3GTZA

Crystal structure of a putative translation initiation inhibitor from salmonella typhimurium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SLSIVRIDAEDRWSDVVIYNNTLWYTGVPENLDADAFEQTANTLAQIDAVLEKQGSSKSRILDATIFLSDKADFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKYKVEIKIVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative translation initiation inhibitor from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Structural genomics, unknown function
molecule keywords Putative translation initiation inhibitor
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3gtzA00
4ZK7A 1XRGA 2UYJA 2B33A 3ZO8A 2UYNB 1COMA 2CWJA 1ONIA 1QD9A 2DYYA 3I7TA 3ZP7A 2CW4A 2CSLA 1FNKA 2CVLA 1PF5A 5HP7A 1DBFA 1JD1A 1QU9A 1UFYA 1FNJA 2CHSA 3L7QA 3LMEA 3KJKA 2EWCA 1XHOA 3LYBA 3R0PA 3I3FA 3M4SA 3VCZA 1QAHA 3ZP4A 2UYKA 3K12A 3QUWA 3D01A 5HP8A 2IG8A 2UYPA 1X25A 2OTMA 3K0TA 3ZOPA 2CHTA 1ODEA 3M1XA 3KJJA 3MQWA 3V4DA 1UI9A 3GTZA 1NQ3A 2UYNA 1J7HA 4NWOB
chains in the Genus database with same CATH superfamily
3FFMA 2G9IA 3WGKA 3CCRF 2KG4A 1VQ4F 3JAMM 4O4LB 3PAFA 3M84A 4TUYA 2H8CA 5DCVA 4U3JB 2CZWA 3D54A 3NVIB 1FNJA 3C9RA 4O4HA 2GVIA 1W42A 3WPWA 2Z1UA 5FJ4C 2PHNA 3VCZA 1QAHA 2BO1A 2HP0B 4EB6B 1VQKF 5HY0A 3IEWA 3G71F 3IKFA 1GO1A 3KJJA 3N2KB 4BVSA 1YIJF 1NJIH 4ZHQB 4C81A 2OHWA 2VAWA 1IV3A 4ZHYB 3CCMF 3E20B 3GHZA 5MN6A 5GIOC 3WJQA 1Z5VA 2H6LA 2RB9A 4G88A 3ESJA 3IEQA 3HKBB 1Q82H 3VI6A 5JH7B 2CHSA 3KJKA 5A2QM 3S0HA 5HWEA 3OW2F 5LP6A 5EYPA 3S03A 1T0KB 5LP6B 3JALA 2ZF8A 3IR9A 1VH8A 3PLAC 1ODEA 3HAXD 5CA0A 1K8AH 3SIVA 2UYNA 3IMPA 3N4ZA 4PWTA 2IQQA 3WGNA 4BVRA 4C8EA 3G4SF 3HWUA 1CN7A 5ITZB 1KQSF 2VAMA 1NMUB 5ITZA 5JCOC 4TZZA 2K1SA 3CC4F 1FFXB 2RHJA 4C82A 3LYBA 3ZP7A 3S02A 3P0ZA 5B8FA 2IAFA 1QVGF 4O4IB 3MDOA 5HY4A 5GONA 4X20B 2HP0A 3B6NA 5HP8A 4HNAB 1X25A 4I55B 5J2TB 5C8YB 3V7EA 4WBNA 3E1YA 1YJ9F 3FD5A 1Q8RA 3CCQF 3J7AR 3JATA 1ONIA 4ZI7B 3JATB 1PXWA 2VGMA 3C8LA 3ERNA 5JVDA 3RA5A 2N48A 1SA0B 2LCAA 3LWQC 3K14A 2EWCA 1XHOA 1FSZA 1QVFF 5FNVB 1U3LA 5LOVA 2BTQB 3CPQA 4RHAA 5IJ9A 5KX5B 4O4LA 4O4IA 4FFBB 2ZVYA 2F9ZC 4FFBA 5JQGA 5CA0B 3K0TA 3CYQA 2VXYA 3FPIA 2GLZA 3VYUC 3LDTA 