2OTLF

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2otlF00
3CG6A 1KQSF 3N4YA 3G4SF 3JCMM 3CC4F 1K73H 3PLAC 1PXWA 5IT9M 1K9MH 1Q86H 3LWQC 2HVYD 3V7EA 3N4ZA 1YHQF 3MCAB 1VQPF 1Q81H 3CMAF 2CZWA 2VGMA 3CCQF 3CCMF 2KTUA 3VI6A 3CMEF 2I6DA 2WALA 1KD1H 3E20B 1ZWZA 1M90H 1YJNF 3OBWA 1W41A 4TZZA 3G71F 3HAXD 2LBWA 3CCEF 1YITF 3I55F 5EWRA 1VQ7F 1QVGF 2KG4A 4C4WC 1VQOF 1VQ6F 1W3EX 1X7PA 3LWPC 4X3MA 1CK2A 1GZ0A 3SIUA 3FFMA 1Q82H 3AGKA 1VQ4F 1NMUB 3V7QA 4NUTA 1GO0A 3CCRF 1M1KH 1VQNF 2FC3A 1E7KA 1GO1A 1VQ8F 1JJ2F 3E1YA 4LCKA 1RLGA 5G4VC 5GIPC 2QEXF 4X3LA 2OTLF 2BO1A 1DT9A 3J7AR 3J80M 4BY9D 3LWRC 3J81M 2AIFA 2OZBA 1YJWF 1QVFF 1S72F 5GINC 1N8RH 1YJ9F 1K8AH 1VQKF 3NVIB 3VMFB 3JAMM 3NMUC 5A2QM 3CPQA 3NK6A 1SDSA 3OBYA 1X52A 3RA5A 3CCSF 3OW2F 1NJIH 1T0KB 5FJ4C 1RA4A 3ON1A 3WXMB 5G4UC 1W2BF 3O85A 1VQ5F 1W42A 2JNBA 5DCVA 2VGNA 3LWVC 1YI2F 3RA6A 2OHWA 1H7MA 5EO3A 3IR9A 5GIOC 3NVKE 1VQLF 3G6EF 3CD6F 2LBXA 1X7OA 3CCVF 3HJWC 3LWOC 3I56F 2QA4F 5GANK 4BW0B 1KC8H 3NK7A 5GAPK 3PAFA 2OTJF 3CC2F 3CCUF 2KTVA 3CCLF 1VQMF 3LFOA 3GYQA 3CCJF 1YIJF 1XBIA 3CPWF 1IPAA 1CN7A 3SIVA 2ALEA 1VQ9F 5FLXM 1W40A 3CXCF 2QI2A 1Q7YH 3CC7F
chains in the Genus database with same CATH superfamily
2HS4A 3JCMM 4G4YA 2CW4A 4FFBB 3KJKA 5IT9M 4O4JA 3ZO8A 5LA6B 3LWQC 3V7EA 1Q81H 2HS0A 3CMAF 3C9TA 4X1YA 1W5FA 3KE1A 1OFUA 4O4HA 1NQ3A 2BTOA 3BYQA 3F0GA 2I6DA 3E20B 4ZHWA 4O2BB 2UYPA 5EIBD 3I3FA 1IV4A 4ZOLB 3K12A 1KNJA 3HTNA 3IKEA 3I55F 1FFXA 4O4HB 2UYJA 4BT3A 3V3TA 1X7PA 3LWPC 2CHSA 2Z1FA 1GZ0A 3SIUA 2HX0A 3FFMA 3D01A 3F0FA 5JVDB 1ODEA 2F9ZC 4G4VA 3CCRF 2CSLA 2GVIA 3ERNA 2P6YA 3MCQA 1QAHA 3KIZA 3DC2A 4B5CA 5GIPC 3FPIA 1SZQA 4I50B 4BVRA 1FNJA 5IJ0A 1GX1A 2GZLA 4BVSA 1QVFF 3C9SA 3NVIB 3VMFB 5KX5A 4B62A 3K0TA 1W5AA 5IYZA 2IQQA 4YJ3A 3TD4A 4DXDA 3P4EA 3RA5A 3QUWA 3OW2F 1T0KB 1RA4A 1H48A 3Q8HA 5JVDA 2JNBA 3V4DA 5FNVA 1JFFA 3RYIA 3LWVC 4B46A 1H7MA 5KMGA 3CB2A 3E22A 3IR9A 5GIOC 3RE3A 3S0WA 1TVKA 3CD6F 3WJQA 1X25A 4U3JB 2VXYA 1Q8RA 3B6NA 1R1MA 5J2UB 3CCVF 2CVLA 3T80A 5GONA 2QA4F 3RYHA 3NK7A 