2OTLF

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2otlF00
1VQ5F 3CCLF 1GO0A 1X7OA 3JAMM 3LWPC 1X7PA 2QEXF 1Q81H 3LWOC 3I56F 3OW2F 3MCAB 2OTJF 2KTVA 2BO1A 3CCVF 1W42A 4BY9D 1Q86H 1M90H 3CCJF 2CZWA 1YHQF 3NK6A 5GIPC 4NUTA 5EO3A 3V7QA 3CD6F 1KC8H 3G6EF 3CC2F 1YJ9F 5G4UC 5A2QM 1Q82H 1K73H 1JJ2F 3RA5A 2HVYD 3NVIB 1VQKF 3CCQF 1VQ8F 3FFMA 3ON1A 1YIJF 1YJNF 3J80M 1X52A 3IR9A 1RA4A 3CMAF 3G4SF 5GINC 3HJWC 1PXWA 3AGKA 1CN7A 3N4YA 1S72F 3CC7F 2VGMA 3CCSF 1E7KA 1W3EX 3CCEF 4X3LA 3VI6A 3VMFB 3SIVA 2OHWA 3GYQA 5GANK 2OZBA 1N8RH 1K8AH 1W40A 1VQNF 3N4ZA 1IPAA 3LFOA 4LCKA 2OTLF 5GAPK 3OBYA 1VQMF 2JNBA 3CC4F 3V7EA 1KD1H 2LBXA 2LBWA 1YITF 1XBIA 3J7AR 3CPQA 3CXCF 1SDSA 1VQ4F 2KTUA 3NMUC 1VQ7F 1GZ0A 3CCMF 2I6DA 2FC3A 3SIUA 5IT9M 3LWQC 3CCUF 2KG4A 5FLXM 3E20B 1RLGA 1YJWF 1W2BF 3E1YA 1T0KB 4C4WC 3LWRC 3WXMB 3O85A 2AIFA 5DCVA 1M1KH 1Q7YH 4TZZA 3CCRF 1YI2F 2QI2A 1VQOF 3PAFA 1VQ6F 1KQSF 1DT9A 2VGNA 3CPWF 3J81M 1GO1A 3I55F 2QA4F 1VQPF 1K9MH 5GIOC 3CMEF 3OBWA 1QVGF 1QVFF 1CK2A 3G71F 5FJ4C 3HAXD 2WALA 3PLAC 3JCMM 1ZWZA 1VQLF 2ALEA 3RA6A 3LWVC 3NVKE 1VQ9F 1NJIH 4BW0B 5EWRA 1NMUB 5G4VC 4X3MA 1W41A 3NK7A 1H7MA 3CG6A
chains in the Genus database with same CATH superfamily
1FNKA 4IIJA 3MQWA 3CYPB 3P10A 3RYIB 5CB4A 1JFFB 2Z1TA 1YGYA 2YYEA 1Z5VA 3UT5B 3VO8A 4B62A 5BMVB 3CCVF 3KE1A 3E22A 4BT7A 4FFBB 4ZHQA 2UYPA 5JCOA 4E6EA 3GHZA 3RYCB 3CD6F 2GZLA 3WJRA 3JAWB 4TV9A 1Q82H 1K73H 4WBNB 1JJ2F 5HP7A 3RA5A 5C8YB 2BTQB 4U39A 1VK3A 1VQKF 1R1MA 3CCQF 2CSLA 3F0EA 4O4IB 3VYUC 3IKEA 3HJWC 1PXWA 4I4TB 3QUWA 3N2KA 5ITZA 5IYZB 5KX5A 3GYQA 5GANK 2OZBA 1Q8RA 5LA6A 5GONB 3N4ZA 4IIJB 1KNJA 3HKDB 3LFOA 5CB4B 1XHOA 2OTLF 2HX0A 1COMA 1FFXA 3V7EA 1OAPA 3D00A 5HY2A 2IQQA 1YITF 4BT6A 3E22B 5LP6C 3WPXA 4ZHQB 4U3JB 4ZI7A 1SDSA 4F6RA 5LYJB 2KTUA 4C82A 1CLIA 1H47A 4TV9B 2HS3A 2FC3A 4ZOLA 5IJ0A 1ONIA 3F6MA 3IEWA 2NMUA 1T0AA 4XCQA 2HRUA 4C4WC 2AIFA 5DCVA 4KWEA 1W57A 3N2KB 1Z5WA 2CWJA 2B33A 4G4WA 3TD4A 5ITZB 1U40A 1KQSF 2Q1YA 5KX5B 3I3FA 3WGJA 5LA6B 5CA0A 3CPWF 2RHOA 5AVMA 4BT4A 1X25A 