3GTZA

Crystal structure of a putative translation initiation inhibitor from salmonella typhimurium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SLSIVRIDAEDRWSDVVIYNNTLWYTGVPENLDADAFEQTANTLAQIDAVLEKQGSSKSRILDATIFLSDKADFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKYKVEIKIVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative translation initiation inhibitor from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Structural genomics, unknown function
molecule keywords Putative translation initiation inhibitor
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3gtzA00
2UYJA 3QUWA 1QD9A 1DBFA 3K12A 2CHTA 2UYPA 1PF5A 2UYNA 4ZK7A 1COMA 3D01A 2DYYA 1FNJA 1XHOA 1UI9A 3L7QA 1FNKA 1J7HA 1QU9A 4NWOB 3LYBA 3R0PA 1X25A 1QAHA 2EWCA 3I3FA 3I7TA 2CW4A 2CWJA 2CHSA 2CSLA 1XRGA 2B33A 5HP7A 1JD1A 2UYKA 1ONIA 2CVLA 3MQWA 3ZP4A 3ZP7A 1ODEA 3K0TA 3GTZA 3KJKA 3ZOPA 1NQ3A 3ZO8A 1UFYA 3VCZA 2IG8A 2UYNB 3KJJA 3M4SA 3V4DA 2OTMA 3LMEA 5HP8A 3M1XA
chains in the Genus database with same CATH superfamily
5EAZA 5B8FA 3V7EA 3VMFB 3CCEF 1W55A 4O4JB 1SZQA 1YITF 4ZHYB 3F0GA 1VQ7F 5EWRA 3N2KA 5CB4A 2Q1YA 3N2KB 1Q8RA 1RA4A 4BVSA 3FD5A 1FSZA 3HKDA 1K9MH 4ZOLA 3P4EA 1VQLF 4C81A 3HAXD 4I50B 4EI7A 2HS4A 3JASB 5EB0A 3RYHB 3KHNA 1H47A 3UT5B 2UYPA 4BT6A 3IMPA 5KX5B 1J7HA 2AIFA 4YJ3A 3JAWB 4TV9A 2VAWA 4I55A 3CC4F 4ERHA 2YYEA 2VAMA 4U39A 4X1KB 1OFUA 2RB9A 2OHWA 2Z1EA 4DRXA 5JQGB 3CCUF 2OTJF 2R6R1 3RYIB 1QVFF 3OBYA 1TVKA 3IR9A 2IG8A 4B45A 4BT3A 5JH7A 4C4WC 3RA5A 1JFFA 4IIJA 5LA6A 3FD6A 3CB2A 3J7AR 3F0FA 3C9TA 2OTLF 1FNJA 1W41A 5BMVB 2PHNA 3S0HA 1M1KH 5LA6B 4BVRA 5HY4A 3S02A 3ELCA 3TD5A 5LP6B 1QAHA 1VQ5F 3KIZA 5J2TB 2K1SA 2HP0B 1Q7YH 5JCOC 3CCJF 3BYQA 3KE1A 1E7KA 2LBTA 3V7QA 3TD3A 2BTOA 2GZLA 3NVKE 4KWEA 1PF5A 3JAWA 4TV9B 5FNVA 3RYFB 3WJQA 3CMAF 1JY8A 1W5EA 5KX5A 5HXUA 2HP0A 2HP3A 5HY1A 5IT9M 1KNJA 4XCQA 2ZVZA 4ZHWA 1NJIH 5LP6A 2FGYA 2HQSC 2LBXA 4LNUB 3HKDB 4B62A 3PAFA 4O4LA 2MQEA 4X1IB 1U3LA 3IKEA 4I4TA 5JH7B 2ZVYA 3P10A 4EI9A 1TVKB 3K12A 1M90H 2Q1XA 3LWVC 1JN1A 5ITZA 4IHJA 3VI6A 2IAFA 1IV2A 1QU9A 2ZF8A 3CCVF 1YJ9F 3LYBA 1YHQF 4G4WA 3J81M 3IKFA 4WBNA 3HKCA 2B33A 4I55B 