3CCEF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cceF00
2LBWA 1YHQF 3G6EF 5A2QM 5GANK 4BW0B 5GAPK 2KTVA 2OZBA 1CK2A 1DT9A 4BY9D 3I55F 3MCAB 1KD1H 1RA4A 2OTLF 3NMUC 1W2BF 1H7MA 3AGKA 1N8RH 1T0KB 3N4YA 5EWRA 2FC3A 5FJ4C 1W41A 3PAFA 3RA6A 1QVGF 3V7EA 5GIOC 1VQKF 3LWOC 3LWQC 2LBXA 1S72F 3E1YA 5EO3A 1NMUB 1VQ4F 2CZWA 3NK7A 3LWPC 2VGNA 3O85A 3CC4F 2WALA 1VQPF 1SDSA 1Q86H 3JAMM 1GO1A 1K8AH 2KG4A 1W40A 4X3MA 5G4VC 3OW2F 3LFOA 1QVFF 3NVKE 5DCVA 1KC8H 2BO1A 1VQNF 3ON1A 2AIFA 5GINC 2OHWA 3CPWF 3J7AR 3E20B 4NUTA 5GIPC 1YJWF 3IR9A 2VGMA 1VQ5F 1KQSF 5FLXM 3J81M 2HVYD 4TZZA 3CMAF 1JJ2F 1M90H 3PLAC 3SIUA 3LWRC 2OTJF 2I6DA 3CCQF 3VI6A 3CCMF 1IPAA 3CCVF 3FFMA 3CXCF 1VQ8F 3RA5A 1M1KH 1W3EX 3NVIB 1XBIA 3CCSF 3WXMB 1Q7YH 1VQLF 1K9MH 3CG6A 1ZWZA 3I56F 3HJWC 1E7KA 3GYQA 1X52A 3OBYA 3CMEF 2JNBA 1YJNF 3CCJF 3CPQA 3SIVA 5G4UC 1VQ6F 1Q81H 2KTUA 3JCMM 1YITF 1K73H 3CCUF 2QA4F 1GZ0A 1W42A 1X7PA 3CCLF 1Q82H 3LWVC 3CC2F 1VQMF 1YJ9F 4X3LA 1VQ9F 1PXWA 3CCRF 1X7OA 4C4WC 3CD6F 3G71F 1CN7A 2QEXF 3CC7F 1NJIH 3CCEF 3NK6A 1YI2F 1VQ7F 2ALEA 4LCKA 1RLGA 5IT9M 3J80M 3HAXD 3G4SF 3OBWA 2QI2A 3N4ZA 1YIJF 1GO0A 3V7QA 1VQOF 3VMFB
chains in the Genus database with same CATH superfamily
1VHAA 2LBWA 3G6EF 2CHTA 1JY8A 2OZBA 4X1YB 5J2TB 2K1SA 4BT2A 3I55F 1IV4A 1IV1A 3P0ZA 4O4JA 4C8GA 3OONA 2ZOVA 3AGKA 3U0OA 4X20B 3WPXA 5JVDB 1YQNA 1U3LA 2HQSC 3Q8HA 3S0WA 3V7EA 5GIOC 4X1IA 3LWOC 2LBXA 3E1YA 4E6EA 5HY1A 4BT5A 1VQ4F 1SZQA 2VGNA 3O85A 5JCOC 4HNAA 3HKBA 3VTIC 1GO1A 3K14A 4BT3A 5HXUA 2KG4A 2VAMA 2H8EA 3OW2F 3NVKE 1VH8A 2AMTA 2UYNB 3K2XA 5JH7A 2BO1A 3F0DA 5LP6B 3RYHB 1VQNF 3JALB 2VAPA 2Z1FA 4U3JA 1FFXA 2OHWA 3CPWF 5FNVA 3J7AR 3E20B 5GIPC 5EIBC 1YJWF 3CB2A 3IR9A 1T0AA 3IEWA 2DT4A 3I3FA 1JJ2F 3PLAC 4X1KB 3LDTA 3F0GA 1IV2A 3R0PA 3CCVF 3DDNA 5CA0A 2HX0A 3M84A 4O2BB 1FNJA 2GLZA 3JATA 2W8BC 4I50A 1W3EX 1W57A 5C8YB 4BT4A 3NVIB 3CCSF 3S06A 1Q7YH 4B46A 1KNJA 1Q8RA 3CG6A 1TUBA 2RHHA 3C9SA 3F0FA 1E7KA 3GYQA 3CMEF 3D01A 3FPIA 1GX1A 1ONIA 1UI9A 2Z1EA 4C81A 3CCJF 2LBTA 1VQ6F 2HRYA 2GZLA 5G4UC 