3GTZA

Crystal structure of a putative translation initiation inhibitor from salmonella typhimurium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SLSIVRIDAEDRWSDVVIYNNTLWYTGVPENLDADAFEQTANTLAQIDAVLEKQGSSKSRILDATIFLSDKADFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKYKVEIKIVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation initiation inhibitor
publication title Crystal structure of a putative translation initiation inhibitor from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Structural genomics, unknown function
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3gtzA00
1UI9A 1JD1A 3KJJA 2UYKA 3D01A 4NWOB 3VCZA 1QU9A 2DYYA 1QAHA 1FNJA 1XRGA 3K12A 1FNKA 2CWJA 3K0TA 3L7QA 1XHOA 2CW4A 5HP8A 3R0PA 3I7TA 2CSLA 3I3FA 2CHSA 1ODEA 1QD9A 3ZOPA 5HP7A 2CVLA 3KJKA 3ZP4A 3ZP7A 2UYPA 1J7HA 1DBFA 2IG8A 1PF5A 1ONIA 2B33A 2UYNA 3MQWA 2EWCA 4ZK7A 1UFYA 3GTZA 3LYBA 3ZO8A 1COMA 3LMEA 3M4SA 2CHTA 2UYNB 1X25A 3M1XA 3QUWA 1NQ3A 2OTMA 3V4DA 2UYJA
chains in the Genus database with same CATH superfamily
1UI9A 1R1MA 3N2KA 4G4VA 4ZI7A 4BVRA 3HKEB 3KIZA 3M84A 3RA5A 2MQEA 4X1IB 2YYEA 2YXZA 2OHWA 5HY0A 1ZWZA 2AMTA 3G6EF 4X3MA 5LP6C 3JASA 2F9ZC 3MCAB 3WJRA 2VXYA 2CZWA 5EIBD 2QTPA 5J2UB 5JQGB 2OTLF 4BVQA 4LNUB 4U3JB 4IHJB 1OFUA 2G9IA 5CA1B 3MDOA 3ERNA 3F0DA 1RQ7A 1H47A 2GLZA 3CB2A 2Z1TA 1IV3A 2IQQA 3UT5A 5JVDB 3JALA 5IJ0A 1SDSA 2LBWA 1ODEA 5JH7B 3JAMM 4IIJA 4B62A 4O4IA 3T80A 1QVFF 2I6DA 1H7MA 3P10A 3HKCA 2VAPA 5LXTB 5CB4B 1XV2A 4ZK7A 3CPWF 5GONA 3TD3A 1X25A 3VOAA 2ZODA 3TD4A 4EI7A 1JJ2F 3WGJA 1FNJA 1W3EX 3WPWA 4HNAA 4B5CA 5HP8A 1W57A 1YIJF 3MCQA 1W5BA 3IEWA 4ZHYB 1VQ9F 2LCAA 3HWUA 4O2BA 3CCEF 3V7EA 4ERHA 3IKEA 3NMUC 4PWTA 5EB0A 3JAKA 4O2AB 1IV1A 5GAPK 4O4JA 5KX5B 4WBNA 4TV8A 3G71F 5HXUA 1CK2A 2HS0A 3IKFA 3JARB 4X3LA 3GYQA 5ITZA 4YJ2A 5FLXM 2UYJA 5MN4A 1NMUB 1GX1A 2HP0B 3RE3A 3HJWC 3CCRF 2CW4A 1QVGF 3SIVA 2ZOVA 3DDNA 3NK7A 3CCLF 3OBWA 4X20B 1W41A 5C8YA 3WJPA 1E7KA 3J80M 5EIBC 2H8CA 5JCOC 1W59A 3CYQA 3IMPA 1K73H 3MQWA 3GTZA 2CHTA 2ZVZA 1VQOF 5GANK 1YQNA 2NMUA 2RB9A 4NQ3A 5LP6A 2VAMA 2Z1EA 3B6NA 4G4XA 5EZYA 2JNBA 4DRXB 3U0OA 4EI9A 5IJ9B 5LOVB 1VH8A 