3JATA 4LCKA 3WGNA 3MQWA 3N4YA 3WPXA 3WGLA 1VQ6F 3K0TA 3MCQA 3VIUA 3ZO8A 3UT5A 2N48A 1W5AA 2GLZA 3ON1A 3VCZA 5KMGB 3VOBA 3RYHA 3V4DA 4F6RB 3M1XA 3NMUC 2UYJA 3E22B 3CPQA 3D00A 3S06A 5JCOA 1GO0A 1KC8H 5CB4B 2RHJA 3HKBB 2VXYA 3EORA 1FFXB 5LXTB 3MCAB 5HY0A 1VK3A 4B46A 1ONIA 2ALEA 3ZOPA 5EIBC 2Z1FA 5GONB 2UYNB 4O4IB 3JVHA 4C8EA 2GVIA 4TV8B 5IYZB 5CA0A 5A2QM 4ZK7A 2PMPA 1YJWF 5EZYA 4ZI7B 2HX0A 5LOVA 1CN7A 1RQ7A 4X1YA 3WXMB 1TUBB 4EB6A 3CCMF 1K8AH 3NK6A 3G4SF 3RA6A 4YJ2A 5GAPK 1VQ8F 3LWOC 3CCLF 5C8YB 3I7TA 2DT4A 5CA1B 4FFBB 2UYKA 4U3JA 2QEXF 1ODEA 4BY9D 5J2UB 4ZHVA 4BW0B 2OZBA 3C9RA 1S72F 3JAKB 4BT2A 3F0EA 2HRUA 4G4XA 1QVGF 2HS3A 4NQ3A 5G4UC 1DBFA 3IEQA 4NUTA 2AMTA 4BT7A 3CXCF 3U0OA 1XBIA 1IPAA 4O2AA 3RE3A 1W40A 3RYCB 4NWOB 1VQOF 1VH8A 3C9UA 3JARA 3E1YA 5IJ9B 4HNAA 1DT9A 5GIPC 5LYJA 2KTUA 2I6RA 3K14A 4PWTA 2BTQB 2YXZA 4HNAB 1UFYA 3JALB 1YIJF 5IJ9A 1VHAA 3LMEA 5IJ0B 1Q81H 2QTPA 1VQ9F 3AGKA 3D54A 1VQ4F 1KD1H 4TUYA 3CC7F 2DYYA 4X20B 1SDSA 3CCSF 1VQKF 3O85A 1YJNF 4G4ZA 1Q86H 4R40B 1VQNF 2I6DA 4X3MA 1U40A 5GINC 3C8LA 3VTIC 4G4YA 3HKEA 5JVDA 5MN5A 3GTZA 3LDTA 4U3JB 3CC2F 1GX1A 3TD4A 5HWEA 1X7PA 3M4SA 3CYPB 4G4VA 1W57A 1IV3A 2KTVA 5IJ0A 3QUWA 3OW2F 2HVYD 3JALA 3N2GB 2Z1TA 1UI9A 1RLGA 3V3TA 3HWUA 3OONA 3LFOA 3WJPA 5LYJB 1X52A 2L26A 2P6YA 1X25A 2VAPA 3FBAA 2CW4A 2CWJA 1JD1A 2H6LA 4O2AB 2UZHA 1Q82H 1RLUA 1W581 3KJJA 5GANK 4BT5A 1VQVA 1FFXA 1KQSF 3NVIB 2G9IA 2H8EA 1QD9A 3HKBA 4O4HA 1W59A 4RQOA 5MN6A 3JAMM 1JJ2F 3DDNA 3MBMA 1U3PA 3WGKA 3L7QA 1NMUB 5J2UA 1SA0B 1Z5VA 1YQNA 4FFBA 1GO1A 2QI2A 4BT4A 3LWQC 5CA1A 1H7MA 4YJ2B 1TUBA 3ZP4A 4EB6B 3S0YA 1K73H 5EYPB 1RQ2A 4G88A 3HJWC 4O2BB 4ZHQB 2JNBA 3QTYA 4O2BA 4ZHQA 3CMEF 3FPIA 4C8IA 5EYPA 2CHTA 2UYNA 4O4IA 3LWPC 2RHLA 3D01A 1XHOA 1T0KB 3CD6F 1T0AA 3G71F 3N2GA 5ITZB 4M8IA 1YGYA 3B6NA 3GHZA 3QHDA 1CLIA 3SIVA 1XRGA 4I4TB 3WGJA 3HKEB 4X1IA 5JVDB 1SA0A 4C8GA 2V9YA 4O4LB 3WPWA 3E22A 2RHHA 2ZAUA 3JCMM 4O4HB 3N4ZA 3M84A 4LNUA 2F9ZC 2OTMA 1OAPA 4F6RA 2BO1A 3WJRA 5FJ4C 3S03A 3CYQA 3VYTC 3RYFA 3S0WA 1W5FA 3JATB 3HKCB 3DC2A 1KNKA 1W42A 2CHSA 1W3EX 2ZODA 3VOAA 3VYUC 2HS0A 2CVLA 3ZP7A 3T80A 3IEWA 4EI8A 3LWRC 4IHJB 2KGWA 1VQPF 1X7OA 1N8RH 