3GTZA

Crystal structure of a putative translation initiation inhibitor from salmonella typhimurium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'SLSIVRIDAEDRWSDVVIYNNTLWYTGVPENLDADAFEQTANTLAQIDAVLEKQGSSKSRILDATIFLSDKADFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKYKVEIKIVAAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation initiation inhibitor
publication title Crystal structure of a putative translation initiation inhibitor from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Structural genomics, unknown function
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3gtzA00
1QAHA 2EWCA 2CWJA 2IG8A 1JD1A 1QU9A 3GTZA 2UYPA 3I7TA 2UYJA 1ONIA 3K12A 3KJJA 3I3FA 3V4DA 3ZP4A 3ZP7A 3KJKA 3QUWA 2UYNA 1DBFA 2B33A 3MQWA 3VCZA 2DYYA 3ZO8A 1UFYA 3M4SA 3R0PA 4ZK7A 2CVLA 1FNJA 3D01A 3K0TA 1X25A 1FNKA 3L7QA 1NQ3A 3ZOPA 2UYKA 1UI9A 2CW4A 1XRGA 1COMA 3LMEA 1QD9A 2CHTA 5HP8A 5HP7A 1XHOA 3M1XA 2CHSA 2UYNB 3LYBA 1PF5A 1J7HA 2OTMA 4NWOB 2CSLA 1ODEA
chains in the Genus database with same CATH superfamily
3TD4A 2EWCA 1JD1A 5LXTB 3N2KA 4F6RB 2FGYA 2H6LA 4R40B 4G88A 4C8IA 4G4VA 3S06A 4I4TA 5FJ4C 2K1SA 3R0PA 3JATB 4IHJA 4BVQA 1TVKB 3E22A 3MBMA 4I50A 1QD9A 3WJRA 1X52A 3ON1A 3WGLA 5EZYA 1K73H 5JCOA 2AMTA 3WGKA 3RYCB 1QAHA 3LWVC 2GZLA 1QU9A 2HQSC 3ZP4A 3ZP7A 3MCQA 3NMUC 3NK7A 3RYFB 3E20B 2Z1FA 4DXDA 1RQ7A 5J2UA 2LBXA 3RYIA 3CCEF 4NUTA 4BY9D 4BT4A 3HAXD 5LXTA 2I6RA 4F6RA 3K2XA 4RQOA 4B62A 5HP7A 3CG6A 3M1XA 4BVTA 3KIZA 1SA0B 4B46A 4G4WA 3CCRF 1Q81H 1VQ6F 3JATA 4BT7A 2GVIA 3CCUF 1TVKA 3F0DA 3G6EF 3PAFA 5LOVB 1VHAA 1ZWZA 1QVGF 2KGWA 3U0OA 3CD6F 1W40A 4O4HB 3CXCF 3ESJA 5EWRA 5KX5B 4ZHQA 2UZHA 3RYCA 4ZK7A 2H8EA 2HS3A 5A2QM 1FNKA 1U40A 3JASB 1NMUB 1OFUA 3RYFA 3I56F 2OHWA 4NQ3A 4TV9B 2HX0A 1QVFF 3CPQA 4U39A 3S03A 2UYPA 2Q1YA 1ONIA 2ZAUA 1VQVA 2PHNA 2Z1TA 5EYPB 3VO8A 3KHNA 1SA0A 2KTUA 3MQWA 2RHHA 1VQ5F 4IIJB 5B8FA 3IKFA 3B6NA 1DT9A 1VQLF 1GO0A 5LOVA 5FLXM 3JARA 2VXYA 3MCAB 4O4HA 4BT6A 3Q8HA 5IT9M 4I55B 5KX5A 1M90H 4NWOB 3HKEB 4EI7A 2IAFA 4B45A 2RHLA 1Q7YH 3FBAA 2I6DA 2BO1A 4TUYB 3I3FA 1IV1A 4IHJB 1RQ2A 3KJKA 5HY1A 1DBFA 3WGNA 4TV9A 1H47A 1GZ0A 4U3JB 5GIPC 