5LP6C 3ZP4A 3JARB 4YJ3B 1GZ0A 1W42A 3CC2F 3D54A 1YJ9F 5CB4B 3G71F 3ZP7A 3UT5B 3CC7F 4F6RA 1Z5WA 2V9YA 2HRUA 2PMPA 2H8CA 3HWUA 2HP0A 5HP7A 3ESJA 4XCQA 3RE3A 3BYQA 1VQOF 4KWEA 4TV8B 1W5EA 5EZYA 5GANK 4BW0B 2Z1TA 2KTVA 3TD3A 1CK2A 5JQGB 1DT9A 1VK3A 3MCQA 1QU9A 1X25A 4DXDA 1JFFB 1KD1H 1COMA 1RA4A 5AVMA 4G88A 5B8FA 5CA1A 3HKDB 3IEQA 2PHNA 4ZK7A 1RQ2A 4O4IA 1H7MA 2R751 3N4YA 3GTZA 5ITZA 1VQVA 3PAFA 1QVGF 5FJ4C 3DC2A 1U3PA 1VQKF 2IQQA 4O2AB 2ZVYA 3HKCB 4G4WA 5EO3A 3B6NA 1NMUB 1RQ7A 3WJQA 2CZWA 4DRXA 5LYJB 5GONB 3E22A 2WALA 5LXTB 1VQPF 4ZHVA 3V4DA 5IYZA 2ZAUA 1FNKA 2RHLA 5EIBD 3RYIB 2LCAA 3WJRA 4FFBB 3VIUA 3MDOA 2VAWA 4I55B 2CVLA 3RYCA 3WGJA 4O4LA 5LA6B 4ZHQB 1TVKA 4IIJA 4NUTA 2YYEA 5J2UA 5FLXM 4WBNB 3ZO8A 1SA0B 2OTMA 3SIUA 1M90H 5HP8A 4RHAA 3CYQA 4I4TA 3S0HA 3LWRC 4G4ZA 5KX5B 3S02A 2OTJF 2H6LA 3CCQF 3VI6A 4B62A 3FFMA 3CXCF 2EWCA 3VYTC 5KMGA 4O4HA 3WXMB 4NQ3A 1VQLF 5IJ9A 3MQWA 4O4JB 4LNUA 1ZWZA 4RQOA 3JAKA 5MN4A 3D00A 2JNBA 2HS0A 3HKEA 1YJNF 3CPQA 4X1IB 3P4EA 3MBMA 3JCMM 3CCUF 1XHOA 2UYKA 3CCLF 1XV2A 4BVSA 4HNAB 5EYPA 3HKBB 1PXWA 1X7OA 4B5CA 3RYFA 3CCEF 1U43A 2ALEA 1PF5A 3QHDA 5JH7B 2ZVZA 3OBWA 3N4ZA 1YIJF 2GVIA 4U3JB 5IJ0A 1FFXB 4YJ2A 3WGNA 3VMFB 3V3TA 3M1XA 4ZI7A 1YHQF 5A2QM 5BMVA 5LOVA 3N2GA 4TUYA 3EORA 3N2KA 3F6MA 4EB6A 4TV9A 4M8IA 3MCAB 2RB9A 5EAZA 5CA0B 3FD6A 2OTLF 3TD5A 1KNKA 3JATB 4I50B 2RHOA 1N8RH 3KJJA 5EWRA 2FC3A 1W41A 3RA6A 1CLIA 4NWOB 2I6RA 1TUBB 1ODEA 4IHJA 2G9IA 1Q86H 3VOAA 3JAMM 2KGWA 4EI7A 2B33A 5JCOA 3JASA 2ZF8A 3C9TA 4X3MA 4ZOLA 5MN6A 1W5FA 4U39A 3VYUC 3LFOA 1QVFF 5DCVA 4G4YA 1KC8H 2HP3A 2MQEA 5GINC 1W5AA 2VXYA 3JAWA 4F6RB 4ZHWA 2IG8A 4C82A 2HVYD 4TZZA 4X1YA 3GHZA 1JN1A 5J2TA 1W55A 3VCZA 2HP0B 2I6DA 4FFBA 3CCMF 1W59A 2F9ZC 1M1KH 2BTOA 5EZYB 1YGYA 4X20A 1XBIA 3HTNA 5JVDA 2L26A 1FSZA 3ZOPA 5CA1B 3LYBA 1U40A 3C9RA 2Q1XA 3M4SA 2FGYA 3TD4A 3I56F 3HJWC 4O4IB 3IMPA 1X52A 3ELCA 5ITZB 4G4XA 3P10A 1Q81H 2KTUA 1Z5VA 2ZODA 2UYNA 4BVQA 4DRXB 4BT7A 3E22B 2R6R1 3F0EA 3L7QA 1QD9A 4X3LA 5LP6A 3RYHA 2CSLA 5IYZB 1VQ9F 3JALA 4C4WC 