3F6MA 3JARB 2AIZP 3F0DA 5HP8A 1ZWZA 1COMA 3ESJA 3RYCA 3VO8A 4DXDA 3P0ZA 5BMVA 2CZWA 1W5BA 1R1MA 2VGMA 3R0PA 3I56F 1JFFB 5AVMA 5LP6C 3OBWA 5HY2A 3SIUA 4X20A 3RYIA 4TUYB 5EIBD 4BVQA 3G6EF 2H8CA 5FNVB 4DRXB 5GIOC 1IV4A 4X1KA 2W8BC 2QA4F 4X3LA 5MN4A 2LBWA 5LOVB 5EZYB 1XV2A 4ZI7A 5IYZA 1FNKA 2RHOA 3GYQA 2WALA 2Z1UA 3VYSC 2BTUA 5CA0B 2IQQA 5J2TA 3ERNA 1U43A 3WGMA 2NMUA 2EWCA 5GONA 3JASA 3HTNA 4I50A 5HP7A 3MDOA 1PXWA 3CG6A 2VGNA 3C9SA 4ZOLB 3CCRF 3Q8HA 5LXTA 1CK2A 2HRYA 1W2BF 3K2XA 4IIJB 5EB1B 1YI2F 5FLXM 5DCVA 3NK7A 5HXZA 3JAKA 5EO3A 4C82A 3CCQF 5G4VC 4O4JA 4B5CA 4BVTA 1Z5WA 1GZ0A 5JQGA 5C8YA 2KG4A 3PLAC 3J80M 3I3FA 5KMGA 2CSLA 4RHAA 4X1YB 2Z01A 4YJ3B 3I55F 3E20B 1H48A 3CPWF 2LCAA 3KJKA 1IV1A 1NQ3A 3FFMA 4E6EA 4WBNB 4TZZA 2FC3A 2R751 4TV8A 1VQMF 2ZOVA
chains in the Genus database with same CATH topology
2UYJA 3QUWA 1QD9A 1DBFA 3K12A 2CHTA 2UYPA 1PF5A 2UYNA 4ZK7A 1COMA 3D01A 2DYYA 1FNJA 1XHOA 1UI9A 3L7QA 1FNKA 1J7HA 1QU9A 4NWOB 3LYBA 3R0PA 1X25A 1QAHA 2EWCA 3I3FA 3I7TA 2CW4A 2CWJA 2CHSA 2CSLA 1XRGA 2B33A 5HP7A 1JD1A 2UYKA 1ONIA 2CVLA 3MQWA 3ZP4A 3ZP7A 1ODEA 3K0TA 3GTZA 3KJKA 3ZOPA 1NQ3A 3ZO8A 1UFYA 3VCZA 2IG8A 2UYNB 3KJJA 3M4SA 3V4DA 2OTMA 3LMEA 5HP8A 3M1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYJ A;  3QUW A;  1QD9 A;  1DBF A;  3K12 A;  2CHT A;  2UYP A;  1PF5 A;  2UYN A;  4ZK7 A;  1COM A;  3D01 A;  2DYY A;  1FNJ A;  1XHO A;  1UI9 A;  3L7Q A;  1FNK A;  1J7H A;  1QU9 A;  4NWO B;  3LYB A;  3R0P A;  1X25 A;  1QAH A;  2EWC A;  3I3F A;  3I7T A;  2CW4 A;  2CWJ A;  2CHS A;  2CSL A;  1XRG A;  2B33 A;  5HP7 A;  1JD1 A;  2UYK A;  1ONI A;  2CVL A;  3MQW A;  3ZP4 A;  3ZP7 A;  1ODE A;  3K0T A;  3GTZ A;  3KJK A;  3ZOP A;  1NQ3 A;  3ZO8 A;  1UFY A;  3VCZ A;  2IG8 A;  2UYN B;  3KJJ A;  3M4S A;  3V4D A;  2OTM A;  3LME A;  5HP8 A;  3M1X A; 
#chains in the Genus database with same CATH topology