2Q1XA 5FJ4C 2WALA 3RYFA 3FD5A 1FFXB 3EORA 4NWOB 1ZWZA 2ALEA 3NVKE 1VQ9F 3HTNA 1RLUA 5J2UA 3UT5A 3FD6A 1NMUB 4X1IA 4ZI7B 2Z01A 5J2TA 1W41A 4BT5A 4C8IA 3F0FA 3R0PA 4F6RB 1FSZA 3CCLF 1X7OA 2ZAUA 3HKEB 3KJJA 1X7PA 4ZOLB 3V3TA 5MN4A 2QEXF 5LP6A 2BTUA 1Q81H 3M4SA 1NQ3A 3IEQA 3S0WA 2KTVA 2Z1FA 5CA1A 2VXYA 1W42A 4TUYA 4YJ2A 3CCJF 4C81A 4ZK7A 4EI8A 1RQ7A 3U0OA 4PWTA 3ERNA 5EB0A 3CC2F 5G4UC 5A2QM 3FBAA 2HRYA 5CA0B 1VQ8F 2P6YA 3ON1A 3VIUA 2RB9A 1YJNF 1X52A 3HKDA 3IR9A 1YIJF 3JALA 3RYFB 1CN7A 1UFYA 1S72F 3CC7F 4B45A 3MCQA 4C8GA 1W5EA 1W3EX 5J2UB 5EYPA 4X1IB 5J2TB 2OHWA 3SIVA 4U3JA 2CHSA 1K8AH 4BVTA 2CHTA 2R751 5LYJA 4LCKA 1ODEA 3OBYA 4ERHA 5LP6B 3Q8HA 3C9RA 2LCAA 3CB2A 5CA1B 2H8EA 5HXZA 4TUYB 2RHLA 4YJ2B 2ZODA 2MQEA 3ZOPA 3I7TA 2R6R1 4BVRA 3CXCF 1H48A 3NMUC 2AMTA 1GZ0A 3ESJA 3P4EA 3SIUA 3C8LA 4EB6A 2W8BC 1VHAA 2KG4A 3S0YA 5FNVA 5FLXM 5JH7A 1VH8A 3JALB 1W2BF 2HP0A 3WXMB 1PF5A 2HQSC 5EYPB 3WJQA 3PAFA 2VAWA 1DT9A 5JQGA 2VGNA 5HP8A 4NQ3A 1W55A 1W5AA 3K2XA 3I55F 3DC2A 1K9MH 1JN1A 4G4XA 1CK2A 3VOAA 2ZVYA 3G71F 3HKEA 1IV1A 3S06A 4TV8A 1VQLF 3KJKA 3LWVC 4BT2A 4B46A 3S0HA 1NJIH 4BW0B 2BTOA 5EWRA 2GVIA 3K12A 5KMGA 5G4VC 4X3MA 4O4HA 1H7MA 4HNAA 3IMPA 1SA0A 3WGLA 1VQ5F 3S03A 1U3PA 3VOBA 5EAZA 3JAMM 3LWPC 2FGYA 4EB6B 3I56F 3OW2F 3MCAB 4X1YA 5FNVB 3WGNA 5JH7B 2DYYA 2Z1UA 2OTJF 3L7QA 2N48A 3QHDA 4BY9D 1M90H 2HP0B 1YHQF 2UYNA 3NK6A 4O4JA 3V7QA 2ZOVA 3JVHA 1IV3A 1YJ9F 2H6LA 5JQGB 2IG8A 4X20A 3FFMA 2LBTA 3CMAF 3GTZA 3P0ZA 3AGKA 3JARA 3N2GA 3N4YA 4IHJA 2VGMA 4TV8B 3CCSF 4I55A 1E7KA 2PMPA 3VMFB 1OFUA 5KMGB 4O4HB 1TVKA 4HNAB 4ZHYB 1SA0B 2DT4A 1QD9A 3D54A 1IPAA 3D01A 3WGKA 2F9ZC 3V4DA 3JASA 5GAPK 2GLZA 2JNBA 4X1YB 2OTMA 5JVDB 3ELCA 5HY0A 1KD1H 1U3LA 1XBIA 3WJPA 2UYNB 4O4JB 3J7AR 3LYBA 3CPQA 4G4VA 2EWCA 1VQ7F 5LOVB 3CCMF 3VYSC 2AIZP 3HKBA 3JATA 2YXZA 5IT9M 3JAKA 4B5CA 1JD1A 4X20B 3KHNA 3MBMA 3F0GA 4O2AA 3K14A 3E20B 4BVQA 1VQVA 3WPWA 4O4LA 2V9YA 1RLGA 3FPIA 3LWRC 5HWEA 3JARB 3N2GB 4IHJB 2Z1EA 4ZHVA 4I55B 1Q7YH 1YI2F 3ZP4A 2QI2A 1VQOF 5EZYA 1TVKB 1DBFA 2HS0A 4O2BA 