2OTLF

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2otlF00
2KG4A 3WXMB 3OW2F 1GO1A 3CC7F 3CCEF 3CCSF 1YHQF 3N4YA 3AGKA 1VQLF 1JJ2F 4TZZA 5A2QM 2BO1A 4X3LA 2LBWA 3OBWA 3CC4F 1W41A 3G6EF 3LWRC 1VQ7F 3J7AR 1SDSA 1XBIA 3V7QA 3NK7A 2VGMA 1NJIH 4BW0B 2KTUA 3CPQA 1QVGF 1VQKF 3E1YA 1Q86H 3IR9A 2ALEA 3VMFB 4BY9D 5GANK 1VQ8F 1N8RH 1VQ4F 3PLAC 3J81M 2AIFA 3E20B 2OTLF 3CCMF 3MCAB 2HVYD 3RA5A 1W2BF 3NVIB 3CCQF 5GINC 5GIOC 3JCMM 1RLGA 1Q7YH 3J80M 3I55F 1W3EX 3SIUA 1W42A 3LWVC 1X7OA 5EO3A 2QEXF 5G4VC 1T0KB 3GYQA 1YITF 1X7PA 1K8AH 5GAPK 3CCLF 2OHWA 2I6DA 2OZBA 1CN7A 1YIJF 1VQ9F 1X52A 5IT9M 1M1KH 3CCVF 1KC8H 4X3MA 3I56F 1PXWA 3G71F 3CG6A 3CMAF 1IPAA 3NMUC 2QA4F 2VGNA 1CK2A 3NVKE 3SIVA 3ON1A 1NMUB 1VQPF 2JNBA 2OTJF 3CCRF 3LWOC 1Q81H 1VQ5F 1QVFF 4C4WC 1VQMF 1YJ9F 1S72F 1YI2F 2QI2A 2FC3A 3LWPC 3CD6F 3G4SF 2LBXA 1E7KA 3CC2F 5FLXM 3OBYA 3O85A 5G4UC 2KTVA 1RA4A 4LCKA 3RA6A 1VQOF 3V7EA 5FJ4C 3CMEF 3LWQC 3CPWF 1VQ6F 3FFMA 1DT9A 1K9MH 5DCVA 3LFOA 3PAFA 1YJNF 1YJWF 1K73H 3HJWC 3VI6A 3N4ZA 1W40A 1M90H 5EWRA 2WALA 1VQNF 1ZWZA 1Q82H 3HAXD 3CXCF 4NUTA 1H7MA 5GIPC 3CCJF 1KD1H 3NK6A 1KQSF 1GZ0A 1GO0A 3JAMM 3CCUF 2CZWA
chains in the Genus database with same CATH superfamily
1UFYA 4YJ3B 4BT3A 1W57A 1Z5WA 4O4IB 5LP6B 3N4YA 1VQLF 3K0TA 3WJQA 4TZZA 2BO1A 2LBWA 4E6EA 3CC4F 5HP7A 4O4HA 3G6EF 2GZLA 3LWRC 3VYSC 3VYUC 3J7AR 3ZOPA 1SDSA 3QUWA 4LNUB 1Z5VA 2KTUA 3F0GA 2CW4A 2RHJA 4O2AA 3N2KB 4TUYA 5LP6C 1COMA 3RYIA 1TUBB 1VHAA 4X1KA 4ZOLB 2RHHA 3J81M 2BTOA 2AIFA 1W5AA 1FNKA 3BYQA 3FD5A 3WJPA 2R6R1 3Q8HA 3RA5A 5J2TB 4F6RA 3F6MA 5GIOC 1RLGA 2PMPA 3J80M 3I55F 3SIUA 2IAFA 3LMEA 4I50A 3MQWA 4BVQA 3GYQA 4BVRA 3GHZA 4ZHQA 4EI8A 2I6DA 5J2UA 3JARA 4X20B 3HKCA 2IQQA 3V4DA 1OAPA 1M1KH 2QTPA 4G88A 1KC8H 3CG6A 3C9SA 3UT5B 4U3JB 4C81A 2MQEA 3HKEA 3CMAF 2Z1FA 5LA6A 2QA4F 1CK2A 5LXTB 1R1MA 3FBAA 3JARB 4X20A 2EWCA 5KX5B 5MN4A 4C4WC 1YJ9F 3K14A 5EZYA 2Z01A 5B8FA 1TVKA 3CD6F 1IV2A 3E22A 5MN5A 3HKEB 5IJ0B 3CC2F 3OBYA 4O2BA 3ZP7A 5G4UC 5CA0A 3FPIA 3K2XA 1RLUA 2LCAA 1VQOF 2R751 2OTMA 