5EB1B 2QEXF 1NJIH 4C8EA 1YI2F 4LCKA 3RYCB 3J80M 3HAXD 3QUWA 4X1KA 4O4LB 5HXZA 3S0YA 1TVKB 4IIJB 3V7QA 1W5BA 1R1MA 4O2BA 5J2UB 5GAPK 2Q1YA 5C8YA 4I4TB 4BY9D 1H48A 3VOBA 2BTUA 2HS3A 4G4VA 3NMUC 2UYPA 1W2BF 2BTQB 3FD5A 4C8IA 1H47A 5KMGB 1T0KB 4BVTA 4O4HB 1J7HA 1XRGA 2P6YA 3T80A 3LWQC 5IJ9B 1S72F 2N48A 5FNVB 4LNUB 3JARA 4YJ3A 3JAKB 5EB0A 3KJKA 3IKFA 2IAFA 3NK7A 3LWPC 3CC4F 1SDSA 3HKEB 2CWJA 5CB4A 5HY4A 2Z01A 1K8AH 3KE1A 1W40A 3UT5A 5G4VC 3LMEA 2HS4A 4B45A 3QTYA 5EYPB 3ON1A 1OFUA 2AIFA 3RYFB 2CW4A 2VGMA 4TV8A 3VO8A 1KQSF 1VQ5F 3J81M 1NQ3A 3CMAF 5JQGA 4BT6A 2AIZP 3WPWA 3KIZA 4R40B 5IJ0B 2UZHA 4YJ2B 4EI8A 1JFFA 1IPAA 3C8LA 3HKDA 1VQ8F 3KHNA 1DBFA 3S03A 3RA5A 3WGMA 4ZI7B 5HY0A 5LOVB 5BMVB 4EI9A 3N2GB 4TUYB 5MN5A 1JD1A 3N2KB 4EB6B 4TV9B 4ERHA 1QAHA 2CHSA 2DYYA 3FBAA 3K0TA 4O2AA 3HKCA 1K9MH 5HWEA 5LYJA 3OBYA 5GONA 4BVRA 3VYSC 5LXTA 3SIVA 3RYIA 1YITF 1K73H 4PWTA 2QA4F 2Z1UA 4I55A 1X7PA 1UFYA 2QTPA 4IHJB 3LWVC 1Q82H 1VQMF 5LA6A 3WJPA 1IV3A 4ZHQA 3CCRF 1CN7A 3CD6F 3I7TA 3CYPB 3C9UA 3ERNA 3IKEA 3WGKA 3JASB 3K12A 1OAPA 4ZOLB 1W581 3JVHA 3NK6A 5HY2A 1VQ7F 1RLGA 4WBNA 1SA0A 5IT9M 1RLUA 2RHJA 3G4SF 2UYJA 2QI2A 5KX5A 4ZHYB 1GO0A 3WGLA 2YXZA 3JAWB 2NMUA
chains in the Genus database with same CATH topology
2LBWA 1YHQF 3G6EF 5A2QM 5GANK 4BW0B 5GAPK 2KTVA 2OZBA 1CK2A 1DT9A 4BY9D 3I55F 3MCAB 1KD1H 1RA4A 2OTLF 3NMUC 1W2BF 1H7MA 3AGKA 1N8RH 1T0KB 3N4YA 4BVTA 5EWRA 2FC3A 5FJ4C 1W41A 3PAFA 3RA6A 1QVGF 3V7EA 5GIOC 1VQKF 3LWOC 3LWQC 2LBXA 1S72F 3E1YA 5EO3A 5HY1A 1NMUB 1VQ4F 2CZWA 3NK7A 3LWPC 2VGNA 3O85A 3CC4F 2WALA 1VQPF 1SDSA 1Q86H 3JAMM 4EI7A 1GO1A 5HY4A 1K8AH 5HXUA 2KG4A 1W40A 4X3MA 5G4VC 3OW2F 3LFOA 1QVFF 3NVKE 5DCVA 1KC8H 2BO1A 1VQNF 3ON1A 2AIFA 5GINC 2OHWA 3CPWF 3J7AR 3E20B 4NUTA 5GIPC 1YJWF 3IR9A 2VGMA 1VQ5F 1KQSF 5FLXM 3J81M 2HVYD 4TZZA 3CMAF 1JJ2F 1M90H 3PLAC 3SIUA 3LWRC 2OTJF 2I6DA 4EI8A 3CCQF 3VI6A 3CCMF 1IPAA 3CCVF 3FFMA 3CXCF 1VQ8F 2F9ZC 3RA5A 1M1KH 5HY0A 2GLZA 4EI9A 1W3EX 3NVIB 1XBIA 3CCSF 3WXMB 1Q7YH 4NQ3A 1VQLF 1K9MH 3CG6A 1ZWZA 2FGYA 3I56F 