5CA0A 3S0YA 2HRYA 5HP7A 5MN6A 5CA0B 1K8AH 1VQ4F 2CVLA 2UZHA 5AVMA 2KTVA 3ZP4A 1TVKB 3ZP7A 1S72F 5BMVA 3WPXA 5A2QM 1VHAA 3CD6F 3VYUC 1DBFA 4I4TA 3S0HA 5FNVB 1PF5A 1VQKF 3N2GB 5EYPA 1YGYA 3CC2F 3CXCF 5EAZA 5EYPB 3JCMM 4BT3A 4X1YA 2FGYA 3V4DA 4U39A 3CC7F 3RYCA 4I50B 4EB6A 3K0TA 3N2KB 4ZI7B 4X1KA 1T0AA 1VK3A 3I7TA 3KE1A 4F6RA 5LYJA 3F0FA 2CHSA 3RYHA 3V7QA 5FJ4C 5G4UC 3NVIB 2I6RA 3LWRC 3FD6A 3JAWA 1YJ9F 3VMFB 1Z5VA 3IEQA 3JASB 4C82A 3D00A 3C8LA 1ONIA 5IYZA 1UFYA 1RA4A 3E20B 4O4HA 3K14A 4B45A 2HS4A 4NWOB 3ESJA 1Q8RA 3K2XA 2LBXA 4DXDA 1XRGA 3UT5B 1XHOA 3JALB 3RYFA 5IJ0B 5KMGA 3J7AR 4C81A 1SA0A 1QD9A 1Q82H 1NJIH 3E22A 4FFBA 4TZZA 1W40A 3OONA 1W55A 4B46A 3WGMA 4IIJB 3CCQF 2VGNA 3WJQA 2BTOA 4O4IB 3DC2A 4G4WA 3HKCB 3G4SF 3S0WA 5LA6A 4NUTA 4TUYA 3MBMA 2BTUA 1NQ3A 5B8FA 4ZOLA 5GONB 2WALA 3O85A 1KNJA 3FPIA 4RHAA 3VIUA 3VYTC 3P4EA 5HY4A 5JCOA 3WGKA 4HNAB 1VQ8F 1GO1A 3SIUA 2OTJF 2AIFA 1IPAA 1IV2A 4O4LA 4O2BB 3LWVC 1X52A 4YJ3A 5GINC 2HVYD 4TV9A 4BT7A 1U3PA 2UYNA 3JAKB 4O4JB 2HQSC 4WBNB 2H6LA 3QUWA 4TV8B 3LFOA 3RYIA 5HWEA 4YJ2B 5ITZB 3D01A 3BYQA 3CPQA 2IAFA 3CCSF 3J81M 4ZHQA 2HP3A 3EORA 3OBYA 2HRUA 5HXZA 3VYSC 1KC8H 3D54A 1YI2F 1FFXA 5C8YB 1K9MH 1X7PA 1U43A 2ZVYA 1W42A 4C8IA 2B33A 5EWRA 2PMPA 1Q86H 2ZAUA 1VQ5F 4G4ZA 1W5FA 4BW0B 2OTMA 1T0KB 2UYKA 1VQVA 1FSZA 2DYYA 2K1SA 3R0PA 5LP6B 1TUBA 3IR9A 4BY9D 1VQPF 3N4ZA 5EZYB 1CN7A 2GZLA 2P6YA 4BT6A 3RA6A 2V9YA 2UYPA 1W2BF 3C9RA 3CYPB 1Z5WA 5BMVB 3JATA 3PAFA 4I4TB 3CCVF 1H48A 5EO3A 2QEXF 3HKDA 3M1XA 3VOBA 2LBTA 1JFFA 4X1YB 3K12A 3L7QA 3RYCB 4KWEA 3CCMF 3C9TA 4EB6B 3HKBA 4I55A 3F6MA 3I3FA 3Q8HA 4X1KB 4F6RB 5LYJB 2RHHA 4C8EA 2OZBA 3WGNA 3LWOC 1OAPA 3RYHB 1KNKA 3KJKA 3CCJF 3ON1A 3HTNA 5J2TA 1RLUA 3FFMA 3N4YA 3JAWB 1VQNF 2QI2A 2VGMA 2PHNA 2HX0A 3S03A 4C8GA 1COMA 1XBIA 3M4SA 5IYZB 3CMAF 1N8RH 2R751 3HKEA 2N48A 1YJWF 1M1KH 3JVHA 4O4HB 4X1IA 4LCKA 2CWJA 3S02A 3NVKE 3RYFB 5KMGB 3CG6A 4BVTA 5DCVA 1SA0B 2L26A 2KTUA 5JQGA 4RQOA 5J2UA 4LNUA 4U3JA 4IHJA 3E22B 4FFBB 4R40B 5CA1A 1YITF 4ZHVA 1Q81H 4BVSA 3LYBA 3F0GA 3ZO8A 5JVDA 3GHZA 5LA6B 1W581 4TUYB 3QHDA 2R6R1 3E1YA 1VQ7F 1QU9A 4ZOLB 2H8EA 2Z01A 1DT9A 4M8IA 3C9SA 5JH7A 2RHLA 3LWQC 3KHNA 