1QD9A 3VTIC 1VQ6F 3FFMA 3RYFB 1JD1A 1K73H 5ITZB 1QAHA 3N4ZA 2BTQB 1Q82H 4ZHVA 4NUTA 3I3FA 4EB6B 4HNAB 2N48A 1GO0A 4B5CA 5KMGA 3JAMM 3LDTA 2HP0A 2CZWA 2ZVZA 4TUYB 3WXMB 5LA6B 4WBNA 3IKFA 4NQ3A 4C8EA 5A2QM 3D54A 3JASB 2HP0B 5KMGB 3OBWA 2Q1YA 2ZOVA 5HXZA 4G4YA 3DC2A 3LYBA 5IJ0A 5J2TA 1VQ7F 1XBIA 1TVKB 3HKDA 1FNJA 3V7QA 3GTZA 5EZYB 1NJIH 4DXDA 4ZHQB 5HY2A 1QVGF 1VQKF 3IR9A 1IV1A 2ALEA 2RHLA 2UYJA 3KE1A 5GANK 1W59A 3D00A 3PLAC 3E20B 4EI9A 2Q1XA 2OTLF 3CCMF 1W5EA 2UZHA 5EB1B 3T80A 1ODEA 2CWJA 3M84A 4ZK7A 4O4JB 1W2BF 5HXUA 5GINC 5FNVB 3JCMM 3WGLA 2AIZP 3FD6A 3JALA 3KIZA 2HS4A 2HS0A 1X7OA 2DYYA 4BVSA 3QHDA 5MN6A 5G4VC 4R40B 3S0HA 3I7TA 3C9UA 2OZBA 1YIJF 3JAKB 1VQ9F 1X52A 4IHJA 3KJKA 5IT9M 3P0ZA 3RYHB 4WBNB 4X3MA 5C8YA 5LOVA 5FNVA 4G4WA 4C82A 3F0DA 5EAZA 3V3TA 2VGNA 4X1YB 2GVIA 5BMVB 1NMUB 2OTJF 3CCRF 1Q81H 1VQ5F 4TV8A 1VQMF 1W5BA 2QI2A 1XV2A 5CB4A 2LBXA 4X1KB 1E7KA 1GX1A 3JVHA 4BT5A 5FLXM 1VQVA 3O85A 1RA4A 4LCKA 2AMTA 5LOVB 4YJ2B 3RYCA 3RA6A 3V7EA 1IV3A 2K1SA 2F9ZC 3CPWF 1YQNA 5IJ9A 3IKEA 1YJNF 2H8EA 3HJWC 5LYJB 3TD3A 1W40A 3WPWA 2DT4A 4DRXB 4IIJB 3WGJA 3CXCF 3IEQA 1DBFA 2ZF8A 1KD1H 3MCQA 1KQSF 4O2AB 4C8IA 1JN1A 3CCUF 2KG4A 5LYJA 3OW2F 4G4ZA 3CC7F 3N2GA 1YHQF 1H47A 1JFFA 4O4IA 1Q8RA 5LP6A 1JJ2F 3S03A 4DRXA 4BT4A 4KWEA 2NMUA 2RHOA 2VAPA 4NWOB 4B46A 4BT2A 4O4JA 4ZHWA 3IEWA 2HX0A 2H6LA 1XHOA 3NK7A 2VGMA 3B6NA 1U3PA 1U43A 2FGYA 2UYNB 3E1YA 4O4LA 1ONIA 2YYEA 3VOAA 3RYCB 3HKCB 4YJ2A 1J7HA 4BY9D 2UYKA 4BT6A 3WGNA 3WPXA 5GONA 1N8RH 4I55B 1FSZA 4EB6A 3MCAB 3OONA 3P10A 3RYHA 3NVIB 3CCQF 2VXYA 5BMVA 5IYZB 2G9IA 1Q7YH 1W3EX 3F0FA 1FFXB 3JASA 3L7QA 4G4XA 3LWVC 1T0KB 3K12A 1YITF 2HRYA 2B33A 3M1XA 5GAPK 3CCLF 5AVMA 4C8GA 5CA0B 2V9YA 3HWUA 1JFFB 3ERNA 3HKBA 4IHJB 2UYPA 1SA0A 1RQ2A 3ELCA 3JAWB 1YGYA 2H8CA 2HQSC 3TD4A 5ITZA 5JVDA 3S02A 2ZAUA 5EYPB 3SIVA 4ZOLA 3LWOC 4I4TB 1YI2F 2FC3A 3JAWA 4I50B 3LWPC 3G4SF 5HY0A 2KTVA 4X1YA 1SA0B 3U0OA 2P6YA 2KGWA 3CMEF 5JH7A 3VYTC 3LWQC 2CVLA 2W8BC 3JATB 1DT9A 2PHNA 5EB0A 3S06A 1K9MH 4I4TA 4U3JA 1T0AA 5EIBD 4ZI7B 3JAKA 