3GTZA

Crystal structure of a putative translation initiation inhibitor from salmonella typhimurium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SLSIVRIDAEDRWSDVVIYNNTLWYTGVPENLDADAFEQTANTLAQIDAVLEKQGSSKSRILDATIFLSDKADFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKYKVEIKIVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative translation initiation inhibitor
publication title Crystal structure of a putative translation initiation inhibitor from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3gtzA00
2OTMA 3M1XA 2UYNA 3GTZA 1QD9A 3R0PA 3I7TA 3KJJA 2CHTA 3QUWA 1NQ3A 1J7HA 3MQWA 1FNKA 2UYKA 3K12A 1QU9A 1XRGA 1JD1A 1COMA 1ONIA 3D01A 3K0TA 1UI9A 5HP8A 1FNJA 2UYJA 3ZO8A 2B33A 5HP7A 1UFYA 3LYBA 3M4SA 3KJKA 1DBFA 2UYNB 4NWOB 3L7QA 3V4DA 2CSLA 2UYPA 2DYYA 3VCZA 2CWJA 2EWCA 3ZP4A 3ZOPA 3I3FA 1XHOA 2IG8A 3ZP7A 4ZK7A 2CVLA 2CHSA 3LMEA 1QAHA 1X25A 2CW4A 1ODEA 1PF5A
chains in the Genus database with same CATH superfamily
5FNVB 1YIJF 4O4LB 2CHTA 1J7HA 5JQGB 3E1YA 4TUYA 1VQ8F 5CA1A 1R1MA 3AGKA 4U39A 3WGNA 4ZHQB 3J7AR 3MBMA 3RYHB 4M8IA 3B6NA 3S0WA 5GAPK 2Z01A 3L7QA 2CSLA 2LCAA 4IHJA 5LA6A 2EWCA 3CCRF 1VQOF 5JH7A 4ZOLB 5DCVA 1KNKA 3CC4F 3CCQF 3JAWB 5IT9M 1GO1A 3PLAC 4TZZA 5ITZA 4ERHA 2ALEA 1TVKB 3IKEA 5MN6A 3VOBA 3JALA 5BMVB 3IMPA 5GIOC 2FC3A 5HXUA 4O4JA 1JD1A 3FD5A 4BVSA 4BT4A 1W5EA 4B5CA 3JASB 4NWOB 3KIZA 1Q8RA 4O4HB 3IEQA 4X20B 3CCSF 5EWRA 3VTIC 3D54A 3MCQA 1SDSA 1RQ2A 5GANK 1CK2A 4I50A 1W59A 3ON1A 4X3LA 3JAKA 3N2GB 3J80M 1CLIA 1XBIA 2BO1A 4X1YB 4ZI7B 2OZBA 4KWEA 5C8YB 1NJIH 4PWTA 3J81M 4BT6A 4DRXA 5HP7A 1W41A 5A2QM 3K14A 1Q86H 5B8FA 2VGNA 3CMAF 3CXCF 1DT9A 3JATB 3QHDA 1VK3A 2IG8A 5LP6B 3V7EA 2NMUA 4YJ2A 3I56F 1VQ9F 2BTOA 4I4TA 4EI9A 1ODEA 2OTMA 4NUTA 2K1SA 2PMPA 3IKFA 5KMGA 2VGMA 1VQ5F 2Q1XA 5LOVA 3OW2F 2KG4A 1OFUA 5JVDA 3KJKA 5IYZB 2H8EA 5GINC 4WBNA 1GO0A 5FNVA 4EI8A 1S72F 3WPWA 3FPIA 5JQGA 1H7MA 4X1KB 3DC2A 1FSZA 4EB6B 3HAXD 5IJ0A 3V4DA 1YGYA 4YJ3A 5HXZA 3RYHA 3CPWF 1VQ7F 1W57A 1Z5WA 3F6MA 1N8RH 3HKEB 3JCMM 4BVRA 1IV3A 1X7PA 3WJPA 5KX5B 1JY8A 1VH8A 3OBYA 5CA0B 1W5FA 3F0EA 1W5AA 4O2AB 5BMVA 3JARB 3CPQA 2I6RA 3FD6A 3NMUC 