4O4HB 1JFFB 2AIFA 2QEXF 1VQ7F 5GANK 1QD9A 5EB1B 3TD5A 3LFOA 4U3JA 3F0EA 3CCJF 2HS4A 2HRYA 5EO3A 5LYJA 3RYCA 1TUBB 5HXZA 4G4WA 4LNUB 2JNBA 3JARB 3HKDB 2W8BC 4G4ZA 5EAZA 3RYCB 3HKEB 3D00A 3C9TA 5LP6C 2VAPA 3VOBA 3JVHA 2YYEA 3G6EF 4X1YB 3J81M 4BT6A 5IJ9B 3JALB 1YGYA 3JAKB 4RQOA 3LWPC 4BVQA 1SA0A 4TUYB 3JASA 1T0AA 3OBYA 3MCAB 3RYFA 4B62A 5LXTB 1OAPA 4B46A 3D01A 1Z5WA 4I4TA 2HS0A 1YJNF 3JASB 5MN5A 5BMVA 4O2BB 1VQVA 2DYYA 1JY8A 4E6EA 4F6RA 3CG6A 4O2AA 3ELCA 4X20A 4X1IA 1U43A 4X1IB 4LCKA 1H7MA 1FFXA 1R1MA 3E22B 3HKEA 5CB4B 4WBNB 3NVKE 3O85A 3C9SA 4KWEA 3ZP4A 3JAWA 4DRXA 1GO0A 5HY1A 3S0WA 3V3TA 1W5FA 3K2XA 2CHTA 3FD6A 2OTJF 1IPAA 1VQMF 5IYZA 5AVMA 3HKDA 1COMA 3KE1A 4U39A 3RE3A 5IT9M 1Q81H 1K73H 2RHOA 1TVKB 1VQ8F 2QTPA 3N2GB 3F0DA 1FNKA 5HXUA 4X1KB 3I55F 4YJ3A 3HKBA 3WPXA 4O4JA 3KIZA 2FGYA 3WGLA 5G4VC 3F0GA 1X52A 4C4WC 1KC8H 4BT2A 1JFFA 2ZODA 4NQ3A 2KTVA 1U40A 3CCLF 2PMPA 3KHNA 3CCVF 1YITF 3LWOC 3GTZA 4G4YA 5BMVB 3E22A 3CCUF 3N4YA 3DDNA 5MN4A 5GIPC 4R40B 5IJ0B 3FBAA 2BTOA 4EB6A 1RLGA 4B5CA 3LWRC 1OFUA 1E7KA 5EWRA 5LOVB 2AMTA 1YQNA 1QU9A 1GZ0A 3HKCA 3UT5A 4ZHQA 3CCSF 5J2TA 3VOAA 2ZOVA 3BYQA 3J80M 3VTIC 1SZQA 1H47A 5FLXM 1W5AA 1RQ2A 3QTYA 1VK3A 5EB0A 2R751 4BT3A 1VQOF 3JAKA 2GZLA 4ZHVA 2UYJA 1IV4A 2B33A 5C8YA 3WJRA 2CWJA 3WXMB 1YJWF 2LBWA 4I4TB 3LWVC 1GX1A 1JD1A 3F6MA 3LMEA 3QHDA 2R6R1 3TD3A 1CK2A 3MCQA 2KGWA 4DXDA 1W2BF 3RYHB 2OTLF 1H48A 2Z1EA 3MBMA 3ZOPA 4IHJB 1W40A 4ZOLB 2BTUA 4O4JB 5JQGB 4I50B 2Z1TA 2Z1FA 1XRGA 5JCOA 1KNKA 4TV8A 2LBXA 5EZYA 3GYQA 3HJWC 4G4XA 3T80A 3U0OA 2VGNA 3VIUA 5CB4A 4TV8B 1DBFA 1W5BA 2Q1XA 5EZYB 2WALA 5IYZB 3M4SA 3EORA 4TV9B 4YJ2B 4C8GA 3WGMA 3HTNA 1VQNF 5LA6A 1XV2A 4EI7A 4IIJB 3HKCB 3I56F 2YXZA 2KTUA 1DT9A 4G4VA 3WGJA 4ZK7A 1VQLF 1K9MH 3OONA 4EI8A 3CCEF 5J2UB 5CA1A 1KD1H 5KX5A 3V7QA 3I7TA 2Q1YA 2CW4A 1X7PA 2CSLA 1M90H 1PF5A 3JAWB 4DRXB 3CC7F 3CD6F 1SDSA 3C9UA 2HVYD 1U3PA 4O2BA 4HNAA 1RQ7A 1W581 3N2KA 2HQSC 4NUTA 2AIZP 3CB2A 3IKEA 5GINC 3RYFB 3VYTC 1ZWZA 2DT4A 4NWOB 4BW0B 3AGKA 4F6RB 2HP3A 2P6YA 3VYSC 4ZHWA 4BY9D 4X1YA 5LA6B 1W41A 4I50A 5J2UA 2Z01A 3R0PA 4C8IA 1VHAA 1TVKA 2QI2A 3CC2F 1W5EA 3I3FA 2LBTA 1N8RH 3CMEF 2UYKA 3S06A 1KNJA 