1VQMF 5J2TB 2BTUA 1NQ3A 4O4LB 3LWOC 5CA0B 1COMA 5JQGB 4BT3A 2Z1UA 3RA6A 1W5BA 1YIJF 2HP3A 2AIZP 5EYPA 2R6R1 1SDSA 4IIJA 3E1YA 1KNKA 2AIFA 1S72F 2OZBA 2DT4A 3V4DA 3N4ZA 5IJ0B 3C9RA 3RA5A 4X1YB 4B5CA 4I55A 3HKCB 2P6YA 3VYUC 4X1KB 3HKEA 3M4SA 4LNUB 2H8CA 4TUYA 2RB9A 4C81A 1IPAA 3IKEA 3F0GA 4XCQA 4BT5A 5C8YB 1RLGA 3VOAA 1FFXB 4RHAA 4O4JB 3K14A 5LP6B 4X20B 1W5EA 3J80M 3HKDB 4U3JA 3ZOPA 2ZODA 1X7OA 3P4EA 4ZHQB 5J2TA 4TZZA 2W8BC 2IG8A 4O4LA 2GLZA 4G4YA 5CA0A 5JQGA 2ZF8A 3VTIC 3HWUA 2HVYD 3PLAC 1YITF 3QUWA 2Z1EA 4ZOLB 1KC8H 3HKBB 5CB4B 1VQ4F 1VQNF 1PXWA 3CCLF 4O2AB 4X3MA 3CCMF 3CCQF 1VQPF 1UFYA 2PMPA 3CC4F 2BTOA 4ZHVA 3LFOA 3KE1A 3RYHA 5IJ0A 1XRGA 2QTPA 4X1YA 3O85A 2IQQA 2L26A 4X3LA 3HKCA 1Z5WA 3IEQA 4TV8B 4X1KA 1VQOF 1W59A 3FFMA 4LNUA 3S0HA 4LCKA 4BW0B 5C8YA 4YJ2B 1FFXA 5DCVA 5FNVB 4O4JA 3JARB 3JALA 5LP6A 4X20A 1YHQF 1IV4A 3HKDA 3VCZA 3FD5A 4WBNB 3VMFB 3QTYA 3V3TA 3VI6A 4G4XA 3N4YA 3JAMM 2G9IA 1TUBB 2V9YA 2LCAA 3EORA 3FPIA 3WGJA 3C9UA 4ZOLA 3HKBA 3BYQA 5CB4A 3C8LA 4O2AA 2OTMA 5MN5A 5IYZB 4C4WC 2Q1XA 1Q82H 1FSZA 5JCOC 4X1IB 3CMAF 5GAPK 3JAWB 5HY2A 4BVRA 1IV2A 3CC2F 3MDOA 3CYQA 1W3EX 4TV8A 3J81M 5JVDB 1T0AA 5BMVB 3OBYA 1JFFB 3JAKB 2ALEA 3D01A 2HRYA 4YJ2A 5G4VC 3ELCA 5FNVA 5HP8A 3WXMB 1IV3A 4C8GA 2OTJF 5GIOC 4WBNA 5GONB 3SIUA 4O4IB 1CLIA 1XBIA 3GYQA 4M8IA 4YJ3B 1H7MA 1TUBA 4PWTA 2LBTA 3S0WA 1YI2F 1GX1A 5HXZA 3N2GB 1VQ9F 5IYZA 1JN1A 3CB2A 2VGNA 4X1IA 1N8RH 3T80A 3FD6A 3JAWA 2FC3A 1JY8A 5HY0A 1W5FA 5ITZB 3HJWC 3IEWA 2HP0A 2VAMA 4O2BB 2CHSA 3TD3A 5GINC 1U3LA 1YQNA 1J7HA 3SIVA 2VGMA 3JCMM 5JVDA 5BMVA 1K9MH 1CK2A 2CZWA 1ODEA 3LWRC 1JFFA 3JAKA 4ZHYB 3F6MA 3C9SA 3WPWA 4E6EA 3HTNA 3V7EA 5KMGB 3RYHB 4KWEA 4EI9A 2HS0A 5JH7B 1RLUA 3G71F 3CC7F 1W41A 2B33A 1VK3A 5GONA 4O4IA 3OONA 5MN6A 5LA6B 3J7AR 3CCVF 1FNJA 4YJ3A 1W5AA 2BTQB 2VAPA 1M1KH 1W57A 1H48A 2UYNB 3N2GA 1PF5A 1U43A 3JALB 3WJQA 3D00A 3QHDA 3WGMA 5EIBD 2R751 5EIBC 5ITZA 2RHJA 1YJWF 4BVSA 4O2BA 2QEXF 2QA4F 1VQ8F 1W42A 3NK6A 3CYPB 1CN7A 3F0FA 5G4UC 5KMGA 3M84A 3P10A 4ZHWA 5EB1B 5JH7A 3CMEF 1X7PA 1VH8A 5GANK 5MN4A 3C9TA 5LA6A 4FFBA 1KNJA 3G4SF 3VIUA 3GTZA 2UYJA 2Z01A 3VOBA 3VYSC 4BT2A 2UYNA 4C8EA 1YJNF 5CA1B 3ZO8A 