1FNJA 3O85A 1KD1H 3F0DA 3VMFB 4LNUB 2AIFA 3JASA 3M1XA 2GZLA 3GTZA 2AMTA 3IR9A 3MQWA 1TUBB 5GONB 2YXZA 3RYCA 3WGJA 4XCQA 3JVHA 5CB4A 2B33A 3CCMF 5EZYA 3VYSC 5J2TB 1YJWF 1RQ7A 2QEXF 1U43A 3HTNA 3DDNA 4ZI7A 5C8YA 5EAZA 4BT7A 4IIJB 2CVLA 3C8LA 4ZHYB 5LYJA 3C9UA 3NK6A 3CC7F 1JFFA 1QVGF 4RHAA 3N2KB 3JATA 4B45A 2HS4A 4TV9A 3FFMA 3PAFA 2Z1FA 4O2BA 1T0AA 3F0FA 4C81A 1KNJA 2KTUA 3S0HA 1OAPA 3GHZA 3P10A 5HY4A 3Q8HA 2QI2A 5IJ9A 1YJNF 3ZP4A 4HNAB 1VQ6F 4O4IB 5EYPB 1QAHA 4RQOA 3OONA 2G9IA 1CN7A 5IYZA 3E20B 2Q1YA 2HP3A 1NQ3A 4B62A 3HKDB 2PHNA 3CCVF 1YITF 4X1KA 2ZOVA 4EB6A 3CMEF 4C82A 4G4WA 4G4YA 2DYYA 4TUYB 3KE1A 4F6RB 4E6EA 1FFXB 2H8CA 1KC8H 1IV1A 2RHOA 2KTVA 3WGMA 3V7QA 1X52A 2CZWA 2HP0B 3NK7A 4I55A 3HKEA 3WJQA 1PF5A 1T0KB 5LA6B 3WGLA 3CG6A 1VQLF 3FBAA 2HRYA 5HY2A 3CCUF 2HVYD 5KX5A 5MN5A 4FFBB 4X1IA 1YI2F 3QUWA 2OTLF 4R40B 4X3MA 3CD6F 3OBWA 3S06A 1XRGA 1IPAA 5ITZB 4O2AA 1YJ9F 3JARA 3EORA 1K73H 1NMUB 2IQQA 5J2UB 3IEWA 2WALA 5EB1B 2YYEA 3TD5A 3K2XA 3LDTA 3JAMM 3ZOPA 1YQNA 2GVIA 3I3FA 4O4LA 1GZ0A 4LCKA 3RYIB 2AIZP 2GLZA 3HKCB 3RA6A 2RHLA 3RYFB 3RA5A 4ZHQA 3SIVA 2KGWA 4TV8B 4BW0B 5J2TA 3WGKA 1W581 3BYQA 3WXMB 4I50B 3TD3A 1W5BA 3JAKB 4ZOLA 4EI7A 1VQMF 2P6YA 1YHQF 3ZO8A 2F9ZC 3JAWA 3LYBA 3G6EF 4NQ3A 4BVQA 2BTQB 2Z1EA 2LBWA 2HRUA 3VCZA 1Z5VA 4C8EA 4DRXB 3CCLF 1XHOA 1TVKA 2ZODA 3N2KA 2Z1UA 2I6DA 4U3JB 3UT5B 3CYPB 2CW4A 2H6LA 2ZVZA 1Q7YH 5LP6C 3MCAB 5EB0A 1VQPF 3WJRA 4BVTA 4O4HA 5FLXM 1U40A 1VQVA 4X20A 5HP8A 3U0OA 5EYPA 2VAWA 3LWOC 3CCJF 3VO8A 4C8IA 3ERNA 2UYPA 3HWUA 5LXTB 3N2GA 3VI6A 2OHWA 5JCOC 1VHAA 2VAPA 3VYTC 4X1YA 1SZQA 4G88A 2HQSC 2ZF8A 3F0GA 4G4ZA 2FGYA 3KHNA 3HKDA 4WBNB 3TD4A 1RA4A 3ELCA 1QD9A 3S0YA 3I7TA 3HKBB 4F6RA 1K8AH 1FFXA 1H47A 5IJ0B 3E22B 1PXWA 5LP6A 4YJ3B 2HP0A 2V9YA 3CB2A 4B46A 2UYNB 2MQEA 2RHHA 4FFBA 3N4YA 4G4XA 2ZVYA 2Z1TA 3RE3A 3GYQA 1SA0B 1W3EX 5JCOA 1VQNF 1E7KA 3CYQA 4G4VA 5J2UA 3SIUA 1JN1A 2LBXA 2UYKA 4ZHVA 3V3TA 3LWPC 2VAMA 3D01A 4BT5A 2UYJA 3RYIA 1UFYA 1DBFA 2QTPA 3HKCA 2HS0A 3S02A 3RYFA 2HX0A 3S03A 3MDOA 3RYCB 5HY1A 2IAFA 4TV8A 5AVMA 1W42A 1GX1A 3LFOA 5CB4B 5CA1B 2LBTA 5EZYB 3VYUC 1JJ2F 4IHJB 4BT2A 5G4UC 5JH7B 5MN4A 1M1KH 4DXDA 