5JCOC 3CYQA 3N2KA 4B62A 3C9TA 4B45A 1H48A 5JH7B 1VQNF 1ZWZA 4HNAA 1H7MA 5GIPC 3IMPA 4G4VA 4M8IA 3KHNA 2ZODA 4FFBA 2CHTA 4O4HB 1GO1A 2HS3A 3CCEF 3CCSF 5GONB 2UYNA 3P4EA 4IIJA 3AGKA 3F0EA 3RE3A 5HY1A 3VO8A 4TV8B 4X3LA 4TV9B 4X1IB 5JVDB 1W41A 3DDNA 4PWTA 3EORA 4RHAA 3VOBA 1U40A 5HP8A 2YXZA 5J2UB 3WGKA 1TUBA 4BVTA 3M4SA 1W581 1UI9A 4FFBB 1CLIA 2ZVYA 4BW0B 3CPQA 3UT5A 2RB9A 3QTYA 1Q86H 3WJRA 3VMFB 2L26A 1VQ8F 4O4LB 4TV9A 1VQ4F 3ZP4A 3C9RA 3C8LA 4O2BB 4I55A 2HVYD 3HKBB 3E22B 3KJJA 3HTNA 1VH8A 1X25A 2CHSA 2I6RA 4ZHYB 3VIUA 1KNKA 1SZQA 4ERHA 1W42A 3D01A 5CB4B 5EO3A 2QEXF 1FFXA 1VK3A 1X7PA 5HWEA 2Z1TA 2Z1EA 1K8AH 3MDOA 5CA1A 2OHWA 1PF5A 2CSLA 3WGMA 3ZO8A 5IYZA 1CN7A 2VAMA 3CB2A 4BT7A 2IG8A 5JCOA 3CCVF 1OFUA 1W5FA 5KX5A 3JATA 3I56F 1PXWA 1KNJA 2BTUA 3G71F 5LXTA 5C8YB 1U3LA 1IPAA 1RQ7A 3NMUC 3VCZA 3TD5A 1QU9A 3NVKE 3MBMA 3ON1A 1VQPF 2JNBA 5EIBC 1JY8A 2GLZA 1QVFF 3N2GB 1S72F 1NQ3A 4U39A 3RYFA 2LBTA 3JALB 3S0YA 5HY4A 5JQGA 5EYPA 3HKDB 1W55A 4RQOA 3S0WA 5FJ4C 3ESJA 3RYIB 4LNUA 2HRUA 2HP3A 5DCVA 4F6RB 4X1IA 3LFOA 3PAFA 1YJWF 3R0PA 5IJ9B 2Z1UA 4YJ3A 3VI6A 1XRGA 1M90H 5EWRA 4ZI7A 2WALA 3CYPB 3HAXD 1IV4A 5JQGB 3CCJF 3NK6A 4XCQA 4EI7A 1GZ0A 5CA1B 2VAWA
chains in the Genus database with same CATH topology
2KG4A 3WXMB 3OW2F 1GO1A 3CC7F 3CCEF 3CCSF 1YHQF 3N4YA 3AGKA 4NQ3A 1JJ2F 1VQLF 4TZZA 5A2QM 2BO1A 5HY1A 4X3LA 2LBWA 3OBWA 3CC4F 1W41A 5HXZA 3G6EF 3LWRC 1VQ7F 4BVTA 3J7AR 1SDSA 1XBIA 3V7QA 3NK7A 2VGMA 1NJIH 4BW0B 2FGYA 2KTUA 3CPQA 5HY2A 1QVGF 1VQKF 3E1YA 1Q86H 3IR9A 2ALEA 3VMFB 4BY9D 5GANK 1VQ8F 3D00A 1N8RH 1VQ4F 3PLAC 3J81M 2AIFA 3E20B 4EI9A 2OTLF 3CCMF 3MCAB 2HVYD 3RA5A 1W2BF 3NVIB 5HXUA 3CCQF 5GINC 5GIOC 3JCMM 1RLGA 1Q7YH 3J80M 3I55F 1W3EX 3SIUA 1W42A 3LWVC 1X7OA 4BVSA 4BVQA 5EO3A 2QEXF 5G4VC 1T0KB 4BVRA 3GYQA 1YITF 5HWEA 1X7PA 1K8AH 5GAPK 3CCLF 4EI8A 2OHWA 2I6DA 2OZBA 1CN7A 1YIJF 1VQ9F 1X52A 5IT9M 1M1KH 3CCVF 1KC8H 4X3MA 3I56F 1PXWA 3G71F 3CG6A 3CMAF 1IPAA 3V3TA 2QA4F 3NMUC 2VGNA 1CK2A 3NVKE 3SIVA 3ON1A 1NMUB 1VQPF 2JNBA 2OTJF 3CCRF 3LWOC 1Q81H 