5HWEA 3HJWC 1E7KA 3D00A 3GYQA 1X52A 3OBYA 4BVRA 3CMEF 2JNBA 1YJNF 3CCJF 3CPQA 3SIVA 5G4UC 1VQ6F 1Q81H 2KTUA 3JCMM 1YITF 1K73H 3CCUF 2QA4F 4BVQA 1GZ0A 1W42A 1X7PA 3CCLF 1Q82H 3LWVC 4BVSA 3CC2F 1VQMF 4X3LA 1YJ9F 1VQ9F 1PXWA 3CCRF 1X7OA 4C4WC 3CD6F 3G71F 1CN7A 2QEXF 3CC7F 1NJIH 3CCEF 3NK6A 1YI2F 1VQ7F 5HY2A 2ALEA 4LCKA 1RLGA 5IT9M 3J80M 3HAXD 3G4SF 3OBWA 2QI2A 3N4ZA 5HXZA 1YIJF 4XCQA 1GO0A 3V7QA 1VQOF 3VMFB 3V3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBW A;  1YHQ F;  3G6E F;  5A2Q M;  5GAN K;  4BW0 B;  5GAP K;  2KTV A;  2OZB A;  1CK2 A;  1DT9 A;  4BY9 D;  3I55 F;  3MCA B;  1KD1 H;  1RA4 A;  2OTL F;  3NMU C;  1W2B F;  1H7M A;  3AGK A;  1N8R H;  1T0K B;  3N4Y A;  5EWR A;  2FC3 A;  5FJ4 C;  1W41 A;  3PAF A;  3RA6 A;  1QVG F;  3V7E A;  5GIO C;  1VQK F;  3LWO C;  3LWQ C;  2LBX A;  1S72 F;  3E1Y A;  5EO3 A;  1NMU B;  1VQ4 F;  2CZW A;  3NK7 A;  3LWP C;  2VGN A;  3O85 A;  3CC4 F;  2WAL A;  1VQP F;  1SDS A;  1Q86 H;  3JAM M;  1GO1 A;  1K8A H;  2KG4 A;  1W40 A;  4X3M A;  5G4V C;  3OW2 F;  3LFO A;  1QVF F;  3NVK E;  5DCV A;  1KC8 H;  2BO1 A;  1VQN F;  3ON1 A;  2AIF A;  5GIN C;  2OHW A;  3CPW F;  3J7A R;  3E20 B;  4NUT A;  5GIP C;  1YJW F;  3IR9 A;  2VGM A;  1VQ5 F;  1KQS F;  5FLX M;  3J81 M;  2HVY D;  4TZZ A;  3CMA F;  1JJ2 F;  1M90 H;  3PLA C;  3SIU A;  3LWR C;  2OTJ F;  2I6D A;  3CCQ F;  3VI6 A;  3CCM F;  1IPA A;  3CCV F;  3FFM A;  3CXC F;  1VQ8 F;  3RA5 A;  1M1K H;  1W3E X;  3NVI B;  1XBI A;  3CCS F;  3WXM B;  1Q7Y H;  1VQL F;  1K9M H;  3CG6 A;  1ZWZ A;  3I56 F;  3HJW C;  1E7K A;  3GYQ A;  1X52 A;  3OBY A;  3CME F;  2JNB A;  1YJN F;  3CCJ F;  3CPQ A;  3SIV A;  5G4U C;  1VQ6 F;  1Q81 H;  2KTU A;  3JCM M;  1YIT F;  1K73 H;  3CCU F;  2QA4 F;  1GZ0 A;  1W42 A;  1X7P A;  3CCL F;  1Q82 H;  3LWV C;  3CC2 F;  1VQM F;  1YJ9 F;  4X3L A;  1VQ9 F;  1PXW A;  3CCR F;  1X7O A;  4C4W C;  3CD6 F;  3G71 F;  1CN7 A;  2QEX F;  3CC7 F;  1NJI H;  3CCE F;  3NK6 A;  1YI2 F;  1VQ7 F;  2ALE A;  4LCK A;  1RLG A;  5IT9 M;  3J80 M;  3HAX D;  3G4S F;  3OBW A;  2QI2 A;  3N4Z A;  1YIJ F;  1GO0 A;  3V7Q A;  1VQO F;  3VMF B; 