4M8IA 2PMPA 2KTVA 3C8LA 3WPXA 2IAFA 1JY8A 3CCJF 4YJ2A 2GLZA 3JALA 3ESJA 3WGMA 5HY2A 4I50A 5HP7A 5EB0A 3I7TA 2Z1EA 4IIJA 2QTPA 5GONB 5JH7A 1RQ2A 3CG6A 1ONIA 5LOVB 5MN6A 4O2AA 2HP0B 3G4SF 1IV3A 3VO8A 1JFFB 1OAPA 5BMVA 4DRXB 5LYJB 3JALB 3PLAC 1PXWA 1SA0B 3N2KB 4TV8A 2LCAA 1Q86H 4IIJB 3M1XA 4BT7A 2HVYD 1Z5VA 4O4IA 4O4LA 1VQPF 4X1KA 2VGMA 4O2BA 5J2UA 4U3JA 1W55A 4ZHQB 3CCQF 5HWEA 3P10A 3RYFA 1VK3A 3R0PA 3M84A 4ZOLA 1DBFA 3E22B 1M90H 1YJNF 5ITZA 3VYSC 1W41A 2YYEA 4G88A 2LBWA 3WPWA 3HKDA 1VQ7F 1QVGF 2KG4A 1IV2A 4C4WC 4O2AB 1VHAA 2ZODA 2DYYA 5J2TA 5ITZB 1VQ4F 4RQOA 2Z1UA 3WGKA 3JVHA 1M1KH 5EIBC 4LNUA 2VAPA 5B8FA 4X1KB 1JJ2F 3E1YA 5IJ0B 5EYPB 1RLGA 3WJRA 4C8EA 4HNAB 2QEXF 4BVTA 2HRYA 5KX5B 3IMPA 3RYHB 5LXTA 3S02A 4KWEA 1JD1A 3J80M 5JCOC 5JCOA 4I4TA 3J81M 2OZBA 2UYNB 1FSZA 2G9IA 2YXZA 3HWUA 5A2QM 3OONA 1XHOA 3CPQA 3NK6A 1SDSA 2HP3A 3RYIB 2H8CA 1Z5WA 2BTQB 3EORA 3KHNA 4E6EA 3CCSF 1NJIH 2I6RA 3GTZA 4X20A 5CA0A 3JATB 3WXMB 5G4UC 4PWTA 1VQ5F 1W42A 2R751 1CLIA 1QU9A 4O4IB 3KJJA 3DDNA 3D00A 3LMEA 3NVKE 1VQLF 3MQWA 5EYPA 4ZHQA 5HY0A 4G4ZA 2RHOA 1TUBA 3S06A 5KMGB 4F6RB 3I56F 2LBTA 5GAPK 5JH7B 5C8YB 3CCUF 5MN5A 5EAZA 3CCLF 2ZAUA 3QTYA 3LFOA 2RB9A 3GYQA 2VAMA 1YIJF 3VTIC 1COMA 1PF5A 3F6MA 2HP0A 4DRXA 5BMVB 4X1IB 2QI2A 1JN1A 3IEQA 5MN4A 3WGNA 3CC4F 1W581 4LNUB 3RYFB 3F0DA 3JARB 1T0AA 3N4ZA 1YHQF 1TUBB 2CZWA 1U3PA 2L26A 3FD6A 3JAKB 4EB6B 3CCMF 2KTUA 3HKDB 1KD1H 1ZWZA 2Q1XA 3WGLA 3OBWA 2ZVZA 1QD9A 2KGWA 3VOAA 4NQ3A 5LA6A 3G71F 2HS3A 2ZF8A 3P0ZA 2FGYA 1KNKA 4C8IA 3CCEF 3CYQA 1YITF 4EI8A 5EWRA 1UI9A 4EB6A 1VQOF 3IEWA 1W59A 2UYKA 5HY4A 1CK2A 3JAWA 4BVQA 1XV2A 3VYTC 3AGKA 2ZVYA 5LXTB 4NWOB 4NUTA 3L7QA 3MBMA 1E7KA 1VQ8F 5HP8A 1RLUA 3QHDA 4X3LA 2OTLF 3JAWB 3ELCA 5LP6A 4C82A 3LWRC 2Z01A 1XRGA 2CWJA 2AIFA 3F0EA 3ZOPA 4EI7A 1YJWF 2Z1TA 1S72F 1YGYA 1N8RH 3JATA 1YJ9F 1VQKF 3JAMM 2AMTA 4ZI7B 1X52A 3K2XA 3ON1A 3HKEB 3O85A 1YQNA 3HKBA 5DCVA 2VGNA 1RQ7A 2CHTA 4EI9A 2OHWA 3RA6A 3GHZA 4ZI7A 5IYZB 4WBNA 2W8BC 3VOBA 3CYPB 3N2KA 5IJ9B 3G6EF 2EWCA 3MDOA 3N2GB 5LP6C 3ZP7A 