3WJPA 4BT7A 4XCQA 3V4DA 5GONB 3OBWA 5LYJB 3Q8HA 4X1KA 3ZO8A 5GAPK 2UYNB 4YJ3B 3CXCF 2V9YA 5FNVA 3VO8A 1IV2A 4O2AB 1IV1A 1RA4A 3UT5B 1RLUA 2CVLA 5HP7A 4LNUA 5JH7A 2UZHA 1W59A 4ZI7A 3DC2A 3CMAF 5CA1B 3F0FA 3K12A 1XBIA 3P10A 2IG8A 4IHJA 1JN1A 4BT4A 1NQ3A 5G4UC 1J7HA 4I55A 1Q7YH 1VQ9F 2I6DA 3CYPB 5JVDB 1M1KH 1YHQF 4B45A 2RHHA 5IJ0A 2NMUA 1VQ6F 1W55A 5EIBD 2ZAUA 1X7OA 3JCMM 3TD4A 3NK7A 1Q86H 5LXTA 1S72F 4M8IA 1UFYA 1CLIA 1W57A 4IIJA 3RYIA 4BVTA 2ZVZA 2HRUA 2OTMA 3CPWF 1W3EX 4BT5A 2HS3A 2RHLA 3MQWA 1UI9A 4X3LA 3VMFB 3N2GA 3NMUC 2QA4F 2HX0A 5HY2A 3SIUA 2FC3A 5EYPB 1YI2F 3ON1A 2ALEA 3RA6A 2MQEA 1TUBA 3S0YA 4X3MA 2I6RA 3NK6A 4TV9A 4YJ2A 3L7QA 4EI9A 4ZOLA 1VQPF 1JJ2F 5KMGA 3QUWA 3RYHA 2UYPA 3P4EA 3RYIB 5EIBC 3M1XA 2H8EA 4ERHA 2OZBA 2L26A 3JARA 1VQ5F 5KMGB
chains in the Genus database with same CATH topology
4ZK7A 1XRGA 2UYJA 2B33A 3ZO8A 2UYNB 1COMA 2CWJA 1ONIA 1QD9A 2DYYA 3I7TA 3ZP7A 2CW4A 2CSLA 1FNKA 2CVLA 1PF5A 5HP7A 1DBFA 1JD1A 1QU9A 1UFYA 1FNJA 2CHSA 3L7QA 3LMEA 3KJKA 2EWCA 1XHOA 3LYBA 3R0PA 3I3FA 3M4SA 3VCZA 1QAHA 3ZP4A 2UYKA 3K12A 3QUWA 3D01A 5HP8A 2IG8A 2UYPA 1X25A 2OTMA 3K0TA 3ZOPA 2CHTA 1ODEA 3M1XA 3KJJA 3MQWA 3V4DA 1UI9A 3GTZA 1NQ3A 2UYNA 1J7HA 4NWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK7 A;  1XRG A;  2UYJ A;  2B33 A;  3ZO8 A;  2UYN B;  1COM A;  2CWJ A;  1ONI A;  1QD9 A;  2DYY A;  3I7T A;  3ZP7 A;  2CW4 A;  2CSL A;  1FNK A;  2CVL A;  1PF5 A;  5HP7 A;  1DBF A;  1JD1 A;  1QU9 A;  1UFY A;  1FNJ A;  2CHS A;  3L7Q A;  3LME A;  3KJK A;  2EWC A;  1XHO A;  3LYB A;  3R0P A;  3I3F A;  3M4S A;  3VCZ A;  1QAH A;  3ZP4 A;  2UYK A;  3K12 A;  3QUW A;  3D01 A;  5HP8 A;  2IG8 A;  2UYP A;  1X25 A;  2OTM A;  3K0T A;  3ZOP A;  2CHT A;  1ODE A;  3M1X A;  3KJJ A;  3MQW A;  3V4D A;  1UI9 A;  3GTZ A;  1NQ3 A;  2UYN A;  1J7H A;  4NWO B; 
#chains in the Genus database with same CATH topology