1U43A 1FNJA 2VAPA 5MN6A 4G88A 3RE3A 3JASB 3CYQA 3HAXD 4RQOA 1IV2A 3PLAC 3M84A 2UYJA 2PHNA 4BVSA 2RHJA 3CG6A 3VYTC 1YQNA 1GO0A 3M1XA 4I50A 2VAMA 3HKBB 3WGMA 4DRXA 3JATB 3OONA 3JAKB 1W581 3LWOC 1RQ2A 4O2AB 3B6NA 2BO1A 3C9UA 4O4LB 1Q86H 2L26A 5LXTA 4EI7A 2CZWA 1TUBA 4LNUA 5GIPC 4NUTA 3HWUA 2KGWA 1XV2A 5EO3A 2G9IA 4C8EA 1KC8H 3G6EF 2UYKA 3DDNA 4YJ3A 4X1KA 5EZYB 2QTPA 5EB1B 3S02A 4O2BB 1KNKA 2HVYD 3NVIB 3HKCA 3J80M 3KIZA 1RA4A 3IKFA 3G4SF 3LMEA 5GINC 1W5FA 1W59A 1GX1A 4R40B 3TD5A 5JVDA 3CCEF 4X3LA 4ZHWA 2ZF8A 3VI6A 5IJ9A 4DXDA 1N8RH 1VQNF 1W40A 3TD3A 1XRGA 4EI9A 3BYQA 3F0DA 5EIBD 4I50B 3ZP7A 4DRXB 3RYHA 3C9TA 1VQMF 5LOVA 3CC4F 2LBXA 2LBWA 5HXUA 2IAFA 3LDTA 5LXTB 2ZVZA 1TUBB 4LNUB 3RYIA 1JY8A 5JCOC 1VQ4F 4YJ3B 4X1KB 3VTIC 3C9SA 2I6DA 1J7HA 1JFFA 4BT3A 3LWQC 3CCUF 1QAHA 3HKCB 3QTYA 5BMVA 4FFBA 1YJWF 2I6RA 3E1YA 1T0KB 3ZO8A 2HS4A 2CW4A 3O85A 3RYCA 2RHHA 1M1KH 4TZZA 4RHAA 3CCRF 2HP3A 5EIBC 5IJ9B 3JAWA 5IJ0B 1VQ6F 4G4ZA 3T80A 4WBNA 4G4YA 5C8YA 1UI9A 3J81M 1GO1A 2QA4F 1VQPF 5GIOC 3CMEF 3OBWA 1QVGF 1QVFF 4O4IA 3RYHB 1SZQA 2UZHA 1IV4A 5HY4A 5B8FA 5HY1A 4I4TA 3JCMM 3RA6A 1QU9A 3K0TA 2H8CA 5MN5A 5IYZA 3MDOA 2CVLA 4M8IA 2K1SA 3VCZA 3NK7A 1W5BA 5GONA
chains in the Genus database with same CATH topology
1VQ5F 3CCLF 1GO0A 1X7OA 3JAMM 3V3TA 3LWPC 1X7PA 2FGYA 2QEXF 1Q81H 3LWOC 3I56F 3OW2F 3MCAB 2OTJF 2KTVA 2BO1A 3CCVF 1W42A 4BY9D 1Q86H 1M90H 3CCJF 4EI7A 2CZWA 1YHQF 3NK6A 4EI8A 5GIPC 4NUTA 5EO3A 3V7QA 3CD6F 1KC8H 3G6EF 3CC2F 1YJ9F 5G4UC 5A2QM 1Q82H 1K73H 1JJ2F 3RA5A 2HVYD 3NVIB 1VQKF 3CCQF 1VQ8F 3FFMA 3ON1A 1YIJF 1YJNF 3J80M 1X52A 3IR9A 1RA4A 3CMAF 3G4SF 5GINC 3HJWC 1PXWA 3AGKA 1CN7A 3N4YA 1S72F 3CC7F 2VGMA 3CCSF 1E7KA 1W3EX 3CCEF 4X3LA 3VI6A 3VMFB 3SIVA 2OHWA 3GYQA 5GANK 2OZBA 1N8RH 1K8AH 1W40A 1VQNF 3N4ZA 4BVTA 1IPAA 4EI9A 2F9ZC 3LFOA 4LCKA 2OTLF 5GAPK 3OBYA 1VQMF 2GLZA 2JNBA 3CC4F 3V7EA 1KD1H 3D00A 2LBXA 5HY0A 5HY2A 2LBWA 1YITF 1XBIA 5HXZA 5HXUA 3J7AR 4BVRA 3CPQA 3CXCF 1SDSA 1VQ4F 2KTUA 3NMUC 1VQ7F 1GZ0A 3CCMF 2I6DA 2FC3A 3SIUA 5IT9M 3LWQC 3CCUF 