5CA0A 3K12A 5LYJB 1QVFF 4U3JA 2R751 1JFFB 3P0ZA 1VQ4F 1IV4A 3UT5A 3P4EA 3LWQC 3T80A 3JALB 1H48A 2QA4F 3WPXA 4LNUA 4TV9B 4O4JB 5HWEA 2R6R1 5EIBD 4O2BB 3ZP7A 1RLGA 3LMEA 1TUBA 3HJWC 5GONA 2UZHA 3M84A 2HS3A 5IJ9B 3G4SF 5G4VC 3R0PA 5EIBC 3KJJA 1RLUA 1M90H 5LXTA 3CC2F 2OTJF 1FNKA 1QU9A 5GIPC 1COMA 1VQKF 3C9SA 1K9MH 3M4SA 4IIJA 5FJ4C 2RB9A 1Q81H 3C9RA 1KQSF 2CWJA 1W55A 3VOAA 3HKBA 5EO3A 3VIUA 1U3LA 4C8GA 3C9TA 3E22A 2L26A 3ESJA 2BTUA 4BY9D 4ZHWA 2JNBA 2UYNA 1U3PA 2RHJA 5HY0A 4BT3A 4I55B 4YJ2B 3G71F 4HNAA 4I4TB 1ONIA 3K0TA 1IV2A 2VXYA 1UI9A 2W8BC 3N4ZA 2ZAUA 4O4IA 2N48A 3I55F 3D00A 1W40A 1SA0A 1ZWZA 4X1IB 5KMGB 3NVKE 3LWRC 1W2BF 3LWVC 3CCEF 5LOVB 1X7OA 4C4WC 4ZK7A 1XV2A 3NVIB 2DT4A 5JVDB 2CHSA 3QTYA 1Q82H 1X25A
chains in the Genus database with same CATH topology
2OTMA 3M1XA 2UYNA 3GTZA 1QD9A 3R0PA 3I7TA 3KJJA 2CHTA 3QUWA 1NQ3A 1J7HA 3MQWA 1FNKA 2UYKA 3K12A 1QU9A 1XRGA 1JD1A 1COMA 1ONIA 3D01A 3K0TA 1UI9A 5HP8A 1FNJA 2UYJA 3ZO8A 2B33A 5HP7A 1UFYA 3LYBA 3M4SA 3KJKA 1DBFA 2UYNB 4NWOB 3L7QA 3V4DA 2CSLA 2UYPA 2DYYA 3VCZA 2CWJA 2EWCA 3ZP4A 3ZOPA 3I3FA 1XHOA 2IG8A 3ZP7A 4ZK7A 2CVLA 2CHSA 3LMEA 1QAHA 1X25A 2CW4A 1ODEA 1PF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTM A;  3M1X A;  2UYN A;  3GTZ A;  1QD9 A;  3R0P A;  3I7T A;  3KJJ A;  2CHT A;  3QUW A;  1NQ3 A;  1J7H A;  3MQW A;  1FNK A;  2UYK A;  3K12 A;  1QU9 A;  1XRG A;  1JD1 A;  1COM A;  1ONI A;  3D01 A;  3K0T A;  1UI9 A;  5HP8 A;  1FNJ A;  2UYJ A;  3ZO8 A;  2B33 A;  5HP7 A;  1UFY A;  3LYB A;  3M4S A;  3KJK A;  1DBF A;  2UYN B;  4NWO B;  3L7Q A;  3V4D A;  2CSL A;  2UYP A;  2DYY A;  3VCZ A;  2CWJ A;  2EWC A;  3ZP4 A;  3ZOP A;  3I3F A;  1XHO A;  2IG8 A;  3ZP7 A;  4ZK7 A;  2CVL A;  2CHS A;  3LME A;  1QAH A;  1X25 A;  2CW4 A;  1ODE A;  1PF5 A; 
#chains in the Genus database with same CATH topology