#chains in the Genus database with same CATH topology
 1VHA A;  2LBW A;  3G6E F;  2CHT A;  1JY8 A;  2OZB A;  4X1Y B;  5J2T B;  2K1S A;  4BT2 A;  3I55 F;  1IV4 A;  1IV1 A;  3P0Z A;  4O4J A;  4C8G A;  3OON A;  2ZOV A;  3AGK A;  3U0O A;  4X20 B;  3WPX A;  5JVD B;  1YQN A;  1U3L A;  2HQS C;  3Q8H A;  3S0W A;  3V7E A;  5GIO C;  4X1I A;  3LWO C;  2LBX A;  3E1Y A;  4E6E A;  5HY1 A;  4BT5 A;  1VQ4 F;  1SZQ A;  2VGN A;  3O85 A;  5JCO C;  4HNA A;  3HKB A;  3VTI C;  1GO1 A;  3K14 A;  4BT3 A;  5HXU A;  2KG4 A;  2VAM A;  2H8E A;  3OW2 F;  3NVK E;  1VH8 A;  2AMT A;  2UYN B;  3K2X A;  5JH7 A;  2BO1 A;  3F0D A;  5LP6 B;  3RYH B;  1VQN F;  3JAL B;  2VAP A;  2Z1F A;  4U3J A;  1FFX A;  2OHW A;  3CPW F;  5FNV A;  3J7A R;  3E20 B;  5GIP C;  5EIB C;  1YJW F;  3CB2 A;  3IR9 A;  1T0A A;  3IEW A;  2DT4 A;  3I3F A;  1JJ2 F;  3PLA C;  4X1K B;  3LDT A;  3F0G A;  1IV2 A;  3R0P A;  3CCV F;  3DDN A;  5CA0 A;  2HX0 A;  3M84 A;  4O2B B;  1FNJ A;  2GLZ A;  3JAT A;  2W8B C;  4I50 A;  1W3E X;  1W57 A;  5C8Y B;  4BT4 A;  3NVI B;  3CCS F;  3S06 A;  1Q7Y H;  4B46 A;  1KNJ A;  1Q8R A;  3CG6 A;  1TUB A;  2RHH A;  3C9S A;  3F0F A;  1E7K A;  3GYQ A;  3CME F;  3D01 A;  3FPI A;  1GX1 A;  1ONI A;  1UI9 A;  2Z1E A;  4C81 A;  3CCJ F;  2LBT A;  1VQ6 F;  2HRY A;  2GZL A;  5G4U C;  5LP6 C;  3ZP4 A;  3JAR B;  4YJ3 B;  1GZ0 A;  1W42 A;  3CC2 F;  3D54 A;  1YJ9 F;  5CB4 B;  3G71 F;  3ZP7 A;  3UT5 B;  3CC7 F;  4F6R A;  1Z5W A;  2V9Y A;  2HRU A;  2PMP A;  2H8C A;  3HWU A;  2HP0 A;  5HP7 A;  3ESJ A;  4XCQ A;  3RE3 A;  3BYQ A;  1VQO F;  4KWE A;  4TV8 B;  1W5E A;  5EZY A;  5GAN K;  4BW0 B;  2Z1T A;  2KTV A;  3TD3 A;  1CK2 A;  5JQG B;  1DT9 A;  1VK3 A;  3MCQ A;  1QU9 A;  1X25 A;  4DXD A;  1JFF B;  1KD1 H;  1COM A;  1RA4 A;  5AVM A;  4G88 A;  5B8F A;  5CA1 A;  3HKD B;  3IEQ A;  2PHN A;  4ZK7 A;  1RQ2 A;  4O4I A;  1H7M A;  2R75 1;  3N4Y A;  3GTZ A;  5ITZ A;  1VQV A;  3PAF A;  1QVG F;  5FJ4 C;  3DC2 A;  1U3P A;  1VQK F;  