4ERHA 4O4LB 3S03A 3WJPA 2LBXA 1X7OA 4I55B 1W5EA 5GANK 4X1IA 4BW0B 1KC8H 4B45A 5EB1B 5LOVA 2DT4A 4C8GA 4I4TB 5EZYA 1XBIA 3CPWF 1IPAA 3N2GA 1CN7A 1J7HA 5LP6B 2BTUA 3UT5B 1Q7YH 3K14A 4I55A 3S0HA 1KQSF 2H6LA 3N4YA 1IV1A 2UZHA 1K73H 2IG8A 4WBNB 1K9MH 3FD5A 1U3LA 5CA1A 3JASA 3MCAB 3HKBB 1W5BA 3RYCA 5FNVB 4U39A 1UFYA 2AIZP 4O4JB 3HKCA 2RHJA 3VI6A 3CMEF 3LYBA 5LYJA 1VH8A 3TD3A 2WALA 2ZOVA 2N48A 4TZZA 2HQSC 3JAKA 2K1SA 3HAXD 4YJ3B 3JASB 3C9RA 1H47A 2UYNA 1W57A 4G4XA 2VAWA 3ZP4A 4C81A 3RYCB 3HKEA 4BT5A 1VQ6F 1W3EX 4TUYB 4X3MA 2HRUA 5CB4B 1U43A 1U40A 2MQEA 1Q82H 4RHAA 1FNKA 3LDTA 1NMUB 3V7QA 1SA0A 1GO0A 1VQNF 4ZHVA 2FC3A 4ZHYB 3VIUA 3U0OA 4IHJA 4XCQA 3S0YA 1GO1A 3FBAA 5CA1B 4LCKA 3D54A 5G4VC 4R40B 5J2TB 3M4SA 4BT6A 2BO1A 1DT9A 2B33A 4BT2A 3J7AR 4BY9D 2PHNA 4IHJB 4YJ2B 2H8EA 5GINC 5C8YA 1K8AH 4BT4A 3UT5A 3NMUC 1VQVA 4HNAA 3VCZA 3OBYA 2NMUA 3IKFA 4TUYA 5CB4A 5FJ4C 2V9YA 5IJ9A 2R6R1 1W2BF 1TVKB 5HY1A 4TV9B 3VYUC 1YI2F 5JQGB 2Q1YA 2RHHA 5EO3A 3C9UA 5AVMA 5HXZA 4X20B 3HKCB 2OTMA 4X1YB 5CA0B 5EZYB 3HJWC 5JQGA 3LWOC 4TV9A 3WGJA 4G4WA 3PAFA 2OTJF 3CC2F 1VQMF 4ZK7A 4FFBA 3TD5A 2RHLA 5HXUA 3SIVA 2ALEA 1VQ9F 1FFXB 5FLXM 3JARA 1W40A 3CXCF 4TV8B 3CC7F 4F6RA
chains in the Genus database with same CATH topology
3CG6A 1KQSF 3N4YA 3G4SF 3JCMM 3CC4F 1K73H 3PLAC 1PXWA 5IT9M 1K9MH 1Q86H 3LWQC 2HVYD 3V7EA 3N4ZA 1YHQF 3MCAB 1VQPF 1Q81H 3CMAF 2CZWA 2VGMA 3CCQF 3CCMF 2KTUA 5HWEA 3VI6A 3CMEF 2I6DA 2WALA 1KD1H 3E20B 1ZWZA 1M90H 1YJNF 3OBWA 1W41A 4TZZA 3G71F 4NQ3A 3HAXD 2LBWA 2FGYA 3CCEF 1YITF 4EI8A 3I55F 5EWRA 1VQ7F 1QVGF 2KG4A 4C4WC 1VQOF 3V3TA 1VQ6F 1W3EX 1X7PA 5HY4A 3LWPC 4X3MA 1CK2A 1GZ0A 4BVQA 3SIUA 3FFMA 1Q82H 3AGKA 1VQ4F 1NMUB 2F9ZC 4NUTA 3V7QA 1GO0A 3CCRF 1M1KH 1VQNF 2FC3A 4XCQA 1E7KA 1GO1A 1VQ8F 1JJ2F 3E1YA 4LCKA 1RLGA 5G4VC 5GIPC 2QEXF 4X3LA 4BVTA 2OTLF 2BO1A 1DT9A 3J7AR 3J80M 4BVRA 4BY9D 3LWRC 3J81M 2AIFA 4BVSA 4EI7A 2OZBA 1YJWF 1QVFF 1S72F 5GINC 1N8RH 1YJ9F 1K8AH 1VQKF 3NVIB 3VMFB 3JAMM 3NMUC 5A2QM 3CPQA 3NK6A 1SDSA 3OBYA 1X52A 3RA5A 3CCSF 3OW2F 1NJIH 