 5EAZ A;  5B8F A;  3V7E A;  3VMF B;  3CCE F;  1W55 A;  4O4J B;  1SZQ A;  1YIT F;  4ZHY B;  3F0G A;  1VQ7 F;  5EWR A;  3N2K A;  5CB4 A;  2Q1Y A;  3N2K B;  1Q8R A;  1RA4 A;  4BVS A;  3FD5 A;  1FSZ A;  3HKD A;  1K9M H;  4ZOL A;  3P4E A;  1VQL F;  4C81 A;  3HAX D;  4I50 B;  4EI7 A;  2HS4 A;  3JAS B;  5EB0 A;  3RYH B;  3KHN A;  1H47 A;  3UT5 B;  2UYP A;  4BT6 A;  3IMP A;  5KX5 B;  1J7H A;  2AIF A;  4YJ3 A;  3JAW B;  4TV9 A;  2VAW A;  4I55 A;  3CC4 F;  4ERH A;  2YYE A;  2VAM A;  4U39 A;  4X1K B;  1OFU A;  2RB9 A;  2OHW A;  2Z1E A;  4DRX A;  5JQG B;  3CCU F;  2OTJ F;  2R6R 1;  3RYI B;  1QVF F;  3OBY A;  1TVK A;  3IR9 A;  2IG8 A;  4B45 A;  4BT3 A;  5JH7 A;  4C4W C;  3RA5 A;  1JFF A;  4IIJ A;  5LA6 A;  3FD6 A;  3CB2 A;  3J7A R;  3F0F A;  3C9T A;  2OTL F;  1FNJ A;  1W41 A;  5BMV B;  2PHN A;  3S0H A;  1M1K H;  5LA6 B;  4BVR A;  5HY4 A;  3S02 A;  3ELC A;  3TD5 A;  5LP6 B;  1QAH A;  1VQ5 F;  3KIZ A;  5J2T B;  2K1S A;  2HP0 B;  1Q7Y H;  5JCO C;  3CCJ F;  3BYQ A;  3KE1 A;  1E7K A;  2LBT A;  3V7Q A;  3TD3 A;  2BTO A;  2GZL A;  3NVK E;  4KWE A;  1PF5 A;  3JAW A;  4TV9 B;  5FNV A;  3RYF B;  3WJQ A;  3CMA F;  1JY8 A;  1W5E A;  5KX5 A;  5HXU A;  2HP0 A;  2HP3 A;  5HY1 A;  5IT9 M;  1KNJ A;  4XCQ A;  2ZVZ A;  4ZHW A;  1NJI H;  5LP6 A;  2FGY A;  2HQS C;  2LBX A;  4LNU B;  3HKD B;  4B62 A;  3PAF A;  4O4L A;  2MQE A;  4X1I B;  1U3L A;  3IKE A;  4I4T A;  5JH7 B;  2ZVY A;  3P10 A;  4EI9 A;  1TVK B;  3K12 A;  1M90 H;  2Q1X A;  3LWV C;  1JN1 A;  5ITZ A;  4IHJ A;  3VI6 A;  2IAF A;  1IV2 A;  1QU9 A;  2ZF8 A;  3CCV F;  1YJ9 F;  3LYB A;  1YHQ F;  4G4W A;  3J81 M;  3IKF A;  4WBN A;  3HKC A;  2B33 A;  4I55 B;  3JAT A;  4LCK A;  3WGN A;  3MQW A;  3N4Y A;  3WPX A;  3WGL A;  1VQ6 F;  3K0T A;  3MCQ A;  3VIU A;  3ZO8 A;  3UT5 A;  2N48 A;  1W5A A;  2GLZ A;  3ON1 A;  3VCZ A;  5KMG B;  3VOB A;  3RYH A;  3V4D A;  4F6R B;  3M1X A;  3NMU C;  2UYJ A;  3E22 B;  3CPQ A;  3D00 A;  3S06 A;  5JCO A;  1GO0 A;  1KC8 H;  5CB4 B;  2RHJ A;  3HKB B;  2VXY A;  3EOR A;  1FFX B;  5LXT B;  3MCA B;  5HY0 A;  1VK3 A;  4B46 A;  1ONI A;  2ALE A;  3ZOP A;  5EIB C;  2Z1F A;  5GON B;  2UYN B;  4O4I B;  3JVH A;  4C8E A;  2GVI A;  4TV8 B;  5IYZ B;  5CA0 A;  5A2Q M;  4ZK7 A;  2PMP A;  1YJW F;  5EZY A;  4ZI7 B;  2HX0 A;  5LOV A;  1CN7 A;  1RQ7 A;  4X1Y A;  3WXM B;  1TUB B;  4EB6 A;  3CCM F;  1K8A H;  3NK6 A;  3G4S F;  3RA6 A;  4YJ2 A;  5GAP K;  1VQ8 F;  3LWO C;  3CCL F;  5C8Y