1VQ5F 2GLZA 1QVFF 4C4WC 1VQMF 1YJ9F 1S72F 1YI2F 2QI2A 2FC3A 3LWPC 3CD6F 3G4SF 2LBXA 1E7KA 3CC2F 5FLXM 3OBYA 3O85A 5G4UC 5HY0A 5HY4A 2KTVA 1RA4A 4LCKA 3RA6A 1VQOF 3V7EA 5FJ4C 3CMEF 2F9ZC 3LWQC 3CPWF 1VQ6F 3FFMA 1DT9A 1K9MH 5DCVA 3LFOA 3PAFA 1YJNF 1YJWF 1K73H 3HJWC 3VI6A 3N4ZA 1W40A 1M90H 5EWRA 2WALA 1VQNF 1ZWZA 1Q82H 3HAXD 3CXCF 4NUTA 1H7MA 5GIPC 3CCJF 1KD1H 3NK6A 4XCQA 4EI7A 1GZ0A 1KQSF 1GO0A 3JAMM 3CCUF 2CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG4 A;  3WXM B;  3OW2 F;  1GO1 A;  3CC7 F;  3CCE F;  3CCS F;  1YHQ F;  3N4Y A;  3AGK A;  1VQL F;  1JJ2 F;  4TZZ A;  5A2Q M;  2BO1 A;  4X3L A;  2LBW A;  3OBW A;  3CC4 F;  1W41 A;  3G6E F;  3LWR C;  1VQ7 F;  3J7A R;  1SDS A;  1XBI A;  3V7Q A;  3NK7 A;  2VGM A;  1NJI H;  4BW0 B;  2KTU A;  3CPQ A;  1QVG F;  1VQK F;  3E1Y A;  1Q86 H;  3IR9 A;  2ALE A;  3VMF B;  4BY9 D;  5GAN K;  1VQ8 F;  1N8R H;  1VQ4 F;  3PLA C;  3J81 M;  2AIF A;  3E20 B;  2OTL F;  3CCM F;  3MCA B;  2HVY D;  3RA5 A;  1W2B F;  3NVI B;  3CCQ F;  5GIN C;  5GIO C;  3JCM M;  1RLG A;  1Q7Y H;  3J80 M;  3I55 F;  1W3E X;  3SIU A;  1W42 A;  3LWV C;  1X7O A;  5EO3 A;  2QEX F;  5G4V C;  1T0K B;  3GYQ A;  1YIT F;  1X7P A;  1K8A H;  5GAP K;  3CCL F;  2OHW A;  2I6D A;  2OZB A;  1CN7 A;  1YIJ F;  1VQ9 F;  1X52 A;  5IT9 M;  1M1K H;  3CCV F;  1KC8 H;  4X3M A;  3I56 F;  1PXW A;  3G71 F;  3CG6 A;  3CMA F;  1IPA A;  3NMU C;  2QA4 F;  2VGN A;  1CK2 A;  3NVK E;  3SIV A;  3ON1 A;  1NMU B;  1VQP F;  2JNB A;  2OTJ F;  3CCR F;  3LWO C;  1Q81 H;  1VQ5 F;  1QVF F;  4C4W C;  1VQM F;  1YJ9 F;  1S72 F;  1YI2 F;  2QI2 A;  2FC3 A;  3LWP C;  3CD6 F;  3G4S F;  2LBX A;  1E7K A;  3CC2 F;  5FLX M;  3OBY A;  3O85 A;  5G4U C;  2KTV A;  1RA4 A;  4LCK A;  3RA6 A;  1VQO F;  3V7E A;  5FJ4 C;  3CME F;  3LWQ C;  3CPW F;  1VQ6 F;  3FFM A;  1DT9 A;  1K9M H;  5DCV A;  3LFO A;  3PAF A;  1YJN F;  1YJW F;  1K73 H;  3HJW C;  3VI6 A;  3N4Z A;  1W40 A;  1M90 H;  5EWR A;  2WAL A;  1VQN F;  1ZWZ A;  1Q82 H;  3HAX D;  3CXC F;  4NUT A;  1H7M A;  5GIP C;  3CCJ F;  1KD1 H;  3NK6 A;  1KQS F;  1GZ0 A;  1GO0 A;  3JAM M;  3CCU F;  2CZW A; 