3C9UA 3TD5A 3CC4F 3LWPC 5LXTA 3I56F 4O4LB 5CB4A 5GIPC 1JN1A 1VQMF 4G88A 2AIZP 5IT9M 4YJ3B 5GIOC 3WGLA 4BT2A 2EWCA 4TV9B 3ELCA 2QA4F 2UYNB 1KQSF 4E6EA 1SZQA 3KJJA 1RQ2A 3RYIB 4BT5A 1CLIA 1GZ0A 1FNKA 3V3TA 3CMEF 1VQ6F 1VQLF 3HAXD 2CSLA 1Q7YH 4EI8A 3CCUF 1YJNF 3P0ZA 1U3LA 4ZHQB 4O2AA 3OW2F 1U40A 3NK6A 3PLAC 5KX5A 1RLGA 3LDTA 1FFXB 3JARA 2GVIA 5HY2A 3FBAA 2HP0A 1W5EA 2VAWA 2RHJA 3AGKA 3VO8A 1JD1A 4ZHWA 2ZF8A 1QAHA 3VTIC 1JY8A 4X20A 1PXWA 1TUBB 3ZOPA 1GO0A 2DT4A 1M90H 2BTQB 5HY1A 1J7HA 2BO1A 2Q1YA 3JATB 4XCQA 3WXMB 3FD5A 1IV4A 2FC3A 3I55F 4C4WC 1X7OA 3HKDB 3VCZA 5EB1B 4DRXA 5IJ9A 5LOVA 1JFFB 2Z1FA 2HS3A 3S06A 5G4VC 5MN5A 2W8BC 1W5AA 1TVKA 3HKBB 4I55B 1KD1H 2ALEA 3F0EA 2Q1XA 4BT4A 5FNVA 3N2GA 2KG4A 1YHQF 2IG8A 5J2TB 3QTYA 3VI6A 2RHOA 3LMEA 2KGWA 4I50A 2Z1UA 4G4YA
chains in the Genus database with same CATH topology
1UI9A 1JD1A 3KJJA 2UYKA 3D01A 4NWOB 3VCZA 1QU9A 2DYYA 1QAHA 1FNJA 1XRGA 3K12A 1FNKA 2CWJA 3K0TA 3L7QA 1XHOA 2CW4A 5HP8A 3R0PA 3I7TA 2CSLA 3I3FA 2CHSA 1ODEA 1QD9A 3ZOPA 5HP7A 2CVLA 3KJKA 3ZP4A 3ZP7A 2UYPA 1J7HA 1DBFA 2IG8A 1PF5A 1ONIA 2B33A 2UYNA 3MQWA 2EWCA 4ZK7A 1UFYA 3GTZA 3LYBA 3ZO8A 1COMA 3LMEA 3M4SA 2CHTA 2UYNB 1X25A 3M1XA 3QUWA 1NQ3A 2OTMA 3V4DA 2UYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UI9 A;  1JD1 A;  3KJJ A;  2UYK A;  3D01 A;  4NWO B;  3VCZ A;  1QU9 A;  2DYY A;  1QAH A;  1FNJ A;  1XRG A;  3K12 A;  1FNK A;  2CWJ A;  3K0T A;  3L7Q A;  1XHO A;  2CW4 A;  5HP8 A;  3R0P A;  3I7T A;  2CSL A;  3I3F A;  2CHS A;  1ODE A;  1QD9 A;  3ZOP A;  5HP7 A;  2CVL A;  3KJK A;  3ZP4 A;  3ZP7 A;  2UYP A;  1J7H A;  1DBF A;  2IG8 A;  1PF5 A;  1ONI A;  2B33 A;  2UYN A;  3MQW A;  2EWC A;  4ZK7 A;  1UFY A;  3GTZ A;  3LYB A;  3ZO8 A;  1COM A;  3LME A;  3M4S A;  2CHT A;  2UYN B;  1X25 A;  3M1X A;  3QUW A;  1NQ3 A;  2OTM A;  3V4D A;  2UYJ A; 
#chains in the Genus database with same CATH topology