2KG4A 5FLXM 3E20B 4BVQA 4XCQA 1RLGA 1YJWF 1W2BF 3E1YA 1T0KB 4C4WC 3LWRC 5HWEA 3WXMB 3O85A 2AIFA 5DCVA 1M1KH 1Q7YH 4TZZA 3CCRF 1YI2F 2QI2A 1VQOF 3PAFA 1VQ6F 1KQSF 1DT9A 2VGNA 4NQ3A 3CPWF 3J81M 1GO1A 3I55F 2QA4F 1VQPF 1K9MH 5GIOC 3CMEF 3OBWA 1QVGF 1QVFF 1CK2A 3G71F 5FJ4C 3HAXD 2WALA 5HY4A 5HY1A 3PLAC 3JCMM 1ZWZA 1VQLF 2ALEA 3RA6A 3LWVC 3NVKE 1VQ9F 1NJIH 4BW0B 5EWRA 1NMUB 5G4VC 4X3MA 1W41A 4BVSA 3NK7A 1H7MA 3CG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 F;  3CCL F;  1GO0 A;  1X7O A;  3JAM M;  3LWP C;  1X7P A;  2QEX F;  1Q81 H;  3LWO C;  3I56 F;  3OW2 F;  3MCA B;  2OTJ F;  2KTV A;  2BO1 A;  3CCV F;  1W42 A;  4BY9 D;  1Q86 H;  1M90 H;  3CCJ F;  2CZW A;  1YHQ F;  3NK6 A;  5GIP C;  4NUT A;  5EO3 A;  3V7Q A;  3CD6 F;  1KC8 H;  3G6E F;  3CC2 F;  1YJ9 F;  5G4U C;  5A2Q M;  1Q82 H;  1K73 H;  1JJ2 F;  3RA5 A;  2HVY D;  3NVI B;  1VQK F;  3CCQ F;  1VQ8 F;  3FFM A;  3ON1 A;  1YIJ F;  1YJN F;  3J80 M;  1X52 A;  3IR9 A;  1RA4 A;  3CMA F;  3G4S F;  5GIN C;  3HJW C;  1PXW A;  3AGK A;  1CN7 A;  3N4Y A;  1S72 F;  3CC7 F;  2VGM A;  3CCS F;  1E7K A;  1W3E X;  3CCE F;  4X3L A;  3VI6 A;  3VMF B;  3SIV A;  2OHW A;  3GYQ A;  5GAN K;  2OZB A;  1N8R H;  1K8A H;  1W40 A;  1VQN F;  3N4Z A;  1IPA A;  3LFO A;  4LCK A;  2OTL F;  5GAP K;  3OBY A;  1VQM F;  2JNB A;  3CC4 F;  3V7E A;  1KD1 H;  2LBX A;  2LBW A;  1YIT F;  1XBI A;  3J7A R;  3CPQ A;  3CXC F;  1SDS A;  1VQ4 F;  2KTU A;  3NMU C;  1VQ7 F;  1GZ0 A;  3CCM F;  2I6D A;  2FC3 A;  3SIU A;  5IT9 M;  3LWQ C;  3CCU F;  2KG4 A;  5FLX M;  3E20 B;  1RLG A;  1YJW F;  1W2B F;  3E1Y A;  1T0K B;  4C4W C;  3LWR C;  3WXM B;  3O85 A;  2AIF A;  5DCV A;  1M1K H;  1Q7Y H;  4TZZ A;  3CCR F;  1YI2 F;  2QI2 A;  1VQO F;  3PAF A;  1VQ6 F;  1KQS F;  1DT9 A;  2VGN A;  3CPW F;  3J81 M;  1GO1 A;  3I55 F;  2QA4 F;  1VQP F;  1K9M H;  5GIO C;  3CME F;  3OBW A;  1QVG F;  1QVF F;  1CK2 A;  3G71 F;  5FJ4 C;  3HAX D;  2WAL A;  3PLA C;  3JCM M;  1ZWZ A;  1VQL F;  2ALE A;  3RA6 A;  3LWV C;  3NVK E;  1VQ9 F;  1NJI H;  4BW0 B;  5EWR A;  1NMU B;  5G4V C;  4X3M A;  1W41 A;  3NK7 A;  1H7M A;  3CG6 A; 