B;  3I7T A;  2DT4 A;  5CA1 B;  4FFB B;  2UYK A;  4U3J A;  2QEX F;  1ODE A;  4BY9 D;  5J2U B;  4ZHV A;  4BW0 B;  2OZB A;  3C9R A;  1S72 F;  3JAK B;  4BT2 A;  3F0E A;  2HRU A;  4G4X A;  1QVG F;  2HS3 A;  4NQ3 A;  5G4U C;  1DBF A;  3IEQ A;  4NUT A;  2AMT A;  4BT7 A;  3CXC F;  3U0O A;  1XBI A;  1IPA A;  4O2A A;  3RE3 A;  1W40 A;  3RYC B;  4NWO B;  1VQO F;  1VH8 A;  3C9U A;  3JAR A;  3E1Y A;  5IJ9 B;  4HNA A;  1DT9 A;  5GIP C;  5LYJ A;  2KTU A;  2I6R A;  3K14 A;  4PWT A;  2BTQ B;  2YXZ A;  4HNA B;  1UFY A;  3JAL B;  1YIJ F;  5IJ9 A;  1VHA A;  3LME A;  5IJ0 B;  1Q81 H;  2QTP A;  1VQ9 F;  3AGK A;  3D54 A;  1VQ4 F;  1KD1 H;  4TUY A;  3CC7 F;  2DYY A;  4X20 B;  1SDS A;  3CCS F;  1VQK F;  3O85 A;  1YJN F;  4G4Z A;  1Q86 H;  4R40 B;  1VQN F;  2I6D A;  4X3M A;  1U40 A;  5GIN C;  3C8L A;  3VTI C;  4G4Y A;  3HKE A;  5JVD A;  5MN5 A;  3GTZ A;  3LDT A;  4U3J B;  3CC2 F;  1GX1 A;  3TD4 A;  5HWE A;  1X7P A;  3M4S A;  3CYP B;  4G4V A;  1W57 A;  1IV3 A;  2KTV A;  5IJ0 A;  3QUW A;  3OW2 F;  2HVY D;  3JAL A;  3N2G B;  2Z1T A;  1UI9 A;  1RLG A;  3V3T A;  3HWU A;  3OON A;  3LFO A;  3WJP A;  5LYJ B;  1X52 A;  2L26 A;  2P6Y A;  1X25 A;  2VAP A;  3FBA A;  2CW4 A;  2CWJ A;  1JD1 A;  2H6L A;  4O2A B;  2UZH A;  1Q82 H;  1RLU A;  1W58 1;  3KJJ A;  5GAN K;  4BT5 A;  1VQV A;  1FFX A;  1KQS F;  3NVI B;  2G9I A;  2H8E A;  1QD9 A;  3HKB A;  4O4H A;  1W59 A;  4RQO A;  5MN6 A;  3JAM M;  1JJ2 F;  3DDN A;  3MBM A;  1U3P A;  3WGK A;  3L7Q A;  1NMU B;  5J2U A;  1SA0 B;  1Z5V A;  1YQN A;  4FFB A;  1GO1 A;  2QI2 A;  4BT4 A;  3LWQ C;  5CA1 A;  1H7M A;  4YJ2 B;  1TUB A;  3ZP4 A;  4EB6 B;  3S0Y A;  1K73 H;  5EYP B;  1RQ2 A;  4G88 A;  3HJW C;  4O2B B;  4ZHQ B;  2JNB A;  3QTY A;  4O2B A;  4ZHQ A;  3CME F;  3FPI A;  4C8I A;  5EYP A;  2CHT A;  2UYN A;  4O4I A;  3LWP C;  2RHL A;  3D01 A;  1XHO A;  1T0K B;  3CD6 F;  1T0A A;  3G71 F;  3N2G A;  5ITZ B;  4M8I A;  1YGY A;  3B6N A;  3GHZ A;  3QHD A;  1CLI A;  3SIV A;  1XRG A;  4I4T B;  3WGJ A;  3HKE B;  4X1I A;  5JVD B;  1SA0 A;  4C8G A;  2V9Y A;  4O4L B;  3WPW A;  3E22 A;  2RHH A;  2ZAU A;  3JCM M;  4O4H B;  3N4Z A;  3M84 A;  4LNU A;  2F9Z C;  2OTM