2IQQ A;  4O2A B;  2ZVY A;  3HKC B;  4G4W A;  5EO3 A;  3B6N A;  1NMU B;  1RQ7 A;  3WJQ A;  2CZW A;  4DRX A;  5LYJ B;  5GON B;  3E22 A;  2WAL A;  5LXT B;  1VQP F;  4ZHV A;  3V4D A;  5IYZ A;  2ZAU A;  1FNK A;  2RHL A;  5EIB D;  3RYI B;  2LCA A;  3WJR A;  4FFB B;  3VIU A;  3MDO A;  2VAW A;  4I55 B;  2CVL A;  3RYC A;  3WGJ A;  4O4L A;  5LA6 B;  4ZHQ B;  1TVK A;  4IIJ A;  4NUT A;  2YYE A;  5J2U A;  5FLX M;  4WBN B;  3ZO8 A;  1SA0 B;  2OTM A;  3SIU A;  1M90 H;  5HP8 A;  4RHA A;  3CYQ A;  4I4T A;  3S0H A;  3LWR C;  4G4Z A;  5KX5 B;  3S02 A;  2OTJ F;  2H6L A;  3CCQ F;  3VI6 A;  4B62 A;  3FFM A;  3CXC F;  2EWC A;  3VYT C;  5KMG A;  4O4H A;  3WXM B;  4NQ3 A;  1VQL F;  5IJ9 A;  3MQW A;  4O4J B;  4LNU A;  1ZWZ A;  4RQO A;  3JAK A;  5MN4 A;  3D00 A;  2JNB A;  2HS0 A;  3HKE A;  1YJN F;  3CPQ A;  4X1I B;  3P4E A;  3MBM A;  3JCM M;  3CCU F;  1XHO A;  2UYK A;  3CCL F;  1XV2 A;  4BVS A;  4HNA B;  5EYP A;  3HKB B;  1PXW A;  1X7O A;  4B5C A;  3RYF A;  3CCE F;  1U43 A;  2ALE A;  1PF5 A;  3QHD A;  5JH7 B;  2ZVZ A;  3OBW A;  3N4Z A;  1YIJ F;  2GVI A;  4U3J B;  5IJ0 A;  1FFX B;  4YJ2 A;  3WGN A;  3VMF B;  3V3T A;  3M1X A;  4ZI7 A;  1YHQ F;  5A2Q M;  5BMV A;  5LOV A;  3N2G A;  4TUY A;  3EOR A;  3N2K A;  3F6M A;  4EB6 A;  4TV9 A;  4M8I A;  3MCA B;  2RB9 A;  5EAZ A;  5CA0 B;  3FD6 A;  2OTL F;  3TD5 A;  1KNK A;  3JAT B;  4I50 B;  2RHO A;  1N8R H;  3KJJ A;  5EWR A;  2FC3 A;  1W41 A;  3RA6 A;  1CLI A;  4NWO B;  2I6R A;  1TUB B;  1ODE A;  4IHJ A;  2G9I A;  1Q86 H;  3VOA A;  3JAM M;  2KGW A;  4EI7 A;  2B33 A;  5JCO A;  3JAS A;  2ZF8 A;  3C9T A;  4X3M A;  4ZOL A;  5MN6 A;  1W5F A;  4U39 A;  3VYU C;  3LFO A;  1QVF F;  5DCV A;  4G4Y A;  1KC8 H;  2HP3 A;  2MQE A;  5GIN C;  1W5A A;  2VXY A;  3JAW A;  4F6R B;  4ZHW A;  2IG8 A;  4C82 A;  2HVY D;  4TZZ A;  4X1Y A;  3GHZ A;  1JN1 A;  5J2T A;  1W55 A;  3VCZ A;  2HP0 B;  2I6D A;  4FFB A;  3CCM F;  1W59 A;  2F9Z C;  1M1K H;  2BTO A;  5EZY B;  1YGY A;  4X20 A;  1XBI A;  3HTN A;  5JVD A;  2L26 A;  1FSZ A;  3ZOP A;  5CA1 B;  