 3FFM A;  2G9I A;  3WGK A;  3CCR F;  2KG4 A;  1VQ4 F;  3JAM M;  4O4L B;  3PAF A;  3M84 A;  4TUY A;  2H8C A;  5DCV A;  4U3J B;  2CZW A;  3D54 A;  3NVI B;  1FNJ A;  3C9R A;  4O4H A;  2GVI A;  1W42 A;  3WPW A;  2Z1U A;  5FJ4 C;  2PHN A;  3VCZ A;  1QAH A;  2BO1 A;  2HP0 B;  4EB6 B;  1VQK F;  5HY0 A;  3IEW A;  3G71 F;  3IKF A;  1GO1 A;  3KJJ A;  3N2K B;  4BVS A;  1YIJ F;  1NJI H;  4ZHQ B;  4C81 A;  2OHW A;  2VAW A;  1IV3 A;  4ZHY B;  3CCM F;  3E20 B;  3GHZ A;  5MN6 A;  5GIO C;  3WJQ A;  1Z5V A;  2H6L A;  2RB9 A;  4G88 A;  3ESJ A;  3IEQ A;  3HKB B;  1Q82 H;  3VI6 A;  5JH7 B;  2CHS A;  3KJK A;  5A2Q M;  3S0H A;  5HWE A;  3OW2 F;  5LP6 A;  5EYP A;  3S03 A;  1T0K B;  5LP6 B;  3JAL A;  2ZF8 A;  3IR9 A;  1VH8 A;  3PLA C;  1ODE A;  3HAX D;  5CA0 A;  1K8A H;  3SIV A;  2UYN A;  3IMP A;  3N4Z A;  4PWT A;  2IQQ A;  3WGN A;  4BVR A;  4C8E A;  3G4S F;  3HWU A;  1CN7 A;  5ITZ B;  1KQS F;  2VAM A;  1NMU B;  5ITZ A;  5JCO C;  4TZZ A;  2K1S A;  3CC4 F;  1FFX B;  2RHJ A;  4C82 A;  3LYB A;  3ZP7 A;  3S02 A;  3P0Z A;  5B8F A;  2IAF A;  1QVG F;  4O4I B;  3MDO A;  5HY4 A;  5GON A;  4X20 B;  2HP0 A;  3B6N A;  5HP8 A;  4HNA B;  1X25 A;  4I55 B;  5J2T B;  5C8Y B;  3V7E A;  4WBN A;  3E1Y A;  1YJ9 F;  3FD5 A;  1Q8R A;  3CCQ F;  3J7A R;  3JAT A;  1ONI A;  4ZI7 B;  3JAT B;  1PXW A;  2VGM A;  3C8L A;  3ERN A;  5JVD A;  3RA5 A;  2N48 A;  1SA0 B;  2LCA A;  3LWQ C;  3K14 A;  2EWC A;  1XHO A;  1FSZ A;  1QVF F;  5FNV B;  1U3L A;  5LOV A;  2BTQ B;  3CPQ A;  4RHA A;  5IJ9 A;  5KX5 B;  4O4L A;  4O4I A;  4FFB B;  2ZVY A;  2F9Z C;  4FFB A;  5JQG A;  5CA0 B;  3K0T A;  3CYQ A;  2VXY A;  3FPI A;  2GLZ A;  3VYU C;  3LDT A;  4O4H B;  1JFF B;  2AIF A;  2QEX F;  1VQ7 F;  5GAN K;  1QD9 A;  5EB1 B;  3TD5 A;  3LFO A;  4U3J A;  3F0E A;  3CCJ F;  2HS4 A;  2HRY A;  5EO3 A;  5LYJ A;  3RYC A;  1TUB B;  5HXZ A;  4G4W A;  4LNU B;  2JNB A;  3JAR B;  3HKD B;  2W8B C;  4G4Z A;  5EAZ A;  3RYC B;  3HKE B;  3D00 A;  3C9T A;  5LP6 C;  2VAP A;  3VOB A;  3JVH A;  2YYE A;  3G6E F;  4X1Y B;  3J81 M;  4BT6 A;  5IJ9 B;  3JAL B;  1YGY A;  3JAK B;  4RQO A;  3LWP C;  4BVQ A;  1SA0 A;  4TUY B;  3JAS A;  1T0A A;  3OBY A;  3MCA B;  3RYF A;  4B62 A;  5LXT B;  1OAP A;  4B46 A;  3D01 A;  1Z5W A;  4I4T A;  2HS0 A;  1YJN F;  3JAS B;  5MN5 A;  5BMV A;  4O2B B;  1VQV A;  2DYY A;  1JY8 A;  4E6E A;  4F6R A;  3CG6 A;  4O2A A;  3ELC A;  4X20 A;  4X1I A;  1U43 A;  4X1I B;  4LCK A;  1H7M A;  1FFX