4EI8A 3V7QA 2CVLA 5HXUA 1VQKF 3K0TA 1X25A 3DC2A 1UI9A 2CW4A 5IJ9B 3LYBA 2LBWA 2QI2A 3LDTA 1W581 2CSLA 4EB6B 3P0ZA 1K8AH 3I7TA 2RHOA 4G4ZA 2YYEA 2ZOVA 3NVKE 2MQEA 2HP0B 4C82A 5LYJB 2OTLF 1GO1A 1SZQA 2ZVYA 3CCSF 3RE3A 1T0KB 2UYKA 1U3PA 2KG4A 3WJPA 1E7KA 1VQ7F 3LWQC 5CA1A 2YXZA 3IMPA 3CCJF 1JJ2F 5IJ9A 4HNAB 4ZI7B 3KJJA 3UT5B 2WALA 1YGYA 4DRXB 3WPXA 5LP6C 4EB6A 3S0YA 2DYYA 2KTVA 1OAPA 2F9ZC 1W55A 3CPWF 1RA4A 3N2KB 3GHZA 2JNBA 2NMUA 1KQSF 2CHTA 3ERNA 3LWPC 5LYJA 5EB0A 2N48A 1W2BF 5AVMA 4I4TB 3F0EA 5HWEA 3TD5A 2CWJA 3JASA 2HRUA 1YJ9F 3K12A 3E22B 4I50B 3DDNA 3JVHA 5EZYB 1KD1H 2VAWA 1R1MA 3OBWA 4ERHA 3IR9A 1NJIH 2ZVZA 3AGKA 4FFBB 3L7QA 5EAZA 5EO3A 4HNAA 3S02A 1XV2A 4ZI7A 3VYTC 3LMEA 3UT5A 1XHOA 3I55F 2HS4A 4DRXA 3D54A 5J2UB 1Q8RA 1Z5VA 5HY4A 3RYIB 3OW2F 3NVIB 1Q86H
chains in the Genus database with same CATH topology
1QAHA 2EWCA 2CWJA 2IG8A 1JD1A 1QU9A 3GTZA 2UYPA 3I7TA 2UYJA 1ONIA 3K12A 3KJJA 3I3FA 3V4DA 3ZP4A 3ZP7A 3KJKA 3QUWA 2UYNA 1DBFA 2B33A 3MQWA 3VCZA 2DYYA 3ZO8A 1UFYA 3M4SA 3R0PA 4ZK7A 2CVLA 1FNJA 3D01A 3K0TA 1X25A 1FNKA 3L7QA 1NQ3A 3ZOPA 2UYKA 1UI9A 2CW4A 1XRGA 1COMA 3LMEA 1QD9A 2CHTA 5HP8A 5HP7A 1XHOA 3M1XA 2CHSA 2UYNB 3LYBA 1PF5A 1J7HA 2OTMA 4NWOB 2CSLA 1ODEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAH A;  2EWC A;  2CWJ A;  2IG8 A;  1JD1 A;  1QU9 A;  3GTZ A;  2UYP A;  3I7T A;  2UYJ A;  1ONI A;  3K12 A;  3KJJ A;  3I3F A;  3V4D A;  3ZP4 A;  3ZP7 A;  3KJK A;  3QUW A;  2UYN A;  1DBF A;  2B33 A;  3MQW A;  3VCZ A;  2DYY A;  3ZO8 A;  1UFY A;  3M4S A;  3R0P A;  4ZK7 A;  2CVL A;  1FNJ A;  3D01 A;  3K0T A;  1X25 A;  1FNK A;  3L7Q A;  1NQ3 A;  3ZOP A;  2UYK A;  1UI9 A;  2CW4 A;  1XRG A;  1COM A;  3LME A;  1QD9 A;  2CHT A;  5HP8 A;  5HP7 A;  1XHO A;  3M1X A;  2CHS A;  2UYN B;  3LYB A;  1PF5 A;  1J7H A;  2OTM A;  4NWO B;  2CSL A;  1ODE A; 
#chains in the Genus database with same CATH topology
