TUYA 4ZHVA 3CB2A
chains in the Genus database with same CATH topology
4LCKA 3O85A 1YITF 2KG4A 1VQ8F 1E7KA 5FLXM 1VQ4F 1VQ5F 1GZ0A 3LWQC 1DT9A 3JAMM 3G6EF 4X3LA 3CCVF 2VGMA 3PLAC 3V7QA 3SIVA 3CG6A 3CC2F 1YJNF 1VQNF 1RA4A 3J81M 3NVKE 2LBWA 5IT9M 1JJ2F 2VGNA 1ZWZA 1VQPF 3PAFA 1W41A 2KTUA 2OHWA 4NUTA 1QVGF 1W42A 4BVSA 1NJIH 1KC8H 5GIPC 4TZZA 3LWOC 1CK2A 2F9ZC 3OBYA 4BVTA 3N4YA 3N4ZA 3I55F 3CCRF 5HXZA 1YI2F 1IPAA 3D00A 1K9MH 1VQ9F 3CCJF 3CCEF 2JNBA 3CCQF 1GO0A 4BVQA 1W40A 5GINC 5GANK 2CZWA 2QA4F 3E1YA 2OTLF 3CCLF 1NMUB 1Q81H 1W3EX 3NK7A 1X7OA 1Q7YH 4NQ3A 3NK6A 4BVRA 5HXUA 3E20B 3JCMM 5HWEA 2FC3A 4BY9D 4BW0B 3MCAB 3OW2F 3HJWC 5GAPK 5HY0A 5DCVA 2GLZA 4EI9A 1M90H 2QI2A 1KQSF 1SDSA 3CC4F 2BO1A 5GIOC 5HY1A 3CCSF 1VQMF 1Q82H 2HVYD 3RA5A 3CMEF 3CCMF 3CC7F 5G4UC 3GYQA 3NMUC 3VMFB 1X52A 1YJ9F 1GO1A 3CPWF 2LBXA 2OZBA 2FGYA 5HY2A 3CD6F 3FFMA 3OBWA 3SIUA 1S72F 3AGKA 1Q86H 3G71F 3V3TA 1H7MA 4X3MA 3CPQA 3LFOA 3ON1A 3J80M 1RLGA 2AIFA 5G4VC 3CXCF 1VQ7F 5HY4A 3CMAF 1W2BF 3J7AR 1KD1H 1VQLF 1YHQF 3VI6A 5EWRA 1VQOF 1YJWF 4EI7A 4EI8A 1CN7A 3LWVC 1VQ6F 5EO3A 2KTVA 1N8RH 4C4WC 3IR9A 2QEXF 1T0KB 2ALEA 3RA6A 3V7EA 2I6DA 3NVIB 3WXMB 3LWRC 1K73H 2OTJF 1X7PA 1XBIA 3HAXD 1PXWA 4XCQA 3LWPC 5A2QM 1VQKF 5FJ4C 1M1KH 1K8AH 3G4SF 3I56F 1QVFF 1YIJF 3CCUF 2WALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCK A;  3O85 A;  1YIT F;  2KG4 A;  1VQ8 F;  1E7K A;  5FLX M;  1VQ4 F;  1VQ5 F;  1GZ0 A;  3LWQ C;  1DT9 A;  3JAM M;  3G6E F;  4X3L A;  3CCV F;  2VGM A;  3PLA C;  3V7Q A;  3SIV A;  3CG6 A;  3CC2 F;  1YJN F;  1VQN F;  1RA4 A;  3J81 M;  3NVK E;  2LBW A;  5IT9 M;  1JJ2 F;  2VGN A;  1ZWZ A;  1VQP F;  3PAF A;  1W41 A;  2KTU A;  2OHW A;  4NUT A;  1QVG F;  1W42 A;  1NJI H;  1KC8 H;  5GIP C;  4TZZ A;  3LWO C;  1CK2 A;  3OBY A;  3N4Y A;  3N4Z A;  3I55 F;  3CCR F;  1YI2 F;  1IPA A;  1K9M H;  1VQ9 F;  3CCJ F;  3CCE F;  2JNB A;  3CCQ F;  1GO0 A;  1W40 A;  5GIN C;  5GAN K;  2CZW A;  2QA4 F;  3E1Y A;  2OTL F;  3CCL F;  1NMU B;  1Q81 H;  1W3E X;  3NK7 A;  1X7O A;  1Q7Y H;  3NK6 A;  3E20 B;  3JCM M;  4BY9 D;  2FC3 A;  4BW0 B;  3MCA B;  3OW2 F;  3HJW C;  5GAP K;  5DCV A;  1M90 H;  2QI2 A;  1KQS F;  1SDS A;  3CC4 F;  2BO1 A;  5GIO C;  3CCS F;  