1T0KB 5FJ4C 1RA4A 3ON1A 3WXMB 5G4UC 1W2BF 3O85A 1VQ5F 5HY1A 1W42A 2JNBA 5DCVA 2VGNA 3LWVC 1YI2F 4EI9A 3RA6A 2OHWA 1H7MA 3D00A 5EO3A 3IR9A 5GIOC 3NVKE 1VQLF 5HXZA 5HY0A 3G6EF 3CD6F 2LBXA 1X7OA 3CCVF 3HJWC 3LWOC 3I56F 2QA4F 5GANK 4BW0B 1KC8H 3NK7A 5GAPK 3PAFA 2OTJF 3CC2F 3CCUF 2KTVA 3CCLF 1VQMF 3LFOA 3GYQA 3CCJF 1YIJF 1XBIA 3CPWF 1IPAA 2GLZA 5HXUA 1CN7A 5HY2A 2ALEA 1VQ9F 3SIVA 5FLXM 1W40A 3CXCF 2QI2A 1Q7YH 3CC7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CG6 A;  1KQS F;  3N4Y A;  3G4S F;  3JCM M;  3CC4 F;  1K73 H;  3PLA C;  1PXW A;  5IT9 M;  1K9M H;  1Q86 H;  3LWQ C;  2HVY D;  3V7E A;  3N4Z A;  1YHQ F;  3MCA B;  1VQP F;  1Q81 H;  3CMA F;  2CZW A;  2VGM A;  3CCQ F;  3CCM F;  2KTU A;  3VI6 A;  3CME F;  2I6D A;  2WAL A;  1KD1 H;  3E20 B;  1ZWZ A;  1M90 H;  1YJN F;  3OBW A;  1W41 A;  4TZZ A;  3G71 F;  3HAX D;  2LBW A;  3CCE F;  1YIT F;  3I55 F;  5EWR A;  1VQ7 F;  1QVG F;  2KG4 A;  4C4W C;  1VQO F;  1VQ6 F;  1W3E X;  1X7P A;  3LWP C;  4X3M A;  1CK2 A;  1GZ0 A;  3SIU A;  3FFM A;  1Q82 H;  3AGK A;  1VQ4 F;  1NMU B;  3V7Q A;  4NUT A;  1GO0 A;  3CCR F;  1M1K H;  1VQN F;  2FC3 A;  1E7K A;  1GO1 A;  1VQ8 F;  1JJ2 F;  3E1Y A;  4LCK A;  1RLG A;  5G4V C;  5GIP C;  2QEX F;  4X3L A;  2OTL F;  2BO1 A;  1DT9 A;  3J7A R;  3J80 M;  4BY9 D;  3LWR C;  3J81 M;  2AIF A;  2OZB A;  1YJW F;  1QVF F;  1S72 F;  5GIN C;  1N8R H;  1YJ9 F;  1K8A H;  1VQK F;  3NVI B;  3VMF B;  3JAM M;  3NMU C;  5A2Q M;  3CPQ A;  3NK6 A;  1SDS A;  3OBY A;  1X52 A;  3RA5 A;  3CCS F;  3OW2 F;  1NJI H;  1T0K B;  5FJ4 C;  1RA4 A;  3ON1 A;  3WXM B;  5G4U C;  1W2B F;  3O85 A;  1VQ5 F;  1W42 A;  2JNB A;  5DCV A;  2VGN A;  3LWV C;  1YI2 F;  3RA6 A;  2OHW A;  1H7M A;  5EO3 A;  3IR9 A;  5GIO C;  3NVK E;  1VQL F;  3G6E F;  3CD6 F;  2LBX A;  1X7O A;  3CCV F;  3HJW C;  3LWO C;  3I56 F;  2QA4 F;  5GAN K;  4BW0 B;  1KC8 H;  3NK7 A;  5GAP K;  3PAF A;  2OTJ F;  3CC2 F;  3CCU F;  2KTV A;  3CCL F;  1VQM F;  3LFO A;  3GYQ A;  3CCJ F;  1YIJ F;  1XBI A;  3CPW F;  1IPA A;  1CN7 A;  3SIV A;  2ALE A;  1VQ9 F;  5FLX M;  1W40 A;  3CXC F;  2QI2 A;  1Q7Y H;  3CC7 F; 