 3TD4 A;  2EWC A;  1JD1 A;  5LXT B;  3N2K A;  4F6R B;  2FGY A;  2H6L A;  4R40 B;  4G88 A;  4C8I A;  4G4V A;  3S06 A;  4I4T A;  5FJ4 C;  2K1S A;  3R0P A;  3JAT B;  4IHJ A;  4BVQ A;  1TVK B;  3E22 A;  3MBM A;  4I50 A;  1QD9 A;  3WJR A;  1X52 A;  3ON1 A;  3WGL A;  5EZY A;  1K73 H;  5JCO A;  2AMT A;  3WGK A;  3RYC B;  1QAH A;  3LWV C;  2GZL A;  1QU9 A;  2HQS C;  3ZP4 A;  3ZP7 A;  3MCQ A;  3NMU C;  3NK7 A;  3RYF B;  3E20 B;  2Z1F A;  4DXD A;  1RQ7 A;  5J2U A;  2LBX A;  3RYI A;  3CCE F;  4NUT A;  4BY9 D;  4BT4 A;  3HAX D;  5LXT A;  2I6R A;  4F6R A;  3K2X A;  4RQO A;  4B62 A;  5HP7 A;  3CG6 A;  3M1X A;  4BVT A;  3KIZ A;  1SA0 B;  4B46 A;  4G4W A;  3CCR F;  1Q81 H;  1VQ6 F;  3JAT A;  4BT7 A;  2GVI A;  3CCU F;  1TVK A;  3F0D A;  3G6E F;  3PAF A;  5LOV B;  1VHA A;  1ZWZ A;  1QVG F;  2KGW A;  3U0O A;  3CD6 F;  1W40 A;  4O4H B;  3CXC F;  3ESJ A;  5EWR A;  5KX5 B;  4ZHQ A;  2UZH A;  3RYC A;  4ZK7 A;  2H8E A;  2HS3 A;  5A2Q M;  1FNK A;  1U40 A;  3JAS B;  1NMU B;  1OFU A;  3RYF A;  3I56 F;  2OHW A;  4NQ3 A;  4TV9 B;  2HX0 A;  1QVF F;  3CPQ A;  4U39 A;  3S03 A;  2UYP A;  2Q1Y A;  1ONI A;  2ZAU A;  1VQV A;  2PHN A;  2Z1T A;  5EYP B;  3VO8 A;  3KHN A;  1SA0 A;  2KTU A;  3MQW A;  2RHH A;  1VQ5 F;  4IIJ B;  5B8F A;  3IKF A;  3B6N A;  1DT9 A;  1VQL F;  1GO0 A;  5LOV A;  5FLX M;  3JAR A;  2VXY A;  3MCA B;  4O4H A;  4BT6 A;  3Q8H A;  5IT9 M;  4I55 B;  5KX5 A;  1M90 H;  4NWO B;  3HKE B;  4EI7 A;  2IAF A;  4B45 A;  2RHL A;  1Q7Y H;  3FBA A;  2I6D A;  2BO1 A;  4TUY B;  3I3F A;  1IV1 A;  4IHJ B;  1RQ2 A;  3KJK A;  5HY1 A;  1DBF A;  3WGN A;  4TV9 A;  1H47 A;  1GZ0 A;  4U3J B;  5GIP C;  1VQM F;  5J2T B;  2BTU A;  1NQ3 A;  4O4L B;  3LWO C;  5CA0 B;  1COM A;  5JQG B;  4BT3 A;  2Z1U A;  3RA6 A;  1W5B A;  1YIJ F;  2HP3 A;  2AIZ P;  5EYP A;  2R6R 1;  1SDS A;  4IIJ A;  3E1Y A;  1KNK A;  2AIF A;  1S72 F;  2OZB A;  2DT4 A;  3V4D A;  3N4Z A;  5IJ0 B;  3C9R A;  3RA5 A;  4X1Y B;  4B5C A;  4I55 A;  3HKC B;  2P6Y A;  3VYU C;  4X1K B;  3HKE A;  3M4S A;  4LNU B;  2H8C A;  4TUY A;  2RB9 A;  4C81 A;  1IPA A;  3IKE A;  3F0G A;  4XCQ A;  4BT5 A;  5C8Y B;  1RLG A;  3VOA A;  1FFX B;  4RHA A;  4O4J B;  3K14 A;  5LP6 B;  4X20 B;  1W5E A;  3J80 M;  3HKD B;  4U3J A;  3ZOP A;  2ZOD A;  1X7O A;  3P4E A;  4ZHQ B;  5J2T A;  4TZZ A;  2W8B C;  2IG8 A;  4O4L A;  2GLZ A;  4G4Y A;  5CA0 A;  5JQG A;  2ZF8 A;  3VTI C;  3HWU A;  2HVY D;  3PLA C;  1YIT F;  3QUW A;  