1VQM F;  1Q82 H;  2HVY D;  3RA5 A;  3CME F;  3CCM F;  3CC7 F;  5G4U C;  3GYQ A;  3NMU C;  3VMF B;  1X52 A;  1YJ9 F;  1GO1 A;  3CPW F;  2LBX A;  2OZB A;  3CD6 F;  3FFM A;  3OBW A;  3SIU A;  1S72 F;  3AGK A;  1Q86 H;  3G71 F;  1H7M A;  4X3M A;  3CPQ A;  3LFO A;  3ON1 A;  3J80 M;  1RLG A;  2AIF A;  5G4V C;  3CXC F;  1VQ7 F;  3CMA F;  1W2B F;  3J7A R;  1KD1 H;  1VQL F;  1YHQ F;  3VI6 A;  5EWR A;  1VQO F;  1YJW F;  1CN7 A;  3LWV C;  1VQ6 F;  5EO3 A;  2KTV A;  1N8R H;  4C4W C;  3IR9 A;  2QEX F;  1T0K B;  2ALE A;  3RA6 A;  3V7E A;  2I6D A;  3NVI B;  3WXM B;  3LWR C;  1K73 H;  2OTJ F;  1X7P A;  1XBI A;  3HAX D;  1PXW A;  3LWP C;  5A2Q M;  1VQK F;  5FJ4 C;  1M1K H;  1K8A H;  3G4S F;  3I56 F;  1QVF F;  1YIJ F;  3CCU F;  2WAL A; 
#chains in the Genus database with same CATH topology
 2UZH A;  3ZOP A;  3P0Z A;  5JH7 A;  5LP6 B;  1YIT F;  1J7H A;  1R1M A;  1VQ5 F;  1GZ0 A;  4I50 A;  3WPW A;  3LWQ C;  1DT9 A;  5CA0 A;  3JAR B;  1QU9 A;  4EB6 A;  4X3L A;  3D54 A;  5CB4 A;  5JCO C;  1W5F A;  3UT5 B;  3CC2 F;  1VQN F;  3J81 M;  3RYI A;  1IV2 A;  3M4S A;  1JJ2 F;  2VGN A;  1ZWZ A;  3VYU C;  3PAF A;  1NJI H;  1KC8 H;  3LWO C;  3I7T A;  5EIB D;  1CK2 A;  3F6M A;  4RQO A;  1JFF B;  5BMV B;  5IJ9 B;  3OBY A;  4O2B B;  3N4Y A;  3N4Z A;  4X1Y B;  4C8E A;  2Q1Y A;  1W5E A;  3IKF A;  1VQ9 F;  1X25 A;  3N2K B;  3HKD B;  3JAS B;  2QA4 F;  4I4T A;  5LXT A;  1Q81 H;  4I55 A;  5IYZ B;  5J2U A;  1X7O A;  2V9Y A;  2HP0 B;  4NQ3 A;  2Z01 A;  4ZHW A;  4BVR A;  5HXU A;  5HWE A;  4NWO B;  3RYH B;  1W55 A;  2GZL A;  3WPX A;  2H8E A;  2CHT A;  3HKC A;  5HY0 A;  2RHH A;  2BTU A;  1OAP A;  4G4Y A;  5GIO C;  4BT4 A;  3CCS F;  2YYE A;  4IHJ A;  1Q82 H;  3QUW A;  4TV8 B;  1W59 A;  1IV4 A;  3CCM F;  4I50 B;  3C9R A;  5EAZ A;  5G4U C;  5CA0 B;  3GYQ A;  3NMU C;  3VMF B;  5LYJ A;  5CB4 B;  3CPW F;  2LBX A;  3N2G A;  5MN6 A;  3M84 A;  5EZY B;  3OBW A;  3JAL B;  3AGK A;  3RYF B;  3V3T A;  3VO8 A;  4X3M A;  3D01 A;  3ON1 A;  4C81 A;  3J80 M;  3U0O A;  3CXC F;  3C9T A;  3CMA F;  3VYT C;  1Q8R A;  3FBA A;  2Q1X A;  1YHQ F;  3IEQ A;  1YJW F;  4EI8 A;  3M1X A;  2Z1U A;  3LWV C;  5MN5 A;  1VQ6 F;  5EO3 A;  1T0K B;  4I4T B;  3UT5 A;  1QAH A;  