#chains in the Genus database with same CATH topology
 1UFY A;  4YJ3 B;  4BT3 A;  1W57 A;  1Z5W A;  4O4I B;  5LP6 B;  3N4Y A;  1VQL F;  3K0T A;  3WJQ A;  4TZZ A;  2BO1 A;  2LBW A;  4E6E A;  3CC4 F;  5HP7 A;  4O4H A;  3G6E F;  2GZL A;  3LWR C;  3VYS C;  3VYU C;  3J7A R;  3ZOP A;  1SDS A;  3QUW A;  4LNU B;  1Z5V A;  2KTU A;  3F0G A;  2CW4 A;  2RHJ A;  4O2A A;  3N2K B;  4TUY A;  5LP6 C;  1COM A;  3RYI A;  1TUB B;  1VHA A;  4X1K A;  4ZOL B;  2RHH A;  3J81 M;  2BTO A;  2AIF A;  1W5A A;  1FNK A;  3BYQ A;  3FD5 A;  3WJP A;  2R6R 1;  3Q8H A;  3RA5 A;  5J2T B;  4F6R A;  3F6M A;  5GIO C;  1RLG A;  2PMP A;  3J80 M;  3I55 F;  3SIU A;  2IAF A;  3LME A;  4I50 A;  3MQW A;  4BVQ A;  3GYQ A;  4BVR A;  3GHZ A;  4ZHQ A;  4EI8 A;  2I6D A;  5J2U A;  3JAR A;  4X20 B;  3HKC A;  2IQQ A;  3V4D A;  1OAP A;  1M1K H;  2QTP A;  4G88 A;  1KC8 H;  3CG6 A;  3C9S A;  3UT5 B;  4U3J B;  4C81 A;  2MQE A;  3HKE A;  3CMA F;  2Z1F A;  5LA6 A;  2QA4 F;  1CK2 A;  5LXT B;  1R1M A;  3FBA A;  3JAR B;  4X20 A;  2EWC A;  5KX5 B;  5MN4 A;  4C4W C;  1YJ9 F;  3K14 A;  5EZY A;  2Z01 A;  5B8F A;  1TVK A;  3CD6 F;  1IV2 A;  3E22 A;  5MN5 A;  3HKE B;  5IJ0 B;  3CC2 F;  3OBY A;  4O2B A;  3ZP7 A;  5G4U C;  5CA0 A;  3FPI A;  3K2X A;  1RLU A;  2LCA A;  1VQO F;  2R75 1;  2OTM A;  1QD9 A;  3VTI C;  1VQ6 F;  3FFM A;  3RYF B;  1JD1 A;  1K73 H;  5ITZ B;  1QAH A;  3N4Z A;  2BTQ B;  1Q82 H;  4ZHV A;  4NUT A;  3I3F A;  4EB6 B;  4HNA B;  2N48 A;  1GO0 A;  4B5C A;  5KMG A;  3JAM M;  3LDT A;  2HP0 A;  2CZW A;  2ZVZ A;  4TUY B;  3WXM B;  5LA6 B;  4WBN A;  3IKF A;  4NQ3 A;  4C8E A;  5A2Q M;  3D54 A;  3JAS B;  2HP0 B;  5KMG B;  3OBW A;  2Q1Y A;  2ZOV A;  5HXZ A;  4G4Y A;  3DC2 A;  3LYB A;  5IJ0 A;  5J2T A;  1VQ7 F;  1XBI A;  1TVK B;  3HKD A;  1FNJ A;  3V7Q A;  3GTZ A;  5EZY B;  1NJI H;  4DXD A;  4ZHQ B;  5HY2 A;  1QVG F;  1VQK F;  3IR9 A;  1IV1 A;  2ALE A;  2RHL A;  2UYJ A;  3KE1 A;  5GAN K;  1W59 A;  3D00 A;  3PLA C;  3E20 B;  