 5FNV B;  1YIJ F;  4O4L B;  2CHT A;  1J7H A;  5JQG B;  3E1Y A;  4TUY A;  1VQ8 F;  5CA1 A;  1R1M A;  3AGK A;  4U39 A;  3WGN A;  4ZHQ B;  3J7A R;  3MBM A;  3RYH B;  4M8I A;  3B6N A;  3S0W A;  5GAP K;  2Z01 A;  3L7Q A;  2CSL A;  2LCA A;  4IHJ A;  5LA6 A;  2EWC A;  3CCR F;  1VQO F;  5JH7 A;  4ZOL B;  5DCV A;  1KNK A;  3CC4 F;  3CCQ F;  3JAW B;  5IT9 M;  1GO1 A;  3PLA C;  4TZZ A;  5ITZ A;  4ERH A;  2ALE A;  1TVK B;  3IKE A;  5MN6 A;  3VOB A;  3JAL A;  5BMV B;  3IMP A;  5GIO C;  2FC3 A;  5HXU A;  4O4J A;  1JD1 A;  3FD5 A;  4BVS A;  4BT4 A;  1W5E A;  4B5C A;  3JAS B;  4NWO B;  3KIZ A;  1Q8R A;  4O4H B;  3IEQ A;  4X20 B;  3CCS F;  5EWR A;  3VTI C;  3D54 A;  3MCQ A;  1SDS A;  1RQ2 A;  5GAN K;  1CK2 A;  4I50 A;  1W59 A;  3ON1 A;  4X3L A;  3JAK A;  3N2G B;  3J80 M;  1CLI A;  1XBI A;  2BO1 A;  4X1Y B;  4ZI7 B;  2OZB A;  4KWE A;  5C8Y B;  1NJI H;  4PWT A;  3J81 M;  4BT6 A;  4DRX A;  5HP7 A;  1W41 A;  5A2Q M;  3K14 A;  1Q86 H;  5B8F A;  2VGN A;  3CMA F;  3CXC F;  1DT9 A;  3JAT B;  3QHD A;  1VK3 A;  2IG8 A;  5LP6 B;  3V7E A;  2NMU A;  4YJ2 A;  3I56 F;  1VQ9 F;  2BTO A;  4I4T A;  4EI9 A;  1ODE A;  2OTM A;  4NUT A;  2K1S A;  2PMP A;  3IKF A;  5KMG A;  2VGM A;  1VQ5 F;  2Q1X A;  5LOV A;  3OW2 F;  2KG4 A;  1OFU A;  5JVD A;  3KJK A;  5IYZ B;  2H8E A;  5GIN C;  4WBN A;  1GO0 A;  5FNV A;  4EI8 A;  1S72 F;  3WPW A;  3FPI A;  5JQG A;  1H7M A;  4X1K B;  3DC2 A;  1FSZ A;  4EB6 B;  3HAX D;  5IJ0 A;  3V4D A;  1YGY A;  4YJ3 A;  5HXZ A;  3RYH A;  3CPW F;  1VQ7 F;  1W57 A;  1Z5W A;  3F6M A;  1N8R H;  3HKE B;  3JCM M;  4BVR A;  1IV3 A;  1X7P A;  3WJP A;  5KX5 B;  1JY8 A;  1VH8 A;  3OBY A;  5CA0 B;  1W5F A;  3F0E A;  1W5A A;  4O2A B;  5BMV A;  3JAR B;  3CPQ A;  2I6R A;  3FD6 A;  3NMU C;  1FNJ A;  3O85 A;  1KD1 H;  3F0D A;  3VMF B;  4LNU B;  2AIF A;  3JAS A;  3M1X A;  2GZL A;  3GTZ A;  2AMT A;  3IR9 A;  3MQW A;  1TUB B;  5GON B;  2YXZ A;  3RYC A;  3WGJ A;  4XCQ A;  3JVH A;  5CB4 A;  2B33 A;  3CCM F;  5EZY A;  3VYS C;  5J2T B;  1YJW F;  1RQ7 A;  2QEX F;  1U43 A;  3HTN A;  3DDN A;  4ZI7 A;  5C8Y A;  5EAZ A;  4BT7 A;  4IIJ B;  2CVL A;  3C8L A;  4ZHY B;  5LYJ A;  3C9U A;  3NK6 A;  3CC7 F;  1JFF A;  1QVG F;  4RHA A;  3N2K B;  3JAT A;  4B45 A;  2HS4 A;  4TV9 A;  3FFM A;  3PAF A;  2Z1F A;  4O2B A;  1T0A A;  3F0F A;  4C81 A;  1KNJ A;  2KTU A;  3S0H A;  1OAP A;  3GHZ A;  3P10 A;  5HY4 A;  3Q8H A;  2QI2 A;  5IJ9 A;  1YJN F;  3ZP4 A;  4HNA B;  1VQ6 F;  4O4I B;  5EYP B;  