#chains in the Genus database with same CATH topology
 1FNK A;  4IIJ A;  3MQW A;  3CYP B;  3P10 A;  3RYI B;  5CB4 A;  1JFF B;  2Z1T A;  1YGY A;  2YYE A;  1Z5V A;  3UT5 B;  3VO8 A;  4B62 A;  5BMV B;  3CCV F;  3KE1 A;  3E22 A;  4BT7 A;  4FFB B;  4ZHQ A;  2UYP A;  5JCO A;  4E6E A;  3GHZ A;  3RYC B;  3CD6 F;  2GZL A;  3WJR A;  3JAW B;  4TV9 A;  1Q82 H;  1K73 H;  4WBN B;  1JJ2 F;  5HP7 A;  3RA5 A;  5C8Y B;  2BTQ B;  4U39 A;  1VK3 A;  1VQK F;  1R1M A;  3CCQ F;  2CSL A;  3F0E A;  4O4I B;  3VYU C;  3IKE A;  3HJW C;  1PXW A;  4I4T B;  3QUW A;  3N2K A;  5ITZ A;  5IYZ B;  5KX5 A;  3GYQ A;  5GAN K;  2OZB A;  1Q8R A;  5LA6 A;  5GON B;  3N4Z A;  4IIJ B;  1KNJ A;  3HKD B;  3LFO A;  5CB4 B;  1XHO A;  2OTL F;  2HX0 A;  1COM A;  1FFX A;  3V7E A;  1OAP A;  3D00 A;  5HY2 A;  2IQQ A;  1YIT F;  4BT6 A;  3E22 B;  5LP6 C;  3WPX A;  4ZHQ B;  4U3J B;  4ZI7 A;  1SDS A;  4F6R A;  5LYJ B;  2KTU A;  4C82 A;  1CLI A;  1H47 A;  4TV9 B;  2HS3 A;  2FC3 A;  4ZOL A;  5IJ0 A;  1ONI A;  3F6M A;  3IEW A;  2NMU A;  1T0A A;  4XCQ A;  2HRU A;  4C4W C;  2AIF A;  5DCV A;  4KWE A;  1W57 A;  3N2K B;  1Z5W A;  2CWJ A;  2B33 A;  4G4W A;  3TD4 A;  5ITZ B;  1U40 A;  1KQS F;  2Q1Y A;  5KX5 B;  3I3F A;  3WGJ A;  5LA6 B;  5CA0 A;  3CPW F;  2RHO A;  5AVM A;  4BT4 A;  1X25 A;  2Q1X A;  5FJ4 C;  2WAL A;  3RYF A;  3FD5 A;  1FFX B;  3EOR A;  4NWO B;  1ZWZ A;  2ALE A;  3NVK E;  1VQ9 F;  3HTN A;  1RLU A;  5J2U A;  3UT5 A;  3FD6 A;  1NMU B;  4X1I A;  4ZI7 B;  2Z01 A;  5J2T A;  1W41 A;  4BT5 A;  4C8I A;  3F0F A;  3R0P A;  4F6R B;  1FSZ A;  3CCL F;  1X7O A;  2ZAU A;  3HKE B;  3KJJ A;  1X7P A;  4ZOL B;  3V3T A;  5MN4 A;  2QEX F;  5LP6 A;  2BTU A;  1Q81 H;  3M4S A;  1NQ3 A;  3IEQ A;  3S0W A;  2KTV A;  2Z1F A;  5CA1 A;  2VXY A;  1W42 A;  4TUY A;  4YJ2 A;  3CCJ F;  4C81 A;  4ZK7 A;  4EI8 A;  1RQ7 A;  3U0O A;  4PWT A;  3ERN A;  5EB0 A;  3CC2 F;  5G4U C;  5A2Q M;  3FBA A;  2HRY A;  5CA0 B;  1VQ8 F;  2P6Y A;  3ON1 A;  3VIU A;  