#chains in the Genus database with same CATH topology
 2HS4 A;  3JCM M;  4G4Y A;  2CW4 A;  4FFB B;  3KJK A;  5IT9 M;  4O4J A;  3ZO8 A;  5LA6 B;  3LWQ C;  3V7E A;  1Q81 H;  2HS0 A;  3CMA F;  3C9T A;  4X1Y A;  1W5F A;  3KE1 A;  1OFU A;  4O4H A;  1NQ3 A;  2BTO A;  3BYQ A;  3F0G A;  2I6D A;  3E20 B;  4ZHW A;  4O2B B;  2UYP A;  5EIB D;  3I3F A;  1IV4 A;  4ZOL B;  3K12 A;  1KNJ A;  3HTN A;  3IKE A;  3I55 F;  1FFX A;  4O4H B;  2UYJ A;  4BT3 A;  3V3T A;  1X7P A;  3LWP C;  2CHS A;  2Z1F A;  1GZ0 A;  3SIU A;  2HX0 A;  3FFM A;  3D01 A;  3F0F A;  5JVD B;  1ODE A;  2F9Z C;  4G4V A;  3CCR F;  2CSL A;  2GVI A;  3ERN A;  2P6Y A;  3MCQ A;  1QAH A;  3KIZ A;  3DC2 A;  4B5C A;  5GIP C;  3FPI A;  1SZQ A;  4I50 B;  4BVR A;  1FNJ A;  5IJ0 A;  1GX1 A;  2GZL A;  4BVS A;  1QVF F;  3C9S A;  3NVI B;  3VMF B;  5KX5 A;  4B62 A;  3K0T A;  1W5A A;  5IYZ A;  2IQQ A;  4YJ3 A;  3TD4 A;  4DXD A;  3P4E A;  3RA5 A;  3QUW A;  3OW2 F;  1T0K B;  1RA4 A;  1H48 A;  3Q8H A;  5JVD A;  2JNB A;  3V4D A;  5FNV A;  1JFF A;  3RYI A;  3LWV C;  4B46 A;  1H7M A;  5KMG A;  3CB2 A;  3E22 A;  3IR9 A;  5GIO C;  3RE3 A;  3S0W A;  1TVK A;  3CD6 F;  3WJQ A;  1X25 A;  4U3J B;  2VXY A;  1Q8R A;  3B6N A;  1R1M A;  5J2U B;  3CCV F;  2CVL A;  3T80 A;  5GON A;  2QA4 F;  3RYH A;  3NK7 A;  4M8I A;  2PMP A;  2KTV A;  3C8L A;  3WPX A;  2IAF A;  1JY8 A;  3CCJ F;  4YJ2 A;  2GLZ A;  3JAL A;  3ESJ A;  3WGM A;  5HY2 A;  4I50 A;  5HP7 A;  5EB0 A;  3I7T A;  2Z1E A;  4IIJ A;  2QTP A;  5GON B;  5JH7 A;  1RQ2 A;  3CG6 A;  1ONI A;  5LOV B;  5MN6 A;  4O2A A;  2HP0 B;  3G4S F;  1IV3 A;  3VO8 A;  1JFF B;  1OAP A;  5BMV A;  4DRX B;  5LYJ B;  3JAL B;  3PLA C;  1PXW A;  1SA0 B;  3N2K B;  4TV8 A;  2LCA A;  1Q86 H;  4IIJ B;  3M1X A;  4BT7 A;  2HVY D;  1Z5V A;  4O4I A;  4O4L A;  1VQP F;  4X1K A;  2VGM A;  4O2B A;  5J2U A;  4U3J A;  1W55 A;  4ZHQ B;  3CCQ F;  5HWE A;  3P10 A;  3RYF A;  1VK3 A;  3R0P A;  3M84 A;  4ZOL A;  1DBF A;  3E22 B;  1M90 H;  