1QAH A;  4RQO A;  3OON A;  2G9I A;  1CN7 A;  5IYZ A;  3E20 B;  2Q1Y A;  2HP3 A;  1NQ3 A;  4B62 A;  3HKD B;  2PHN A;  3CCV F;  1YIT F;  4X1K A;  2ZOV A;  4EB6 A;  3CME F;  4C82 A;  4G4W A;  4G4Y A;  2DYY A;  4TUY B;  3KE1 A;  4F6R B;  4E6E A;  1FFX B;  2H8C A;  1KC8 H;  1IV1 A;  2RHO A;  2KTV A;  3WGM A;  3V7Q A;  1X52 A;  2CZW A;  2HP0 B;  3NK7 A;  4I55 A;  3HKE A;  3WJQ A;  1PF5 A;  1T0K B;  5LA6 B;  3WGL A;  3CG6 A;  1VQL F;  3FBA A;  2HRY A;  5HY2 A;  3CCU F;  2HVY D;  5KX5 A;  5MN5 A;  4FFB B;  4X1I A;  1YI2 F;  3QUW A;  2OTL F;  4R40 B;  4X3M A;  3CD6 F;  3OBW A;  3S06 A;  1XRG A;  1IPA A;  5ITZ B;  4O2A A;  1YJ9 F;  3JAR A;  3EOR A;  1K73 H;  1NMU B;  2IQQ A;  5J2U B;  3IEW A;  2WAL A;  5EB1 B;  2YYE A;  3TD5 A;  3K2X A;  3LDT A;  3JAM M;  3ZOP A;  1YQN A;  2GVI A;  3I3F A;  4O4L A;  1GZ0 A;  4LCK A;  3RYI B;  2AIZ P;  2GLZ A;  3HKC B;  3RA6 A;  2RHL A;  3RYF B;  3RA5 A;  4ZHQ A;  3SIV A;  2KGW A;  4TV8 B;  4BW0 B;  5J2T A;  3WGK A;  1W58 1;  3BYQ A;  3WXM B;  4I50 B;  3TD3 A;  1W5B A;  3JAK B;  4ZOL A;  4EI7 A;  1VQM F;  2P6Y A;  1YHQ F;  3ZO8 A;  2F9Z C;  3JAW A;  3LYB A;  3G6E F;  4NQ3 A;  4BVQ A;  2BTQ B;  2Z1E A;  2LBW A;  2HRU A;  3VCZ A;  1Z5V A;  4C8E A;  4DRX B;  3CCL F;  1XHO A;  1TVK A;  2ZOD A;  3N2K A;  2Z1U A;  2I6D A;  4U3J B;  3UT5 B;  3CYP B;  2CW4 A;  2H6L A;  2ZVZ A;  1Q7Y H;  5LP6 C;  3MCA B;  5EB0 A;  1VQP F;  3WJR A;  4BVT A;  4O4H A;  5FLX M;  1U40 A;  1VQV A;  4X20 A;  5HP8 A;  3U0O A;  5EYP A;  2VAW A;  3LWO C;  3CCJ F;  3VO8 A;  4C8I A;  3ERN A;  2UYP A;  3HWU A;  5LXT B;  3N2G A;  3VI6 A;  2OHW A;  5JCO C;  1VHA A;  2VAP A;  3VYT C;  4X1Y A;  1SZQ A;  4G88 A;  2HQS C;  2ZF8 A;  3F0G A;  4G4Z A;  2FGY A;  3KHN A;  3HKD A;  4WBN B;  3TD4 A;  1RA4 A;  3ELC A;  1QD9 A;  3S0Y A;  3I7T A;  3HKB B;  4F6R A;  1K8A H;  1FFX A;  1H47 A;  5IJ0 B;  3E22 B;  1PXW A;  5LP6 A;  4YJ3 B;  2HP0 A;  2V9Y A;  3CB2 A;  4B46 A;  2UYN B;  2MQE A;  2RHH A;  4FFB A;  3N4Y A;  4G4X A;  2ZVY A;  2Z1T A;  3RE3 A;  3GYQ A;  1SA0 B;  1W3E X;  5JCO A;  1VQN F;  1E7K A;  3CYQ A;  4G4V A;  5J2U A;  3SIU A;  1JN1 A;  2LBX A;  2UYK A;  