 1UI9 A;  1R1M A;  3N2K A;  4G4V A;  4ZI7 A;  4BVR A;  3HKE B;  3KIZ A;  3M84 A;  3RA5 A;  2MQE A;  4X1I B;  2YYE A;  2YXZ A;  2OHW A;  5HY0 A;  1ZWZ A;  2AMT A;  3G6E F;  4X3M A;  5LP6 C;  3JAS A;  2F9Z C;  3MCA B;  3WJR A;  2VXY A;  2CZW A;  5EIB D;  2QTP A;  5J2U B;  5JQG B;  2OTL F;  4BVQ A;  4LNU B;  4U3J B;  4IHJ B;  1OFU A;  2G9I A;  5CA1 B;  3MDO A;  3ERN A;  3F0D A;  1RQ7 A;  1H47 A;  2GLZ A;  3CB2 A;  2Z1T A;  1IV3 A;  2IQQ A;  3UT5 A;  5JVD B;  3JAL A;  5IJ0 A;  1SDS A;  2LBW A;  1ODE A;  5JH7 B;  3JAM M;  4IIJ A;  4B62 A;  4O4I A;  3T80 A;  1QVF F;  2I6D A;  1H7M A;  3P10 A;  3HKC A;  2VAP A;  5LXT B;  5CB4 B;  1XV2 A;  4ZK7 A;  3CPW F;  5GON A;  3TD3 A;  1X25 A;  3VOA A;  2ZOD A;  3TD4 A;  4EI7 A;  1JJ2 F;  3WGJ A;  1FNJ A;  1W3E X;  3WPW A;  4HNA A;  4B5C A;  5HP8 A;  1W57 A;  1YIJ F;  3MCQ A;  1W5B A;  3IEW A;  4ZHY B;  1VQ9 F;  2LCA A;  3HWU A;  4O2B A;  3CCE F;  3V7E A;  4ERH A;  3IKE A;  3NMU C;  4PWT A;  5EB0 A;  3JAK A;  4O2A B;  1IV1 A;  5GAP K;  4O4J A;  5KX5 B;  4WBN A;  4TV8 A;  3G71 F;  5HXU A;  1CK2 A;  2HS0 A;  3IKF A;  3JAR B;  4X3L A;  3GYQ A;  5ITZ A;  4YJ2 A;  5FLX M;  2UYJ A;  5MN4 A;  1NMU B;  1GX1 A;  2HP0 B;  3RE3 A;  3HJW C;  3CCR F;  2CW4 A;  1QVG F;  3SIV A;  2ZOV A;  3DDN A;  3NK7 A;  3CCL F;  3OBW A;  4X20 B;  1W41 A;  5C8Y A;  3WJP A;  1E7K A;  3J80 M;  5EIB C;  2H8C A;  5JCO C;  1W59 A;  3CYQ A;  3IMP A;  1K73 H;  3MQW A;  3GTZ A;  2CHT A;  2ZVZ A;  1VQO F;  5GAN K;  1YQN A;  2NMU A;  2RB9 A;  4NQ3 A;  5LP6 A;  2VAM A;  2Z1E A;  3B6N A;  4G4X A;  5EZY A;  2JNB A;  4DRX B;  3U0O A;  4EI9 A;  5IJ9 B;  5LOV B;  1VH8 A;  5CA0 A;  3S0Y A;  2HRY A;  5HP7 A;  5MN6 A;  5CA0 B;  1K8A H;  1VQ4 F;  2CVL A;  2UZH A;  5AVM A;  2KTV A;  3ZP4 A;  1TVK B;  3ZP7 A;  1S72 F;  5BMV A;  3WPX A;  5A2Q M;  1VHA A;  3CD6 F;  3VYU C;  1DBF A;  4I4T A;  3S0H A;  5FNV B;  1PF5 A;  1VQK F;  3N2G B;  5EYP A;  1YGY A;  3CC2 F;  3CXC F;  5EAZ A;  5EYP B;  3JCM M;  4BT3 A;  4X1Y A;  2FGY A;  3V4D A;  4U39 A;  3CC7 F;  3RYC A;  4I50 B;  4EB6 A;  3K0T A;  3N2K B;  4ZI7 B;  4X1K A;  1T0A A;  1VK3 A;  3I7T A;  3KE1 A;  4F6R A;  5LYJ A;  3F0F A;  2CHS A;  3RYH A;  3V7Q A;  5FJ4 C;  5G4U C;  3NVI B;  2I6R A;  3LWR C;  3FD6 A;  3JAW A;  1YJ9 F;  3VMF B;  1Z5V A;  3IEQ A;  3JAS B;  4C82 A;  3D00 A;  3C8L A;  1ONI A;  5IYZ A;  1UFY A;  1RA4 A;  3E20 B;  4O4H A;  3K14 A;  4B45 A;  2HS4 A;  4NWO B;  