1YJN F;  5ITZ A;  3VYS C;  1W41 A;  2YYE A;  4G88 A;  2LBW A;  3WPW A;  3HKD A;  1VQ7 F;  1QVG F;  2KG4 A;  1IV2 A;  4C4W C;  4O2A B;  1VHA A;  2ZOD A;  2DYY A;  5J2T A;  5ITZ B;  1VQ4 F;  4RQO A;  2Z1U A;  3WGK A;  3JVH A;  1M1K H;  5EIB C;  4LNU A;  2VAP A;  5B8F A;  4X1K B;  1JJ2 F;  3E1Y A;  5IJ0 B;  5EYP B;  1RLG A;  3WJR A;  4C8E A;  4HNA B;  2QEX F;  4BVT A;  2HRY A;  5KX5 B;  3IMP A;  3RYH B;  5LXT A;  3S02 A;  4KWE A;  1JD1 A;  3J80 M;  5JCO C;  5JCO A;  4I4T A;  3J81 M;  2OZB A;  2UYN B;  1FSZ A;  2G9I A;  2YXZ A;  3HWU A;  5A2Q M;  3OON A;  1XHO A;  3CPQ A;  3NK6 A;  1SDS A;  2HP3 A;  3RYI B;  2H8C A;  1Z5W A;  2BTQ B;  3EOR A;  3KHN A;  4E6E A;  3CCS F;  1NJI H;  2I6R A;  3GTZ A;  4X20 A;  5CA0 A;  3JAT B;  3WXM B;  5G4U C;  4PWT A;  1VQ5 F;  1W42 A;  2R75 1;  1CLI A;  1QU9 A;  4O4I B;  3KJJ A;  3DDN A;  3D00 A;  3LME A;  3NVK E;  1VQL F;  3MQW A;  5EYP A;  4ZHQ A;  5HY0 A;  4G4Z A;  2RHO A;  1TUB A;  3S06 A;  5KMG B;  4F6R B;  3I56 F;  2LBT A;  5GAP K;  5JH7 B;  5C8Y B;  3CCU F;  5MN5 A;  5EAZ A;  3CCL F;  2ZAU A;  3QTY A;  3LFO A;  2RB9 A;  3GYQ A;  2VAM A;  1YIJ F;  3VTI C;  1COM A;  1PF5 A;  3F6M A;  2HP0 A;  4DRX A;  5BMV B;  4X1I B;  2QI2 A;  1JN1 A;  3IEQ A;  5MN4 A;  3WGN A;  3CC4 F;  1W58 1;  4LNU B;  3RYF B;  3F0D A;  3JAR B;  1T0A A;  3N4Z A;  1YHQ F;  1TUB B;  2CZW A;  1U3P A;  2L26 A;  3FD6 A;  3JAK B;  4EB6 B;  3CCM F;  2KTU A;  3HKD B;  1KD1 H;  1ZWZ A;  2Q1X A;  3WGL A;  3OBW A;  2ZVZ A;  1QD9 A;  2KGW A;  3VOA A;  4NQ3 A;  5LA6 A;  3G71 F;  2HS3 A;  2ZF8 A;  3P0Z A;  2FGY A;  1KNK A;  4C8I A;  3CCE F;  3CYQ A;  1YIT F;  4EI8 A;  5EWR A;  1UI9 A;  4EB6 A;  1VQO F;  3IEW A;  1W59 A;  2UYK A;  5HY4 A;  1CK2 A;  3JAW A;  4BVQ A;  1XV2 A;  3VYT C;  3AGK A;  2ZVY A;  5LXT B;  4NWO B;  4NUT A;  3L7Q A;  3MBM A;  1E7K A;  1VQ8 F;  5HP8 A;  1RLU A;  3QHD A;  4X3L A;  2OTL F;  3JAW B;  3ELC A;  5LP6 A;  4C82 A;  3LWR C;  2Z01 A;  1XRG A;  2CWJ A;  2AIF A;  3F0E A;  3ZOP A;  4EI7 A;  1YJW F;  2Z1T A;  1S72 F;  