A;  1R1M A;  3E22 B;  3HKE A;  5CB4 B;  4WBN B;  3NVK E;  3O85 A;  3C9S A;  4KWE A;  3ZP4 A;  3JAW A;  4DRX A;  1GO0 A;  5HY1 A;  3S0W A;  3V3T A;  1W5F A;  3K2X A;  2CHT A;  3FD6 A;  2OTJ F;  1IPA A;  1VQM F;  5IYZ A;  5AVM A;  3HKD A;  1COM A;  3KE1 A;  4U39 A;  3RE3 A;  5IT9 M;  1Q81 H;  1K73 H;  2RHO A;  1TVK B;  1VQ8 F;  2QTP A;  3N2G B;  3F0D A;  1FNK A;  5HXU A;  4X1K B;  3I55 F;  4YJ3 A;  3HKB A;  3WPX A;  4O4J A;  3KIZ A;  2FGY A;  3WGL A;  5G4V C;  3F0G A;  1X52 A;  4C4W C;  1KC8 H;  4BT2 A;  1JFF A;  2ZOD A;  4NQ3 A;  2KTV A;  1U40 A;  3CCL F;  2PMP A;  3KHN A;  3CCV F;  1YIT F;  3LWO C;  3GTZ A;  4G4Y A;  5BMV B;  3E22 A;  3CCU F;  3N4Y A;  3DDN A;  5MN4 A;  5GIP C;  4R40 B;  5IJ0 B;  3FBA A;  2BTO A;  4EB6 A;  1RLG A;  4B5C A;  3LWR C;  1OFU A;  1E7K A;  5EWR A;  5LOV B;  2AMT A;  1YQN A;  1QU9 A;  1GZ0 A;  3HKC A;  3UT5 A;  4ZHQ A;  3CCS F;  5J2T A;  3VOA A;  2ZOV A;  3BYQ A;  3J80 M;  3VTI C;  1SZQ A;  1H47 A;  5FLX M;  1W5A A;  1RQ2 A;  3QTY A;  1VK3 A;  5EB0 A;  2R75 1;  4BT3 A;  1VQO F;  3JAK A;  2GZL A;  4ZHV A;  2UYJ A;  1IV4 A;  2B33 A;  5C8Y A;  3WJR A;  2CWJ A;  3WXM B;  1YJW F;  2LBW A;  4I4T B;  3LWV C;  1GX1 A;  1JD1 A;  3F6M A;  3LME A;  3QHD A;  2R6R 1;  3TD3 A;  1CK2 A;  3MCQ A;  2KGW A;  4DXD A;  1W2B F;  3RYH B;  2OTL F;  1H48 A;  2Z1E A;  3MBM A;  3ZOP A;  4IHJ B;  1W40 A;  4ZOL B;  2BTU A;  4O4J B;  5JQG B;  4I50 B;  2Z1T A;  2Z1F A;  1XRG A;  5JCO A;  1KNK A;  4TV8 A;  2LBX A;  5EZY A;  3GYQ A;  3HJW C;  4G4X A;  3T80 A;  3U0O A;  2VGN A;  3VIU A;  5CB4 A;  4TV8 B;  1DBF A;  1W5B A;  2Q1X A;  5EZY B;  2WAL A;  5IYZ B;  3M4S A;  3EOR A;  4TV9 B;  4YJ2 B;  4C8G A;  3WGM A;  3HTN A;  1VQN F;  5LA6 A;  1XV2 A;  4EI7 A;  4IIJ B;  3HKC B;  3I56 F;  2YXZ A;  2KTU A;  1DT9 A;  4G4V A;  3WGJ A;  4ZK7 A;  1VQL F;  1K9M H;  3OON A;  4EI8 A;  3CCE F;  5J2U B;  5CA1 A;  1KD1 H;  5KX5 A;  3V7Q A;  3I7T A;  2Q1Y A;  2CW4 A;  1X7P A;  2CSL A;  1M90 H;  1PF5 A;  3JAW B;  4DRX B;  3CC7 F;  3CD6 F;  1SDS A;  3C9U A;  2HVY D;  1U3P A;  4O2B A;  4HNA A;  1RQ7 A;  1W58 1;  3N2K A;  2HQS C;  4NUT A;  2AIZ P;  3CB2 A;  3IKE A;  5GIN