3LYB A;  1U40 A;  3C9R A;  2Q1X A;  3M4S A;  2FGY A;  3TD4 A;  3I56 F;  3HJW C;  4O4I B;  3IMP A;  1X52 A;  3ELC A;  5ITZ B;  4G4X A;  3P10 A;  1Q81 H;  2KTU A;  1Z5V A;  2ZOD A;  2UYN A;  4BVQ A;  4DRX B;  4BT7 A;  3E22 B;  2R6R 1;  3F0E A;  3L7Q A;  1QD9 A;  4X3L A;  5LP6 A;  3RYH A;  2CSL A;  5IYZ B;  1VQ9 F;  3JAL A;  4C4W C;  5EB1 B;  2QEX F;  1NJI H;  4C8E A;  1YI2 F;  4LCK A;  3RYC B;  3J80 M;  3HAX D;  3QUW A;  4X1K A;  4O4L B;  5HXZ A;  3S0Y A;  1TVK B;  4IIJ B;  3V7Q A;  1W5B A;  1R1M A;  4O2B A;  5J2U B;  5GAP K;  2Q1Y A;  5C8Y A;  4I4T B;  4BY9 D;  1H48 A;  3VOB A;  2BTU A;  2HS3 A;  4G4V A;  3NMU C;  2UYP A;  1W2B F;  2BTQ B;  3FD5 A;  4C8I A;  1H47 A;  5KMG B;  1T0K B;  4BVT A;  4O4H B;  1J7H A;  1XRG A;  2P6Y A;  3T80 A;  3LWQ C;  5IJ9 B;  1S72 F;  2N48 A;  5FNV B;  4LNU B;  3JAR A;  4YJ3 A;  3JAK B;  5EB0 A;  3KJK A;  3IKF A;  2IAF A;  3NK7 A;  3LWP C;  3CC4 F;  1SDS A;  3HKE B;  2CWJ A;  5CB4 A;  5HY4 A;  2Z01 A;  1K8A H;  3KE1 A;  1W40 A;  3UT5 A;  5G4V C;  3LME A;  2HS4 A;  4B45 A;  3QTY A;  5EYP B;  3ON1 A;  1OFU A;  2AIF A;  3RYF B;  2CW4 A;  2VGM A;  4TV8 A;  3VO8 A;  1KQS F;  1VQ5 F;  3J81 M;  1NQ3 A;  3CMA F;  5JQG A;  4BT6 A;  2AIZ P;  3WPW A;  3KIZ A;  4R40 B;  5IJ0 B;  2UZH A;  4YJ2 B;  4EI8 A;  1JFF A;  1IPA A;  3C8L A;  3HKD A;  1VQ8 F;  3KHN A;  1DBF A;  3S03 A;  3RA5 A;  3WGM A;  4ZI7 B;  5HY0 A;  5LOV B;  5BMV B;  4EI9 A;  3N2G B;  4TUY B;  5MN5 A;  1JD1 A;  3N2K B;  4EB6 B;  4TV9 B;  4ERH A;  1QAH A;  2CHS A;  2DYY A;  3FBA A;  3K0T A;  4O2A A;  3HKC A;  1K9M H;  5HWE A;  5LYJ A;  3OBY A;  5GON A;  4BVR A;  3VYS C;  5LXT A;  3SIV A;  3RYI A;  1YIT F;  1K73 H;  4PWT A;  2QA4 F;  2Z1U A;  4I55 A;  1X7P A;  1UFY A;  2QTP A;  4IHJ B;  3LWV C;  1Q82 H;  1VQM F;  5LA6 A;  3WJP A;  1IV3 A;  4ZHQ A;  3CCR F;  1CN7 A;  3CD6 F;  3I7T A;  3CYP B;  3C9U A;  3ERN A;  3IKE A;  3WGK A;  3JAS B;  3K12 A;  1OAP A;  4ZOL B;  1W58 1;  3JVH A;  3NK6 A;  5HY2 A;  1VQ7 F;  1RLG A;  4WBN A;  1SA0 A;  5IT9 M;  1RLU A;  2RHJ A;  3G4S F;  2UYJ A;  2QI2 A;  5KX5 A;  4ZHY B;  1GO0 A;  3WGL A;  2YXZ A;  3JAW B;  2NMU A; 