4EI9 A;  2Q1X A;  2OTL F;  3CCM F;  1W5E A;  2UZH A;  5EB1 B;  3T80 A;  1ODE A;  2CWJ A;  3M84 A;  4ZK7 A;  4O4J B;  1W2B F;  5HXU A;  5GIN C;  5FNV B;  3JCM M;  3WGL A;  2AIZ P;  3FD6 A;  3JAL A;  3KIZ A;  2HS4 A;  2HS0 A;  1X7O A;  2DYY A;  4BVS A;  3QHD A;  5MN6 A;  5G4V C;  4R40 B;  3S0H A;  3I7T A;  3C9U A;  2OZB A;  1YIJ F;  3JAK B;  1VQ9 F;  1X52 A;  4IHJ A;  3KJK A;  5IT9 M;  3P0Z A;  3RYH B;  4WBN B;  4X3M A;  5C8Y A;  5LOV A;  5FNV A;  4G4W A;  4C82 A;  3F0D A;  5EAZ A;  3V3T A;  2VGN A;  4X1Y B;  2GVI A;  5BMV B;  1NMU B;  2OTJ F;  3CCR F;  1Q81 H;  1VQ5 F;  4TV8 A;  1VQM F;  1W5B A;  2QI2 A;  1XV2 A;  5CB4 A;  2LBX A;  4X1K B;  1E7K A;  1GX1 A;  3JVH A;  4BT5 A;  5FLX M;  1VQV A;  3O85 A;  1RA4 A;  4LCK A;  2AMT A;  5LOV B;  4YJ2 B;  3RYC A;  3RA6 A;  3V7E A;  1IV3 A;  2K1S A;  2F9Z C;  3CPW F;  1YQN A;  5IJ9 A;  3IKE A;  1YJN F;  2H8E A;  3HJW C;  5LYJ B;  3TD3 A;  1W40 A;  3WPW A;  2DT4 A;  4DRX B;  4IIJ B;  3WGJ A;  3CXC F;  3IEQ A;  1DBF A;  2ZF8 A;  1KD1 H;  3MCQ A;  1KQS F;  4O2A B;  4C8I A;  1JN1 A;  3CCU F;  2KG4 A;  5LYJ A;  3OW2 F;  4G4Z A;  3CC7 F;  3N2G A;  1YHQ F;  1H47 A;  1JFF A;  4O4I A;  1Q8R A;  5LP6 A;  1JJ2 F;  3S03 A;  4DRX A;  4BT4 A;  4KWE A;  2NMU A;  2RHO A;  2VAP A;  4NWO B;  4B46 A;  4BT2 A;  4O4J A;  4ZHW A;  3IEW A;  2HX0 A;  2H6L A;  1XHO A;  3NK7 A;  2VGM A;  3B6N A;  1U3P A;  1U43 A;  2FGY A;  2UYN B;  3E1Y A;  4O4L A;  1ONI A;  2YYE A;  3VOA A;  3RYC B;  3HKC B;  4YJ2 A;  1J7H A;  4BY9 D;  2UYK A;  4BT6 A;  3WGN A;  3WPX A;  5GON A;  1N8R H;  4I55 B;  1FSZ A;  4EB6 A;  3MCA B;  3OON A;  3P10 A;  3RYH A;  3NVI B;  3CCQ F;  2VXY A;  5BMV A;  5IYZ B;  2G9I A;  1Q7Y H;  1W3E X;  3F0F A;  1FFX B;  3JAS A;  3L7Q A;  4G4X A;  3LWV C;  1T0K B;  3K12 A;  1YIT F;  2HRY A;  2B33 A;  3M1X A;  5GAP K;  3CCL F;  5AVM A;  4C8G A;  5CA0 B;  2V9Y A;  3HWU A;  1JFF B;  3ERN A;  3HKB A;  4IHJ B;  2UYP A;  1SA0 A;  1RQ2 A;  3ELC A;  3JAW B;  1YGY A;  2H8C A;  2HQS C;  3TD4 A;  5ITZ A;  5JVD A;  3S02 A;  