1K73 H;  2DYY A;  4ZHQ A;  3ZP7 A;  3FD6 A;  3HAX D;  1VK3 A;  4B5C A;  3TD5 A;  2DT4 A;  1M1K H;  5FJ4 C;  3G4S F;  4X1K A;  5BMV A;  1JFF A;  1QVF F;  1YIJ F;  3CCU F;  3RE3 A;  3P10 A;  3HKE A;  4X1Y A;  2KG4 A;  1OFU A;  1VQ8 F;  4G4W A;  3N2K A;  1IV3 A;  4F6R A;  2ZVZ A;  3LYB A;  3HKD A;  5JVD B;  4ZK7 A;  3JAM M;  4YJ3 A;  4IIJ B;  2H8C A;  4R40 B;  3JAT B;  2MQE A;  3JAW B;  1KNK A;  1YJN F;  1KNJ A;  2HP0 A;  4C8G A;  1RQ7 A;  1W41 A;  2KTU A;  4O4H A;  4ZI7 B;  5GIP C;  2CWJ A;  3VOA A;  4PWT A;  3CCR F;  2BTQ B;  1YI2 F;  2Z1F A;  3EOR A;  3KHN A;  3F0D A;  3WGJ A;  4TV8 A;  3CCE F;  2JNB A;  4WBN A;  3CCQ F;  1GO0 A;  4BVQ A;  5GAN K;  2VAP A;  2CZW A;  5HP7 A;  4KWE A;  2OTL F;  4X1I B;  3V4D A;  4O4J A;  1Z5W A;  1Q7Y H;  5EZY A;  3JAL A;  2LBT A;  3RYF A;  4ZHQ B;  3LDT A;  1UFY A;  1RLU A;  1FNJ A;  2RHO A;  1TVK A;  4X1K B;  5LA6 A;  2QTP A;  4X20 A;  3HKE B;  2HQS C;  4C8I A;  2I6R A;  3RA5 A;  3CME F;  2ZAU A;  4F6R B;  2K1S A;  1XRG A;  4YJ3 B;  2RHJ A;  2VAW A;  2FGY A;  3SIU A;  2W8B C;  1IV1 A;  3HWU A;  3QTY A;  3KIZ A;  3QHD A;  1XV2 A;  5J2T B;  1Z5V A;  4O4H B;  4FFB B;  1JD1 A;  5HY4 A;  5CA1 A;  1W2B F;  3T80 A;  3J7A R;  1KD1 H;  1VQL F;  1ONI A;  4O4L B;  2UYK A;  1W58 1;  5JCO A;  3VTI C;  1TUB B;  4EI7 A;  5JVD A;  4WBN B;  4IIJ A;  1W5B A;  3K2X A;  2ALE A;  3JAT A;  3RA6 A;  3IMP A;  5ITZ B;  1RQ2 A;  3V7E A;  2OTM A;  2I6D A;  3JAW A;  3WXM B;  4B45 A;  4BT7 A;  4DRX A;  4O4J B;  2HRY A;  5JQG A;  3BYQ A;  4G88 A;  1VQK F;  4ZI7 A;  1VH8 A;  3P4E A;  4TV9 B;  2YXZ A;  5AVM A;  2AIZ P;  4ZHY B;  4G4Z A;  2WAL A;  1TVK B;  5LA6 B;  2HS4 A;  4X20 B;  5FLX M;  4ZOL B;  1VQ4 F;  2UYP A;  2EWC A;  3WGL A;  3VYS C;  2RHL A;  3IEW A;  3G6E F;  3CYP B;  1T0A A;  4X1I A;  3PLA C;  3DC2 A;  2G9I A;  3S0W A;  3SIV A;  1U40 A;  1W5A A;  3VOB A;  2LBW A;  3JAK B;  2CSL A;  1FSZ A;  2ZVY A;  2IG8 A;  1GX1 A;  2VXY A;  4NUT A;  2OHW A;  1QVG F;  1JY8 A;  1CLI A;  4BVT A;  3I55 F;  2R6R 1;  3B6N A;  3F0G A;  3TD3 A;  5HP8 A;  2P6Y A;  5CA1 B;  1U3L A;  5HXZ A;  3D00 A;  2ZF8 A;  4B46 A;  5MN4 A;  2HRU A;  1W40 A;  3CCL F;  2UYN B;  4U39 A;  3DDN A;  1W3E X;  3NK7 A;  