2RB9 A;  1YJN F;  1X52 A;  3HKD A;  3IR9 A;  1YIJ F;  3JAL A;  3RYF B;  1CN7 A;  1UFY A;  1S72 F;  3CC7 F;  4B45 A;  3MCQ A;  4C8G A;  1W5E A;  1W3E X;  5J2U B;  5EYP A;  4X1I B;  5J2T B;  2OHW A;  3SIV A;  4U3J A;  2CHS A;  1K8A H;  4BVT A;  2CHT A;  2R75 1;  5LYJ A;  4LCK A;  1ODE A;  3OBY A;  4ERH A;  5LP6 B;  3Q8H A;  3C9R A;  2LCA A;  3CB2 A;  5CA1 B;  2H8E A;  5HXZ A;  4TUY B;  2RHL A;  4YJ2 B;  2ZOD A;  2MQE A;  3ZOP A;  3I7T A;  2R6R 1;  4BVR A;  3CXC F;  1H48 A;  3NMU C;  2AMT A;  1GZ0 A;  3ESJ A;  3P4E A;  3SIU A;  3C8L A;  4EB6 A;  2W8B C;  1VHA A;  2KG4 A;  3S0Y A;  5FNV A;  5FLX M;  5JH7 A;  1VH8 A;  3JAL B;  1W2B F;  2HP0 A;  3WXM B;  1PF5 A;  2HQS C;  5EYP B;  3WJQ A;  3PAF A;  2VAW A;  1DT9 A;  5JQG A;  2VGN A;  5HP8 A;  4NQ3 A;  1W55 A;  1W5A A;  3K2X A;  3I55 F;  3DC2 A;  1K9M H;  1JN1 A;  4G4X A;  1CK2 A;  3VOA A;  2ZVY A;  3G71 F;  3HKE A;  1IV1 A;  3S06 A;  4TV8 A;  1VQL F;  3KJK A;  3LWV C;  4BT2 A;  4B46 A;  3S0H A;  1NJI H;  4BW0 B;  2BTO A;  5EWR A;  2GVI A;  3K12 A;  5KMG A;  5G4V C;  4X3M A;  4O4H A;  1H7M A;  4HNA A;  3IMP A;  1SA0 A;  3WGL A;  1VQ5 F;  3S03 A;  1U3P A;  3VOB A;  5EAZ A;  3JAM M;  3LWP C;  2FGY A;  4EB6 B;  3I56 F;  3OW2 F;  3MCA B;  4X1Y A;  5FNV B;  3WGN A;  5JH7 B;  2DYY A;  2Z1U A;  2OTJ F;  3L7Q A;  2N48 A;  3QHD A;  4BY9 D;  1M90 H;  2HP0 B;  1YHQ F;  2UYN A;  3NK6 A;  4O4J A;  3V7Q A;  2ZOV A;  3JVH A;  1IV3 A;  1YJ9 F;  2H6L A;  5JQG B;  2IG8 A;  4X20 A;  3FFM A;  2LBT A;  3CMA F;  3GTZ A;  3P0Z A;  3AGK A;  3JAR A;  3N2G A;  3N4Y A;  4IHJ A;  2VGM A;  4TV8 B;  3CCS F;  4I55 A;  1E7K A;  2PMP A;  3VMF B;  1OFU A;  5KMG B;  4O4H B;  1TVK A;  4HNA B;  4ZHY B;  1SA0 B;  2DT4 A;  1QD9 A;  3D54 A;  1IPA A;  3D01 A;  3WGK A;  2F9Z C;  3V4D A;  3JAS A;  5GAP K;  2GLZ A;  2JNB A;  4X1Y B;  2OTM A;  5JVD B;  3ELC A;  5HY0 A;  1KD1 H;  1U3L A;  1XBI A;  3WJP A;  2UYN B;  4O4J B;  3J7A R;  3LYB A;  3CPQ A;  4G4V A;  2EWC A;  1VQ7 F;  5LOV B;  3CCM F;  3VYS C;  2AIZ P;  3HKB A;  3JAT A;  