2Z1E A;  4ZOL B;  1KC8 H;  3HKB B;  5CB4 B;  1VQ4 F;  1VQN F;  1PXW A;  3CCL F;  4O2A B;  4X3M A;  3CCM F;  3CCQ F;  1VQP F;  1UFY A;  2PMP A;  3CC4 F;  2BTO A;  4ZHV A;  3LFO A;  3KE1 A;  3RYH A;  5IJ0 A;  1XRG A;  2QTP A;  4X1Y A;  3O85 A;  2IQQ A;  2L26 A;  4X3L A;  3HKC A;  1Z5W A;  3IEQ A;  4TV8 B;  4X1K A;  1VQO F;  1W59 A;  3FFM A;  4LNU A;  3S0H A;  4LCK A;  4BW0 B;  5C8Y A;  4YJ2 B;  1FFX A;  5DCV A;  5FNV B;  4O4J A;  3JAR B;  3JAL A;  5LP6 A;  4X20 A;  1YHQ F;  1IV4 A;  3HKD A;  3VCZ A;  3FD5 A;  4WBN B;  3VMF B;  3QTY A;  3V3T A;  3VI6 A;  4G4X A;  3N4Y A;  3JAM M;  2G9I A;  1TUB B;  2V9Y A;  2LCA A;  3EOR A;  3FPI A;  3WGJ A;  3C9U A;  4ZOL A;  3HKB A;  3BYQ A;  5CB4 A;  3C8L A;  4O2A A;  2OTM A;  5MN5 A;  5IYZ B;  4C4W C;  2Q1X A;  1Q82 H;  1FSZ A;  5JCO C;  4X1I B;  3CMA F;  5GAP K;  3JAW B;  5HY2 A;  4BVR A;  1IV2 A;  3CC2 F;  3MDO A;  3CYQ A;  1W3E X;  4TV8 A;  3J81 M;  5JVD B;  1T0A A;  5BMV B;  3OBY A;  1JFF B;  3JAK B;  2ALE A;  3D01 A;  2HRY A;  4YJ2 A;  5G4V C;  3ELC A;  5FNV A;  5HP8 A;  3WXM B;  1IV3 A;  4C8G A;  2OTJ F;  5GIO C;  4WBN A;  5GON B;  3SIU A;  4O4I B;  1CLI A;  1XBI A;  3GYQ A;  4M8I A;  4YJ3 B;  1H7M A;  1TUB A;  4PWT A;  2LBT A;  3S0W A;  1YI2 F;  1GX1 A;  5HXZ A;  3N2G B;  1VQ9 F;  5IYZ A;  1JN1 A;  3CB2 A;  2VGN A;  4X1I A;  1N8R H;  3T80 A;  3FD6 A;  3JAW A;  2FC3 A;  1JY8 A;  5HY0 A;  1W5F A;  5ITZ B;  3HJW C;  3IEW A;  2HP0 A;  2VAM A;  4O2B B;  2CHS A;  3TD3 A;  5GIN C;  1U3L A;  1YQN A;  1J7H A;  3SIV A;  2VGM A;  3JCM M;  5JVD A;  5BMV A;  1K9M H;  1CK2 A;  2CZW A;  1ODE A;  3LWR C;  1JFF A;  3JAK A;  4ZHY B;  3F6M A;  3C9S A;  3WPW A;  4E6E A;  3HTN A;  3V7E A;  5KMG B;  3RYH B;  4KWE A;  4EI9 A;  2HS0 A;  5JH7 B;  1RLU A;  3G71 F;  3CC7 F;  1W41 A;  2B33 A;  1VK3 A;  5GON A;  4O4I A;  3OON A;  5MN6 A;  5LA6 B;  3J7A R;  3CCV F;  1FNJ A;  4YJ3 A;  1W5A A;  2BTQ B;  2VAP A;  1M1K H;  1W57 A;  1H48 A;  2UYN B;  3N2G A;  1PF5 A;  1U43 A;  3JAL B;  3WJQ A;  3D00 A;  3QHD A;  3WGM A;  5EIB D;  2R75 1;  5EIB C;  5ITZ A;  2RHJ A;  1YJW F;  4BVS A;  4O2B A;  2QEX F;  2QA4 F;  1VQ8 F;  1W42 A;  3NK6 A;  3CYP