1YGY A;  1N8R H;  3JAT A;  1YJ9 F;  1VQK F;  3JAM M;  2AMT A;  4ZI7 B;  1X52 A;  3K2X A;  3ON1 A;  3HKE B;  3O85 A;  1YQN A;  3HKB A;  5DCV A;  2VGN A;  1RQ7 A;  2CHT A;  4EI9 A;  2OHW A;  3RA6 A;  3GHZ A;  4ZI7 A;  5IYZ B;  4WBN A;  2W8B C;  3VOB A;  3CYP B;  3N2K A;  5IJ9 B;  3G6E F;  2EWC A;  3MDO A;  3N2G B;  5LP6 C;  3ZP7 A;  4ERH A;  4O4L B;  3S03 A;  3WJP A;  2LBX A;  1X7O A;  4I55 B;  1W5E A;  5GAN K;  4X1I A;  4BW0 B;  1KC8 H;  4B45 A;  5EB1 B;  5LOV A;  2DT4 A;  4C8G A;  4I4T B;  5EZY A;  1XBI A;  3CPW F;  1IPA A;  3N2G A;  1CN7 A;  1J7H A;  5LP6 B;  2BTU A;  3UT5 B;  1Q7Y H;  3K14 A;  4I55 A;  3S0H A;  1KQS F;  2H6L A;  3N4Y A;  1IV1 A;  2UZH A;  1K73 H;  2IG8 A;  4WBN B;  1K9M H;  3FD5 A;  1U3L A;  5CA1 A;  3JAS A;  3MCA B;  3HKB B;  1W5B A;  3RYC A;  5FNV B;  4U39 A;  1UFY A;  2AIZ P;  4O4J B;  3HKC A;  2RHJ A;  3VI6 A;  3CME F;  3LYB A;  5LYJ A;  1VH8 A;  3TD3 A;  2WAL A;  2ZOV A;  2N48 A;  4TZZ A;  2HQS C;  3JAK A;  2K1S A;  3HAX D;  4YJ3 B;  3JAS B;  3C9R A;  1H47 A;  2UYN A;  1W57 A;  4G4X A;  2VAW A;  3ZP4 A;  4C81 A;  3RYC B;  3HKE A;  4BT5 A;  1VQ6 F;  1W3E X;  4TUY B;  4X3M A;  2HRU A;  5CB4 B;  1U43 A;  1U40 A;  2MQE A;  1Q82 H;  4RHA A;  1FNK A;  3LDT A;  1NMU B;  3V7Q A;  1SA0 A;  1GO0 A;  1VQN F;  4ZHV A;  2FC3 A;  4ZHY B;  3VIU A;  3U0O A;  4IHJ A;  4XCQ A;  3S0Y A;  1GO1 A;  3FBA A;  5CA1 B;  4LCK A;  3D54 A;  5G4V C;  4R40 B;  5J2T B;  3M4S A;  4BT6 A;  2BO1 A;  1DT9 A;  2B33 A;  4BT2 A;  3J7A R;  4BY9 D;  2PHN A;  4IHJ B;  4YJ2 B;  2H8E A;  5GIN C;  5C8Y A;  1K8A H;  4BT4 A;  3UT5 A;  3NMU C;  1VQV A;  4HNA A;  3VCZ A;  3OBY A;  2NMU A;  3IKF A;  4TUY A;  5CB4 A;  5FJ4 C;  2V9Y A;  5IJ9 A;  2R6R 1;  1W2B F;  1TVK B;  5HY1 A;  4TV9 B;  3VYU C;  1YI2 F;  5JQG B;  2Q1Y A;  2RHH A;  5EO3 A;  3C9U A;  5AVM A;  5HXZ A;  4X20 B;  3HKC B;  2OTM A;  4X1Y B;  5CA0 B;  5EZY B;  3HJW C;  5JQG A;  3LWO C;  4TV9 A;  3WGJ A;  4G4W A;  3PAF A;  2OTJ F;  3CC2 F;  1VQM F;  4ZK7 A;  4FFB A;  3TD5 A;  2RHL A;  5HXU A;  3SIV A;  2ALE A;  1VQ9 F;  1FFX B;  5FLX M;  3JAR A;  1W40 A;  3CXC F;  4TV8 B;  3CC7 F;  4F6R A; 