2YXZ A;  5IT9 M;  3JAK A;  4B5C A;  1JD1 A;  4X20 B;  3KHN A;  3MBM A;  3F0G A;  4O2A A;  3K14 A;  3E20 B;  4BVQ A;  1VQV A;  3WPW A;  4O4L A;  2V9Y A;  1RLG A;  3FPI A;  3LWR C;  5HWE A;  3JAR B;  3N2G B;  4IHJ B;  2Z1E A;  4ZHV A;  4I55 B;  1Q7Y H;  1YI2 F;  3ZP4 A;  2QI2 A;  1VQO F;  5EZY A;  1TVK B;  1DBF A;  2HS0 A;  4O2B A;  1U43 A;  1FNJ A;  2VAP A;  5MN6 A;  4G88 A;  3RE3 A;  3JAS B;  3CYQ A;  3HAX D;  4RQO A;  1IV2 A;  3PLA C;  3M84 A;  2UYJ A;  2PHN A;  4BVS A;  2RHJ A;  3CG6 A;  3VYT C;  1YQN A;  1GO0 A;  3M1X A;  4I50 A;  2VAM A;  3HKB B;  3WGM A;  4DRX A;  3JAT B;  3OON A;  3JAK B;  1W58 1;  3LWO C;  1RQ2 A;  4O2A B;  3B6N A;  2BO1 A;  3C9U A;  4O4L B;  1Q86 H;  2L26 A;  5LXT A;  4EI7 A;  2CZW A;  1TUB A;  4LNU A;  5GIP C;  4NUT A;  3HWU A;  2KGW A;  1XV2 A;  5EO3 A;  2G9I A;  4C8E A;  1KC8 H;  3G6E F;  2UYK A;  3DDN A;  4YJ3 A;  4X1K A;  5EZY B;  2QTP A;  5EB1 B;  3S02 A;  4O2B B;  1KNK A;  2HVY D;  3NVI B;  3HKC A;  3J80 M;  3KIZ A;  1RA4 A;  3IKF A;  3G4S F;  3LME A;  5GIN C;  1W5F A;  1W59 A;  1GX1 A;  4R40 B;  3TD5 A;  5JVD A;  3CCE F;  4X3L A;  4ZHW A;  2ZF8 A;  3VI6 A;  5IJ9 A;  4DXD A;  1N8R H;  1VQN F;  1W40 A;  3TD3 A;  1XRG A;  4EI9 A;  3BYQ A;  3F0D A;  5EIB D;  4I50 B;  3ZP7 A;  4DRX B;  3RYH A;  3C9T A;  1VQM F;  5LOV A;  3CC4 F;  2LBX A;  2LBW A;  5HXU A;  2IAF A;  3LDT A;  5LXT B;  2ZVZ A;  1TUB B;  4LNU B;  3RYI A;  1JY8 A;  5JCO C;  1VQ4 F;  4YJ3 B;  4X1K B;  3VTI C;  3C9S A;  2I6D A;  1J7H A;  1JFF A;  4BT3 A;  3LWQ C;  3CCU F;  1QAH A;  3HKC B;  3QTY A;  5BMV A;  4FFB A;  1YJW F;  2I6R A;  3E1Y A;  1T0K B;  3ZO8 A;  2HS4 A;  2CW4 A;  3O85 A;  3RYC A;  2RHH A;  1M1K H;  4TZZ A;  4RHA A;  3CCR F;  2HP3 A;  5EIB C;  5IJ9 B;  3JAW A;  5IJ0 B;  1VQ6 F;  4G4Z A;  3T80 A;  4WBN A;  4G4Y A;  5C8Y A;  1UI9 A;  3J81 M;  1GO1 A;  2QA4 F;  1VQP F;  5GIO C;  3CME F;  3OBW A;  1QVG F;  1QVF F;  4O4I A;  3RYH B;  1SZQ A;  2UZH A;  1IV4 A;  5HY4 A;  5B8F A;  5HY1 A;  4I4T A;  3JCM M;  3RA6 A;  1QU9 A;  3K0T A;  2H8C A;  5MN5 A;  5IYZ A;  3MDO A;  2CVL A;  4M8I A;  2K1S A;  3VCZ A;  3NK7 A;  1W5B A;  5GON A; 