B;  1CN7 A;  3F0F A;  5G4U C;  5KMG A;  3M84 A;  3P10 A;  4ZHW A;  5EB1 B;  5JH7 A;  3CME F;  1X7P A;  1VH8 A;  5GAN K;  5MN4 A;  3C9T A;  5LA6 A;  4FFB A;  1KNJ A;  3G4S F;  3VIU A;  3GTZ A;  2UYJ A;  2Z01 A;  3VOB A;  3VYS C;  4BT2 A;  2UYN A;  4C8E A;  1YJN F;  5CA1 B;  3ZO8 A;  4EI8 A;  3V7Q A;  2CVL A;  5HXU A;  1VQK F;  3K0T A;  1X25 A;  3DC2 A;  1UI9 A;  2CW4 A;  5IJ9 B;  3LYB A;  2LBW A;  2QI2 A;  3LDT A;  1W58 1;  2CSL A;  4EB6 B;  3P0Z A;  1K8A H;  3I7T A;  2RHO A;  4G4Z A;  2YYE A;  2ZOV A;  3NVK E;  2MQE A;  2HP0 B;  4C82 A;  5LYJ B;  2OTL F;  1GO1 A;  1SZQ A;  2ZVY A;  3CCS F;  3RE3 A;  1T0K B;  2UYK A;  1U3P A;  2KG4 A;  3WJP A;  1E7K A;  1VQ7 F;  3LWQ C;  5CA1 A;  2YXZ A;  3IMP A;  3CCJ F;  1JJ2 F;  5IJ9 A;  4HNA B;  4ZI7 B;  3KJJ A;  3UT5 B;  2WAL A;  1YGY A;  4DRX B;  3WPX A;  5LP6 C;  4EB6 A;  3S0Y A;  2DYY A;  2KTV A;  1OAP A;  2F9Z C;  1W55 A;  3CPW F;  1RA4 A;  3N2K B;  3GHZ A;  2JNB A;  2NMU A;  1KQS F;  2CHT A;  3ERN A;  3LWP C;  5LYJ A;  5EB0 A;  2N48 A;  1W2B F;  5AVM A;  4I4T B;  3F0E A;  5HWE A;  3TD5 A;  2CWJ A;  3JAS A;  2HRU A;  1YJ9 F;  3K12 A;  3E22 B;  4I50 B;  3DDN A;  3JVH A;  5EZY B;  1KD1 H;  2VAW A;  1R1M A;  3OBW A;  4ERH A;  3IR9 A;  1NJI H;  2ZVZ A;  3AGK A;  4FFB B;  3L7Q A;  5EAZ A;  5EO3 A;  4HNA A;  3S02 A;  1XV2 A;  4ZI7 A;  3VYT C;  3LME A;  3UT5 A;  1XHO A;  3I55 F;  2HS4 A;  4DRX A;  3D54 A;  5J2U B;  1Q8R A;  1Z5V A;  5HY4 A;  3RYI B;  3OW2 F;  3NVI B;  1Q86 H; 
#chains in the Genus database with same CATH homology
 1QAH A;  2EWC A;  2CWJ A;  2IG8 A;  1JD1 A;  1QU9 A;  3GTZ A;  2UYP A;  3I7T A;  2UYJ A;  1ONI A;  3K12 A;  3KJJ A;  3I3F A;  3V4D A;  3ZP4 A;  3ZP7 A;  3KJK A;  3QUW A;  2UYN A;  1DBF A;  2B33 A;  3MQW A;  3VCZ A;  2DYY A;  3ZO8 A;  1UFY A;  3M4S A;  3R0P A;  4ZK7 A;  2CVL A;  1FNJ A;  3D01 A;  3K0T A;  1X25 A;  1FNK A;  3L7Q A;  1NQ3 A;  3ZOP A;  2UYK A;  1UI9 A;  2CW4 A;  1XRG A;  1COM A;  3LME A;  1QD9 A;  2CHT A;  5HP8 A;  5HP7 A;  1XHO A;  3M1X A;  2CHS A;  2UYN B;  3LYB A;  1PF5 A;  1J7H A;  2OTM A;  4NWO B;  2CSL A;  1ODE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...