2ZAU A;  5EYP B;  3SIV A;  4ZOL A;  3LWO C;  4I4T B;  1YI2 F;  2FC3 A;  3JAW A;  4I50 B;  3LWP C;  3G4S F;  5HY0 A;  2KTV A;  4X1Y A;  1SA0 B;  3U0O A;  2P6Y A;  2KGW A;  3CME F;  5JH7 A;  3VYT C;  3LWQ C;  2CVL A;  2W8B C;  3JAT B;  1DT9 A;  2PHN A;  5EB0 A;  3S06 A;  1K9M H;  4I4T A;  4U3J A;  1T0A A;  5EIB D;  4ZI7 B;  3JAK A;  5JCO C;  3CYQ A;  3N2K A;  4B62 A;  3C9T A;  4B45 A;  1H48 A;  5JH7 B;  1VQN F;  1ZWZ A;  4HNA A;  1H7M A;  5GIP C;  3IMP A;  4G4V A;  4M8I A;  3KHN A;  2ZOD A;  4FFB A;  2CHT A;  4O4H B;  1GO1 A;  2HS3 A;  3CCE F;  3CCS F;  5GON B;  2UYN A;  3P4E A;  4IIJ A;  3AGK A;  3F0E A;  3RE3 A;  5HY1 A;  3VO8 A;  4TV8 B;  4X3L A;  4TV9 B;  4X1I B;  5JVD B;  1W41 A;  3DDN A;  4PWT A;  3EOR A;  4RHA A;  3VOB A;  1U40 A;  5HP8 A;  2YXZ A;  5J2U B;  3WGK A;  1TUB A;  4BVT A;  3M4S A;  1W58 1;  1UI9 A;  4FFB B;  1CLI A;  2ZVY A;  4BW0 B;  3CPQ A;  3UT5 A;  2RB9 A;  3QTY A;  1Q86 H;  3WJR A;  3VMF B;  2L26 A;  1VQ8 F;  4O4L B;  4TV9 A;  1VQ4 F;  3ZP4 A;  3C9R A;  3C8L A;  4O2B B;  4I55 A;  2HVY D;  3HKB B;  3E22 B;  3KJJ A;  3HTN A;  1VH8 A;  1X25 A;  2CHS A;  2I6R A;  4ZHY B;  3VIU A;  1KNK A;  1SZQ A;  4ERH A;  1W42 A;  3D01 A;  5CB4 B;  5EO3 A;  2QEX F;  1FFX A;  1VK3 A;  1X7P A;  5HWE A;  2Z1T A;  2Z1E A;  1K8A H;  3MDO A;  5CA1 A;  2OHW A;  1PF5 A;  2CSL A;  3WGM A;  3ZO8 A;  5IYZ A;  1CN7 A;  2VAM A;  3CB2 A;  4BT7 A;  2IG8 A;  5JCO A;  3CCV F;  1OFU A;  1W5F A;  5KX5 A;  3JAT A;  3I56 F;  1PXW A;  1KNJ A;  2BTU A;  3G71 F;  5LXT A;  5C8Y B;  1U3L A;  1IPA A;  1RQ7 A;  3NMU C;  3VCZ A;  3TD5 A;  1QU9 A;  3NVK E;  3MBM A;  3ON1 A;  1VQP F;  2JNB A;  5EIB C;  1JY8 A;  2GLZ A;  1QVF F;  3N2G B;  1S72 F;  1NQ3 A;  4U39 A;  3RYF A;  2LBT A;  3JAL B;  3S0Y A;  5HY4 A;  5JQG A;  5EYP A;  3HKD B;  1W55 A;  4RQO A;  3S0W A;  5FJ4 C;  3ESJ A;  3RYI B;  4LNU A;  2HRU A;  2HP3 A;  5DCV A;  4F6R B;  4X1I A;  3LFO A;  3PAF A;  1YJW F;  3R0P A;  5IJ9 B;  2Z1U A;  4YJ3 A;  3VI6 A;  1XRG A;  1M90 H;  5EWR A;  4ZI7 A;  2WAL A;  3CYP B;  3HAX D;  1IV4 A;  5JQG B;  3CCJ F;  3NK6 A;  4XCQ A;  4EI7 A;  1GZ0 A;  5CA1 B;  2VAW A; 