#chains in the Genus database with same CATH homology
 1VQ5 F;  3CCL F;  1GO0 A;  1X7O A;  3JAM M;  3V3T A;  3LWP C;  1X7P A;  2FGY A;  2QEX F;  1Q81 H;  3LWO C;  3I56 F;  3OW2 F;  3MCA B;  2OTJ F;  2KTV A;  2BO1 A;  3CCV F;  1W42 A;  4BY9 D;  1Q86 H;  1M90 H;  3CCJ F;  4EI7 A;  2CZW A;  1YHQ F;  3NK6 A;  4EI8 A;  5GIP C;  4NUT A;  5EO3 A;  3V7Q A;  3CD6 F;  1KC8 H;  3G6E F;  3CC2 F;  1YJ9 F;  5G4U C;  5A2Q M;  1Q82 H;  1K73 H;  1JJ2 F;  3RA5 A;  2HVY D;  3NVI B;  1VQK F;  3CCQ F;  1VQ8 F;  3FFM A;  3ON1 A;  1YIJ F;  1YJN F;  3J80 M;  1X52 A;  3IR9 A;  1RA4 A;  3CMA F;  3G4S F;  5GIN C;  3HJW C;  1PXW A;  3AGK A;  1CN7 A;  3N4Y A;  1S72 F;  3CC7 F;  2VGM A;  3CCS F;  1E7K A;  1W3E X;  3CCE F;  4X3L A;  3VI6 A;  3VMF B;  3SIV A;  2OHW A;  3GYQ A;  5GAN K;  2OZB A;  1N8R H;  1K8A H;  1W40 A;  1VQN F;  3N4Z A;  4BVT A;  1IPA A;  4EI9 A;  2F9Z C;  3LFO A;  4LCK A;  2OTL F;  5GAP K;  3OBY A;  1VQM F;  2GLZ A;  2JNB A;  3CC4 F;  3V7E A;  1KD1 H;  3D00 A;  2LBX A;  5HY0 A;  5HY2 A;  2LBW A;  1YIT F;  1XBI A;  5HXZ A;  5HXU A;  3J7A R;  4BVR A;  3CPQ A;  3CXC F;  1SDS A;  1VQ4 F;  2KTU A;  3NMU C;  1VQ7 F;  1GZ0 A;  3CCM F;  2I6D A;  2FC3 A;  3SIU A;  5IT9 M;  3LWQ C;  3CCU F;  2KG4 A;  5FLX M;  3E20 B;  4BVQ A;  4XCQ A;  1RLG A;  1YJW F;  1W2B F;  3E1Y A;  1T0K B;  4C4W C;  3LWR C;  5HWE A;  3WXM B;  3O85 A;  2AIF A;  5DCV A;  1M1K H;  1Q7Y H;  4TZZ A;  3CCR F;  1YI2 F;  2QI2 A;  1VQO F;  3PAF A;  1VQ6 F;  1KQS F;  1DT9 A;  2VGN A;  4NQ3 A;  3CPW F;  3J81 M;  1GO1 A;  3I55 F;  2QA4 F;  1VQP F;  1K9M H;  5GIO C;  3CME F;  3OBW A;  1QVG F;  1QVF F;  1CK2 A;  3G71 F;  5FJ4 C;  3HAX D;  2WAL A;  5HY4 A;  5HY1 A;  3PLA C;  3JCM M;  1ZWZ A;  1VQL F;  2ALE A;  3RA6 A;  3LWV C;  3NVK E;  1VQ9 F;  1NJI H;  4BW0 B;  5EWR A;  1NMU B;  5G4V C;  4X3M A;  1W41 A;  4BVS A;  3NK7 A;  1H7M A;  3CG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...