3S0Y A;  4DRX B;  4BT5 A;  5JQG B;  2PHN A;  3E20 B;  2FC3 A;  4BW0 B;  3L7Q A;  1W57 A;  4BT6 A;  5J2T A;  5GAP K;  4FFB A;  3MCQ A;  5DCV A;  2GLZ A;  1M90 H;  2QI2 A;  1KQS F;  1SDS A;  4O4L A;  2BO1 A;  5HY1 A;  5EB1 B;  3I3F A;  5EIB C;  1TUB A;  4B62 A;  3CC7 F;  1SZQ A;  2IQQ A;  4BT3 A;  5ITZ A;  1JN1 A;  1XHO A;  3Q8H A;  3WGM A;  4YJ2 A;  3LME A;  2OZB A;  5HY2 A;  3CD6 F;  3WJQ A;  1SA0 A;  3E22 B;  3KJJ A;  1FFX A;  4TV9 A;  2HX0 A;  2Z1T A;  3LFO A;  1RLG A;  2RB9 A;  1H48 A;  1VQ7 F;  4ZOL A;  3C9S A;  3ELC A;  3S03 A;  3VI6 A;  5EWR A;  3HKB B;  5EYP A;  5KMG A;  4C4W C;  2KTV A;  2QEX F;  4BT2 A;  4C82 A;  3IKE A;  2B33 A;  3FD5 A;  1VQV A;  4O4I B;  3K14 A;  1QD9 A;  4ERH A;  1X7P A;  3JAK A;  2R75 1;  5GON B;  2ZOD A;  3LWP C;  3FPI A;  3I56 F;  4U3J A;  5LOV A;  1PF5 A;  2LCA A;  4HNA A;  3O85 A;  4LCK A;  1COM A;  1E7K A;  3VCZ A;  1UI9 A;  3S0H A;  5LP6 C;  5KX5 A;  1U3P A;  2N48 A;  4DXD A;  3GHZ A;  4M8I A;  3ZP4 A;  3KE1 A;  3CCV F;  2VGM A;  2UYN A;  3V7Q A;  5C8Y A;  1FNK A;  3CG6 A;  3F0F A;  4YJ2 B;  3R0P A;  1RA4 A;  3NVK E;  1H47 A;  1VHA A;  2UYJ A;  3GTZ A;  5IT9 M;  3WJP A;  3VIU A;  3RYC A;  1SA0 B;  1VQP F;  2H6L A;  1YGY A;  1DBF A;  1W42 A;  4BVS A;  4O2A A;  1FFX B;  4TZZ A;  4G4X A;  5FNV A;  2F9Z C;  4TUY B;  3WGN A;  4U3J B;  5JH7 B;  1IPA A;  1K9M H;  1YQN A;  2Z1E A;  3CCJ F;  2HS0 A;  5IJ0 A;  5B8F A;  5EYP B;  5KMG B;  5GIN C;  2L26 A;  4EB6 B;  3HTN A;  3E1Y A;  1NMU B;  1ODE A;  3ESJ A;  3MQW A;  4LNU A;  2HP3 A;  2ZOV A;  3E22 A;  3RYI B;  3TD4 A;  4G4V A;  2CHS A;  3NK6 A;  3MBM A;  4BY9 D;  3JCM M;  3MCA B;  3OW2 F;  3HJW C;  2AMT A;  3K0T A;  3MDO A;  4EI9 A;  5LP6 A;  5LOV B;  3CC4 F;  4HNA B;  1VQM F;  2HS3 A;  3JAR A;  3HKB A;  2HVY D;  3ERN A;  3WJR A;  4E6E A;  5KX5 B;  4RHA A;  3WGK A;  3F0E A;  1X52 A;  1YJ9 F;  4O4I A;  1GO1 A;  2IAF A;  4I55 B;  5J2U B;  5LXT B;  5C8Y B;  3FFM A;  3KJK A;  1S72 F;  1Q86 H;  5GON A;  3G71 F;  2KGW A;  3RYC B;  1H7M A;  3CPQ A;  2NMU A;  2GVI A;  3ZO8 A;  5IJ9 A;  2AIF A;  4O2B A;  3HKC B;  4O2A B;  5G4V C;  5FNV B;  5EB0 A;  3S02 A;  1U43 A;  3CYQ A;  3OON A;  4IHJ B;  1VQO F;  1CN7 A;  3JAS A;  5IJ0 B;  1N8R H;  3IR9 A;  2CVL A;  1NQ3 A;  3C9U A;  2BTO A;  5IYZ A;  5LYJ B;  3NVI B;  3LWR C;  3K12 A;  3N2G B;  2PMP A;  3C8L A;  2OTJ F;  1XBI A;  4LNU B;  3RYH A;  1PXW A;  4XCQ A;  5A2Q M;  2VAM A;  1K8A H;  3S06 A;  3JVH A;  2CW4 A;  4TUY A;  4ZHV A;  3CB2 A; 