#chains in the Genus database with same CATH homology
 2KG4 A;  3WXM B;  3OW2 F;  1GO1 A;  3CC7 F;  3CCE F;  3CCS F;  1YHQ F;  3N4Y A;  3AGK A;  4NQ3 A;  1JJ2 F;  1VQL F;  4TZZ A;  5A2Q M;  2BO1 A;  5HY1 A;  4X3L A;  2LBW A;  3OBW A;  3CC4 F;  1W41 A;  5HXZ A;  3G6E F;  3LWR C;  1VQ7 F;  4BVT A;  3J7A R;  1SDS A;  1XBI A;  3V7Q A;  3NK7 A;  2VGM A;  1NJI H;  4BW0 B;  2FGY A;  2KTU A;  3CPQ A;  5HY2 A;  1QVG F;  1VQK F;  3E1Y A;  1Q86 H;  3IR9 A;  2ALE A;  3VMF B;  4BY9 D;  5GAN K;  1VQ8 F;  3D00 A;  1N8R H;  1VQ4 F;  3PLA C;  3J81 M;  2AIF A;  3E20 B;  4EI9 A;  2OTL F;  3CCM F;  3MCA B;  2HVY D;  3RA5 A;  1W2B F;  3NVI B;  5HXU A;  3CCQ F;  5GIN C;  5GIO C;  3JCM M;  1RLG A;  1Q7Y H;  3J80 M;  3I55 F;  1W3E X;  3SIU A;  1W42 A;  3LWV C;  1X7O A;  4BVS A;  4BVQ A;  5EO3 A;  2QEX F;  5G4V C;  1T0K B;  4BVR A;  3GYQ A;  1YIT F;  5HWE A;  1X7P A;  1K8A H;  5GAP K;  3CCL F;  4EI8 A;  2OHW A;  2I6D A;  2OZB A;  1CN7 A;  1YIJ F;  1VQ9 F;  1X52 A;  5IT9 M;  1M1K H;  3CCV F;  1KC8 H;  4X3M A;  3I56 F;  1PXW A;  3G71 F;  3CG6 A;  3CMA F;  1IPA A;  3V3T A;  2QA4 F;  3NMU C;  2VGN A;  1CK2 A;  3NVK E;  3SIV A;  3ON1 A;  1NMU B;  1VQP F;  2JNB A;  2OTJ F;  3CCR F;  3LWO C;  1Q81 H;  1VQ5 F;  2GLZ A;  1QVF F;  4C4W C;  1VQM F;  1YJ9 F;  1S72 F;  1YI2 F;  2QI2 A;  2FC3 A;  3LWP C;  3CD6 F;  3G4S F;  2LBX A;  1E7K A;  3CC2 F;  5FLX M;  3OBY A;  3O85 A;  5G4U C;  5HY0 A;  5HY4 A;  2KTV A;  1RA4 A;  4LCK A;  3RA6 A;  1VQO F;  3V7E A;  5FJ4 C;  3CME F;  2F9Z C;  3LWQ C;  3CPW F;  1VQ6 F;  3FFM A;  1DT9 A;  1K9M H;  5DCV A;  3LFO A;  3PAF A;  1YJN F;  1YJW F;  1K73 H;  3HJW C;  3VI6 A;  3N4Z A;  1W40 A;  1M90 H;  5EWR A;  2WAL A;  1VQN F;  1ZWZ A;  1Q82 H;  3HAX D;  3CXC F;  4NUT A;  1H7M A;  5GIP C;  3CCJ F;  1KD1 H;  3NK6 A;  4XCQ A;  4EI7 A;  1GZ0 A;  1KQS F;  1GO0 A;  3JAM M;  3CCU F;  2CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...