C;  3RYF B;  3VYT C;  1ZWZ A;  2DT4 A;  4NWO B;  4BW0 B;  3AGK A;  4F6R B;  2HP3 A;  2P6Y A;  3VYS C;  4ZHW A;  4BY9 D;  4X1Y A;  5LA6 B;  1W41 A;  4I50 A;  5J2U A;  2Z01 A;  3R0P A;  4C8I A;  1VHA A;  1TVK A;  2QI2 A;  3CC2 F;  1W5E A;  3I3F A;  2LBT A;  1N8R H;  3CME F;  2UYK A;  3S06 A;  1KNJ A;  3WJP A;  4BT7 A;  4XCQ A;  3V4D A;  5GON B;  3OBW A;  5LYJ B;  3Q8H A;  4X1K A;  3ZO8 A;  5GAP K;  2UYN B;  4YJ3 B;  3CXC F;  2V9Y A;  5FNV A;  3VO8 A;  1IV2 A;  4O2A B;  1IV1 A;  1RA4 A;  3UT5 B;  1RLU A;  2CVL A;  5HP7 A;  4LNU A;  5JH7 A;  2UZH A;  1W59 A;  4ZI7 A;  3DC2 A;  3CMA F;  5CA1 B;  3F0F A;  3K12 A;  1XBI A;  3P10 A;  2IG8 A;  4IHJ A;  1JN1 A;  4BT4 A;  1NQ3 A;  5G4U C;  1J7H A;  4I55 A;  1Q7Y H;  1VQ9 F;  2I6D A;  3CYP B;  5JVD B;  1M1K H;  1YHQ F;  4B45 A;  2RHH A;  5IJ0 A;  2NMU A;  1VQ6 F;  1W55 A;  5EIB D;  2ZAU A;  1X7O A;  3JCM M;  3TD4 A;  3NK7 A;  1Q86 H;  5LXT A;  1S72 F;  4M8I A;  1UFY A;  1CLI A;  1W57 A;  4IIJ A;  3RYI A;  4BVT A;  2ZVZ A;  2HRU A;  2OTM A;  3CPW F;  1W3E X;  4BT5 A;  2HS3 A;  2RHL A;  3MQW A;  1UI9 A;  4X3L A;  3VMF B;  3N2G A;  3NMU C;  2QA4 F;  2HX0 A;  5HY2 A;  3SIU A;  2FC3 A;  5EYP B;  1YI2 F;  3ON1 A;  2ALE A;  3RA6 A;  2MQE A;  1TUB A;  3S0Y A;  4X3M A;  2I6R A;  3NK6 A;  4TV9 A;  4YJ2 A;  3L7Q A;  4EI9 A;  4ZOL A;  1VQP F;  1JJ2 F;  5KMG A;  3QUW A;  3RYH A;  2UYP A;  3P4E A;  3RYI B;  5EIB C;  3M1X A;  2H8E A;  4ERH A;  2OZB A;  2L26 A;  3JAR A;  1VQ5 F;  5KMG B; 
#chains in the Genus database with same CATH homology
 4ZK7 A;  1XRG A;  2UYJ A;  2B33 A;  3ZO8 A;  2UYN B;  1COM A;  2CWJ A;  1ONI A;  1QD9 A;  2DYY A;  3I7T A;  3ZP7 A;  2CW4 A;  2CSL A;  1FNK A;  2CVL A;  1PF5 A;  5HP7 A;  1DBF A;  1JD1 A;  1QU9 A;  1UFY A;  1FNJ A;  2CHS A;  3L7Q A;  3LME A;  3KJK A;  2EWC A;  1XHO A;  3LYB A;  3R0P A;  3I3F A;  3M4S A;  3VCZ A;  1QAH A;  3ZP4 A;  2UYK A;  3K12 A;  3QUW A;  3D01 A;  5HP8 A;  2IG8 A;  2UYP A;  1X25 A;  2OTM A;  3K0T A;  3ZOP A;  2CHT A;  1ODE A;  3M1X A;  3KJJ A;  3MQW A;  3V4D A;  1UI9 A;  3GTZ A;  1NQ3 A;  2UYN A;  1J7H A;  4NWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...