4ZHV A;  3V3T A;  3LWP C;  2VAM A;  3D01 A;  4BT5 A;  2UYJ A;  3RYI A;  1UFY A;  1DBF A;  2QTP A;  3HKC A;  2HS0 A;  3S02 A;  3RYF A;  2HX0 A;  3S03 A;  3MDO A;  3RYC B;  5HY1 A;  2IAF A;  4TV8 A;  5AVM A;  1W42 A;  1GX1 A;  3LFO A;  5CB4 B;  5CA1 B;  2LBT A;  5EZY B;  3VYU C;  1JJ2 F;  4IHJ B;  4BT2 A;  5G4U C;  5JH7 B;  5MN4 A;  1M1K H;  4DXD A;  5CA0 A;  3K12 A;  5LYJ B;  1QVF F;  4U3J A;  2R75 1;  1JFF B;  3P0Z A;  1VQ4 F;  1IV4 A;  3UT5 A;  3P4E A;  3LWQ C;  3T80 A;  3JAL B;  1H48 A;  2QA4 F;  3WPX A;  4LNU A;  4TV9 B;  4O4J B;  5HWE A;  2R6R 1;  5EIB D;  4O2B B;  3ZP7 A;  1RLG A;  3LME A;  1TUB A;  3HJW C;  5GON A;  2UZH A;  3M84 A;  2HS3 A;  5IJ9 B;  3G4S F;  5G4V C;  3R0P A;  5EIB C;  3KJJ A;  1RLU A;  1M90 H;  5LXT A;  3CC2 F;  2OTJ F;  1FNK A;  1QU9 A;  5GIP C;  1COM A;  1VQK F;  3C9S A;  1K9M H;  3M4S A;  4IIJ A;  5FJ4 C;  2RB9 A;  1Q81 H;  3C9R A;  1KQS F;  2CWJ A;  1W55 A;  3VOA A;  3HKB A;  5EO3 A;  3VIU A;  1U3L A;  4C8G A;  3C9T A;  3E22 A;  2L26 A;  3ESJ A;  2BTU A;  4BY9 D;  4ZHW A;  2JNB A;  2UYN A;  1U3P A;  2RHJ A;  5HY0 A;  4BT3 A;  4I55 B;  4YJ2 B;  3G71 F;  4HNA A;  4I4T B;  1ONI A;  3K0T A;  1IV2 A;  2VXY A;  1UI9 A;  2W8B C;  3N4Z A;  2ZAU A;  4O4I A;  2N48 A;  3I55 F;  3D00 A;  1W40 A;  1SA0 A;  1ZWZ A;  4X1I B;  5KMG B;  3NVK E;  3LWR C;  1W2B F;  3LWV C;  3CCE F;  5LOV B;  1X7O A;  4C4W C;  4ZK7 A;  1XV2 A;  3NVI B;  2DT4 A;  5JVD B;  2CHS A;  3QTY A;  1Q82 H;  1X25 A; 
#chains in the Genus database with same CATH homology
 2OTM A;  3M1X A;  2UYN A;  3GTZ A;  1QD9 A;  3R0P A;  3I7T A;  3KJJ A;  2CHT A;  3QUW A;  1NQ3 A;  1J7H A;  3MQW A;  1FNK A;  2UYK A;  3K12 A;  1QU9 A;  1XRG A;  1JD1 A;  1COM A;  1ONI A;  3D01 A;  3K0T A;  1UI9 A;  5HP8 A;  1FNJ A;  2UYJ A;  3ZO8 A;  2B33 A;  5HP7 A;  1UFY A;  3LYB A;  3M4S A;  3KJK A;  1DBF A;  2UYN B;  4NWO B;  3L7Q A;  3V4D A;  2CSL A;  2UYP A;  2DYY A;  3VCZ A;  2CWJ A;  2EWC A;  3ZP4 A;  3ZOP A;  3I3F A;  1XHO A;  2IG8 A;  3ZP7 A;  4ZK7 A;  2CVL A;  2CHS A;  3LME A;  1QAH A;  1X25 A;  2CW4 A;  1ODE A;  1PF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...