#chains in the Genus database with same CATH homology
 3CG6 A;  1KQS F;  3N4Y A;  3G4S F;  3JCM M;  3CC4 F;  1K73 H;  3PLA C;  1PXW A;  5IT9 M;  1K9M H;  1Q86 H;  3LWQ C;  2HVY D;  3V7E A;  3N4Z A;  1YHQ F;  3MCA B;  1VQP F;  1Q81 H;  3CMA F;  2CZW A;  2VGM A;  3CCQ F;  3CCM F;  2KTU A;  5HWE A;  3VI6 A;  3CME F;  2I6D A;  2WAL A;  1KD1 H;  3E20 B;  1ZWZ A;  1M90 H;  1YJN F;  3OBW A;  1W41 A;  4TZZ A;  3G71 F;  4NQ3 A;  3HAX D;  2LBW A;  2FGY A;  3CCE F;  1YIT F;  4EI8 A;  3I55 F;  5EWR A;  1VQ7 F;  1QVG F;  2KG4 A;  4C4W C;  1VQO F;  3V3T A;  1VQ6 F;  1W3E X;  1X7P A;  5HY4 A;  3LWP C;  4X3M A;  1CK2 A;  1GZ0 A;  4BVQ A;  3SIU A;  3FFM A;  1Q82 H;  3AGK A;  1VQ4 F;  1NMU B;  2F9Z C;  4NUT A;  3V7Q A;  1GO0 A;  3CCR F;  1M1K H;  1VQN F;  2FC3 A;  4XCQ A;  1E7K A;  1GO1 A;  1VQ8 F;  1JJ2 F;  3E1Y A;  4LCK A;  1RLG A;  5G4V C;  5GIP C;  2QEX F;  4X3L A;  4BVT A;  2OTL F;  2BO1 A;  1DT9 A;  3J7A R;  3J80 M;  4BVR A;  4BY9 D;  3LWR C;  3J81 M;  2AIF A;  4BVS A;  4EI7 A;  2OZB A;  1YJW F;  1QVF F;  1S72 F;  5GIN C;  1N8R H;  1YJ9 F;  1K8A H;  1VQK F;  3NVI B;  3VMF B;  3JAM M;  3NMU C;  5A2Q M;  3CPQ A;  3NK6 A;  1SDS A;  3OBY A;  1X52 A;  3RA5 A;  3CCS F;  3OW2 F;  1NJI H;  1T0K B;  5FJ4 C;  1RA4 A;  3ON1 A;  3WXM B;  5G4U C;  1W2B F;  3O85 A;  1VQ5 F;  5HY1 A;  1W42 A;  2JNB A;  5DCV A;  2VGN A;  3LWV C;  1YI2 F;  4EI9 A;  3RA6 A;  2OHW A;  1H7M A;  3D00 A;  5EO3 A;  3IR9 A;  5GIO C;  3NVK E;  1VQL F;  5HXZ A;  5HY0 A;  3G6E F;  3CD6 F;  2LBX A;  1X7O A;  3CCV F;  3HJW C;  3LWO C;  3I56 F;  2QA4 F;  5GAN K;  4BW0 B;  1KC8 H;  3NK7 A;  5GAP K;  3PAF A;  2OTJ F;  3CC2 F;  3CCU F;  2KTV A;  3CCL F;  1VQM F;  3LFO A;  3GYQ A;  3CCJ F;  1YIJ F;  1XBI A;  3CPW F;  1IPA A;  2GLZ A;  5HXU A;  1CN7 A;  5HY2 A;  2ALE A;  1VQ9 F;  3SIV A;  5FLX M;  1W40 A;  3CXC F;  2QI2 A;  1Q7Y H;  3CC7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...