#chains in the Genus database with same CATH homology
 2LBW A;  1YHQ F;  3G6E F;  5A2Q M;  5GAN K;  4BW0 B;  5GAP K;  2KTV A;  2OZB A;  1CK2 A;  1DT9 A;  4BY9 D;  3I55 F;  3MCA B;  1KD1 H;  1RA4 A;  2OTL F;  3NMU C;  1W2B F;  1H7M A;  3AGK A;  1N8R H;  1T0K B;  3N4Y A;  4BVT A;  5EWR A;  2FC3 A;  5FJ4 C;  1W41 A;  3PAF A;  3RA6 A;  1QVG F;  3V7E A;  5GIO C;  1VQK F;  3LWO C;  3LWQ C;  2LBX A;  1S72 F;  3E1Y A;  5EO3 A;  5HY1 A;  1NMU B;  1VQ4 F;  2CZW A;  3NK7 A;  3LWP C;  2VGN A;  3O85 A;  3CC4 F;  2WAL A;  1VQP F;  1SDS A;  1Q86 H;  3JAM M;  4EI7 A;  1GO1 A;  5HY4 A;  1K8A H;  5HXU A;  2KG4 A;  1W40 A;  4X3M A;  5G4V C;  3OW2 F;  3LFO A;  1QVF F;  3NVK E;  5DCV A;  1KC8 H;  2BO1 A;  1VQN F;  3ON1 A;  2AIF A;  5GIN C;  2OHW A;  3CPW F;  3J7A R;  3E20 B;  4NUT A;  5GIP C;  1YJW F;  3IR9 A;  2VGM A;  1VQ5 F;  1KQS F;  5FLX M;  3J81 M;  2HVY D;  4TZZ A;  3CMA F;  1JJ2 F;  1M90 H;  3PLA C;  3SIU A;  3LWR C;  2OTJ F;  2I6D A;  4EI8 A;  3CCQ F;  3VI6 A;  3CCM F;  1IPA A;  3CCV F;  3FFM A;  3CXC F;  1VQ8 F;  2F9Z C;  3RA5 A;  1M1K H;  5HY0 A;  2GLZ A;  4EI9 A;  1W3E X;  3NVI B;  1XBI A;  3CCS F;  3WXM B;  1Q7Y H;  4NQ3 A;  1VQL F;  1K9M H;  3CG6 A;  1ZWZ A;  2FGY A;  3I56 F;  5HWE A;  3HJW C;  1E7K A;  3D00 A;  3GYQ A;  1X52 A;  3OBY A;  4BVR A;  3CME F;  2JNB A;  1YJN F;  3CCJ F;  3CPQ A;  3SIV A;  5G4U C;  1VQ6 F;  1Q81 H;  2KTU A;  3JCM M;  1YIT F;  1K73 H;  3CCU F;  2QA4 F;  4BVQ A;  1GZ0 A;  1W42 A;  1X7P A;  3CCL F;  1Q82 H;  3LWV C;  4BVS A;  3CC2 F;  1VQM F;  4X3L A;  1YJ9 F;  1VQ9 F;  1PXW A;  3CCR F;  1X7O A;  4C4W C;  3CD6 F;  3G71 F;  1CN7 A;  2QEX F;  3CC7 F;  1NJI H;  3CCE F;  3NK6 A;  1YI2 F;  1VQ7 F;  5HY2 A;  2ALE A;  4LCK A;  1RLG A;  5IT9 M;  3J80 M;  3HAX D;  3G4S F;  3OBW A;  2QI2 A;  3N4Z A;  5HXZ A;  1YIJ F;  4XCQ A;  1GO0 A;  3V7Q A;  1VQO F;  3VMF B;  3V3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...