A;  1OAP A;  4F6R A;  2BO1 A;  3WJR A;  5FJ4 C;  3S03 A;  3CYQ A;  3VYT C;  3RYF A;  3S0W A;  1W5F A;  3JAT B;  3HKC B;  3DC2 A;  1KNK A;  1W42 A;  2CHS A;  1W3E X;  2ZOD A;  3VOA A;  3VYU C;  2HS0 A;  2CVL A;  3ZP7 A;  3T80 A;  3IEW A;  4EI8 A;  3LWR C;  4IHJ B;  2KGW A;  1VQP F;  1X7O A;  1N8R H;  3F6M A;  3JAR B;  2AIZ P;  3F0D A;  5HP8 A;  1ZWZ A;  1COM A;  3ESJ A;  3RYC A;  3VO8 A;  4DXD A;  3P0Z A;  5BMV A;  2CZW A;  1W5B A;  1R1M A;  2VGM A;  3R0P A;  3I56 F;  1JFF B;  5AVM A;  5LP6 C;  3OBW A;  5HY2 A;  3SIU A;  4X20 A;  3RYI A;  4TUY B;  5EIB D;  4BVQ A;  3G6E F;  2H8C A;  5FNV B;  4DRX B;  5GIO C;  1IV4 A;  4X1K A;  2W8B C;  2QA4 F;  4X3L A;  5MN4 A;  2LBW A;  5LOV B;  5EZY B;  1XV2 A;  4ZI7 A;  5IYZ A;  1FNK A;  2RHO A;  3GYQ A;  2WAL A;  2Z1U A;  3VYS C;  2BTU A;  5CA0 B;  2IQQ A;  5J2T A;  3ERN A;  1U43 A;  3WGM A;  2NMU A;  2EWC A;  5GON A;  3JAS A;  3HTN A;  4I50 A;  5HP7 A;  3MDO A;  1PXW A;  3CG6 A;  2VGN A;  3C9S A;  4ZOL B;  3CCR F;  3Q8H A;  5LXT A;  1CK2 A;  2HRY A;  1W2B F;  3K2X A;  4IIJ B;  5EB1 B;  1YI2 F;  5FLX M;  5DCV A;  3NK7 A;  5HXZ A;  3JAK A;  5EO3 A;  4C82 A;  3CCQ F;  5G4V C;  4O4J A;  4B5C A;  4BVT A;  1Z5W A;  1GZ0 A;  5JQG A;  5C8Y A;  2KG4 A;  3PLA C;  3J80 M;  3I3F A;  5KMG A;  2CSL A;  4RHA A;  4X1Y B;  2Z01 A;  4YJ3 B;  3I55 F;  3E20 B;  1H48 A;  3CPW F;  2LCA A;  3KJK A;  1IV1 A;  1NQ3 A;  3FFM A;  4E6E A;  4WBN B;  4TZZ A;  2FC3 A;  2R75 1;  4TV8 A;  1VQM F;  2ZOV A; 
#chains in the Genus database with same CATH homology
 2UYJ A;  3QUW A;  1QD9 A;  1DBF A;  3K12 A;  2CHT A;  2UYP A;  1PF5 A;  2UYN A;  4ZK7 A;  1COM A;  3D01 A;  2DYY A;  1FNJ A;  1XHO A;  1UI9 A;  3L7Q A;  1FNK A;  1J7H A;  1QU9 A;  4NWO B;  3LYB A;  3R0P A;  1X25 A;  1QAH A;  2EWC A;  3I3F A;  3I7T A;  2CW4 A;  2CWJ A;  2CHS A;  2CSL A;  1XRG A;  2B33 A;  5HP7 A;  1JD1 A;  2UYK A;  1ONI A;  2CVL A;  3MQW A;  3ZP4 A;  3ZP7 A;  1ODE A;  3K0T A;  3GTZ A;  3KJK A;  3ZOP A;  1NQ3 A;  3ZO8 A;  1UFY A;  3VCZ A;  2IG8 A;  2UYN B;  3KJJ A;  3M4S A;  3V4D A;  2OTM A;  3LME A;  5HP8 A;  3M1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...