#chains in the Genus database with same CATH homology
 4LCK A;  3O85 A;  1YIT F;  2KG4 A;  1VQ8 F;  1E7K A;  5FLX M;  1VQ4 F;  1VQ5 F;  1GZ0 A;  3LWQ C;  1DT9 A;  3JAM M;  3G6E F;  4X3L A;  3CCV F;  2VGM A;  3PLA C;  3V7Q A;  3SIV A;  3CG6 A;  3CC2 F;  1YJN F;  1VQN F;  1RA4 A;  3J81 M;  3NVK E;  2LBW A;  5IT9 M;  1JJ2 F;  2VGN A;  1ZWZ A;  1VQP F;  3PAF A;  1W41 A;  2KTU A;  2OHW A;  4NUT A;  1QVG F;  1W42 A;  4BVS A;  1NJI H;  1KC8 H;  5GIP C;  4TZZ A;  3LWO C;  1CK2 A;  2F9Z C;  3OBY A;  4BVT A;  3N4Y A;  3N4Z A;  3I55 F;  3CCR F;  5HXZ A;  1YI2 F;  1IPA A;  3D00 A;  1K9M H;  1VQ9 F;  3CCJ F;  3CCE F;  2JNB A;  3CCQ F;  1GO0 A;  4BVQ A;  1W40 A;  5GIN C;  5GAN K;  2CZW A;  2QA4 F;  3E1Y A;  2OTL F;  3CCL F;  1NMU B;  1Q81 H;  1W3E X;  3NK7 A;  1X7O A;  1Q7Y H;  4NQ3 A;  3NK6 A;  4BVR A;  5HXU A;  3E20 B;  3JCM M;  5HWE A;  2FC3 A;  4BY9 D;  4BW0 B;  3MCA B;  3OW2 F;  3HJW C;  5GAP K;  5HY0 A;  5DCV A;  2GLZ A;  4EI9 A;  1M90 H;  2QI2 A;  1KQS F;  1SDS A;  3CC4 F;  2BO1 A;  5GIO C;  5HY1 A;  3CCS F;  1VQM F;  1Q82 H;  2HVY D;  3RA5 A;  3CME F;  3CCM F;  3CC7 F;  5G4U C;  3GYQ A;  3NMU C;  3VMF B;  1X52 A;  1YJ9 F;  1GO1 A;  3CPW F;  2LBX A;  2OZB A;  2FGY A;  5HY2 A;  3CD6 F;  3FFM A;  3OBW A;  3SIU A;  1S72 F;  3AGK A;  1Q86 H;  3G71 F;  3V3T A;  1H7M A;  4X3M A;  3CPQ A;  3LFO A;  3ON1 A;  3J80 M;  1RLG A;  2AIF A;  5G4V C;  3CXC F;  1VQ7 F;  5HY4 A;  3CMA F;  1W2B F;  3J7A R;  1KD1 H;  1VQL F;  1YHQ F;  3VI6 A;  5EWR A;  1VQO F;  1YJW F;  4EI7 A;  4EI8 A;  1CN7 A;  3LWV C;  1VQ6 F;  5EO3 A;  2KTV A;  1N8R H;  4C4W C;  3IR9 A;  2QEX F;  1T0K B;  2ALE A;  3RA6 A;  3V7E A;  2I6D A;  3NVI B;  3WXM B;  3LWR C;  1K73 H;  2OTJ F;  1X7P A;  1XBI A;  3HAX D;  1PXW A;  4XCQ A;  3LWP C;  5A2Q M;  1VQK F;  5FJ4 C;  1M1K H;  1K8A H;  3G4S F;  3I56 F;  1QVF F;  1YIJ F;  3CCU F;  2WAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...