3ESJ A;  1Q8R A;  3K2X A;  2LBX A;  4DXD A;  1XRG A;  3UT5 B;  1XHO A;  3JAL B;  3RYF A;  5IJ0 B;  5KMG A;  3J7A R;  4C81 A;  1SA0 A;  1QD9 A;  1Q82 H;  1NJI H;  3E22 A;  4FFB A;  4TZZ A;  1W40 A;  3OON A;  1W55 A;  4B46 A;  3WGM A;  4IIJ B;  3CCQ F;  2VGN A;  3WJQ A;  2BTO A;  4O4I B;  3DC2 A;  4G4W A;  3HKC B;  3G4S F;  3S0W A;  5LA6 A;  4NUT A;  4TUY A;  3MBM A;  2BTU A;  1NQ3 A;  5B8F A;  4ZOL A;  5GON B;  2WAL A;  3O85 A;  1KNJ A;  3FPI A;  4RHA A;  3VIU A;  3VYT C;  3P4E A;  5HY4 A;  5JCO A;  3WGK A;  4HNA B;  1VQ8 F;  1GO1 A;  3SIU A;  2OTJ F;  2AIF A;  1IPA A;  1IV2 A;  4O4L A;  4O2B B;  3LWV C;  1X52 A;  4YJ3 A;  5GIN C;  2HVY D;  4TV9 A;  4BT7 A;  1U3P A;  2UYN A;  3JAK B;  4O4J B;  2HQS C;  4WBN B;  2H6L A;  3QUW A;  4TV8 B;  3LFO A;  3RYI A;  5HWE A;  4YJ2 B;  5ITZ B;  3D01 A;  3BYQ A;  3CPQ A;  2IAF A;  3CCS F;  3J81 M;  4ZHQ A;  2HP3 A;  3EOR A;  3OBY A;  2HRU A;  5HXZ A;  3VYS C;  1KC8 H;  3D54 A;  1YI2 F;  1FFX A;  5C8Y B;  1K9M H;  1X7P A;  1U43 A;  2ZVY A;  1W42 A;  4C8I A;  2B33 A;  5EWR A;  2PMP A;  1Q86 H;  2ZAU A;  1VQ5 F;  4G4Z A;  1W5F A;  4BW0 B;  2OTM A;  1T0K B;  2UYK A;  1VQV A;  1FSZ A;  2DYY A;  2K1S A;  3R0P A;  5LP6 B;  1TUB A;  3IR9 A;  4BY9 D;  1VQP F;  3N4Z A;  5EZY B;  1CN7 A;  2GZL A;  2P6Y A;  4BT6 A;  3RA6 A;  2V9Y A;  2UYP A;  1W2B F;  3C9R A;  3CYP B;  1Z5W A;  5BMV B;  3JAT A;  3PAF A;  4I4T B;  3CCV F;  1H48 A;  5EO3 A;  2QEX F;  3HKD A;  3M1X A;  3VOB A;  2LBT A;  1JFF A;  4X1Y B;  3K12 A;  3L7Q A;  3RYC B;  4KWE A;  3CCM F;  3C9T A;  4EB6 B;  3HKB A;  4I55 A;  3F6M A;  3I3F A;  3Q8H A;  4X1K B;  4F6R B;  5LYJ B;  2RHH A;  4C8E A;  2OZB A;  3WGN A;  3LWO C;  1OAP A;  3RYH B;  1KNK A;  3KJK A;  3CCJ F;  3ON1 A;  3HTN A;  5J2T A;  1RLU A;  3FFM A;  3N4Y A;  3JAW B;  1VQN F;  2QI2 A;  2VGM A;  2PHN A;  2HX0 A;  3S03 A;  4C8G A;  1COM A;  1XBI A;  3M4S A;  5IYZ B;  3CMA F;  1N8R H;  2R75 1;  3HKE A;  2N48 A;  1YJW F;  1M1K H;  3JVH A;  4O4H B;  4X1I A;  4LCK A;  2CWJ A;  3S02 A;  3NVK E;  3RYF B;  5KMG B;  3CG6 A;  4BVT A;  5DCV A;  1SA0 B;  2L26 A;  2KTU A;  5JQG A;  4RQO A;  5J2U A;  4LNU A;  4U3J A;  4IHJ A;  3E22 B;  4FFB B;  4R40 B;  5CA1 A;  1YIT F;  4ZHV A;  1Q81 H;  4BVS A;  3LYB A;  3F0G A;  3ZO8 A;  5JVD A;  3GHZ A;  5LA6 B;  1W58 1;  4TUY B;  3QHD A;  2R6R 1;  3E1Y A;  1VQ7 F;  1QU9 A;  4ZOL B;  2H8E A;  2Z01 A;  1DT9 A;  4M8I A;  3C9S A;  5JH7 A;  2RHL A;  3LWQ C;  3KHN A;  3C9U A;  3TD5 A;  3CC4 F;  3LWP C;  5LXT A;  3I56 F;  4O4L B;  5CB4 A;  5GIP C;  1JN1 A;  1VQM F;  4G88 A;  2AIZ P;  5IT9 M;  4YJ3 B;  5GIO C;  3WGL A;  4BT2 A;  2EWC A;  4TV9 B;  3ELC A;  2QA4 F;  2UYN B;  1KQS F;  4E6E A;  1SZQ A;  3KJJ A;  1RQ2 A;  3RYI B;  4BT5 A;  1CLI A;  1GZ0 A;  1FNK A;  3V3T A;  3CME F;  1VQ6 F;  1VQL F;  3HAX D;  2CSL A;  1Q7Y H;  4EI8 A;  3CCU F;  1YJN F;  3P0Z A;  1U3L A;  4ZHQ B;  4O2A A;  3OW2 F;  1U40 A;  3NK6 A;  3PLA C;  5KX5 A;  1RLG A;  3LDT A;  1FFX B;  3JAR A;  2GVI A;  5HY2 A;  3FBA A;  2HP0 A;  1W5E A;  2VAW A;  2RHJ A;  3AGK A;  3VO8 A;  1JD1 A;  4ZHW A;  2ZF8 A;  1QAH A;  3VTI C;  1JY8 A;  4X20 A;  1PXW A;  1TUB B;  3ZOP A;  1GO0 A;  2DT4 A;  1M90 H;  2BTQ B;  5HY1 A;  1J7H A;  2BO1 A;  2Q1Y A;  3JAT B;  4XCQ A;  3WXM B;  3FD5 A;  1IV4 A;  2FC3 A;  3I55 F;  4C4W C;  1X7O A;  3HKD B;  3VCZ A;  5EB1 B;  4DRX A;  5IJ9 A;  5LOV A;  1JFF B;  2Z1F A;  2HS3 A;  3S06 A;  5G4V C;  5MN5 A;  2W8B C;  1W5A A;  1TVK A;  3HKB B;  4I55 B;  1KD1 H;  2ALE A;  3F0E A;  2Q1X A;  4BT4 A;  5FNV A;  3N2G A;  2KG4 A;  1YHQ F;  2IG8 A;  5J2T B;  3QTY A;  3VI6 A;  2RHO A;  3LME A;  2KGW A;  4I50 A;  2Z1U A;  4G4Y A; 
#chains in the Genus database with same CATH homology
 1UI9 A;  1JD1 A;  3KJJ A;  2UYK A;  3D01 A;  4NWO B;  3VCZ A;  1QU9 A;  2DYY A;  1QAH A;  1FNJ A;  1XRG A;  3K12 A;  1FNK A;  2CWJ A;  3K0T A;  3L7Q A;  1XHO A;  2CW4 A;  5HP8 A;  3R0P A;  3I7T A;  2CSL A;  3I3F A;  2CHS A;  1ODE A;  1QD9 A;  3ZOP A;  5HP7 A;  2CVL A;  3KJK A;  3ZP4 A;  3ZP7 A;  2UYP A;  1J7H A;  1DBF A;  2IG8 A;  1PF5 A;  1ONI A;  2B33 A;  2UYN A;  3MQW A;  2EWC A;  4ZK7 A;  1UFY A;  3GTZ A;  3LYB A;  3ZO8 A;  1COM A;  3LME A;  3M4S A;  2CHT A;  2UYN B;  1X25 A;  3M1X A;  3QUW A;  1NQ3 A;  2OTM A;  3V4D A;  2UYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...