3CCEF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cceF00
3HAXD 1PXWA 3VMFB 3SIVA 2HVYD 3CCRF 5G4VC 2AIFA 3CCVF 3LWRC 3CC4F 1Q81H 3CCSF 3FFMA 1CK2A 4C4WC 3RA6A 1QVFF 2OZBA 1X52A 1YITF 1Q86H 1KC8H 1GZ0A 3CD6F 1M1KH 3LWVC 3OBWA 3JCMM 3I56F 1VQPF 1YHQF 1E7KA 1N8RH 3ON1A 3RA5A 3VI6A 2QI2A 3CC2F 1NMUB 5EWRA 1M90H 4X3LA 2ALEA 5A2QM 1VQ9F 2OTLF 5GANK 1GO1A 3CPQA 3E1YA 3LWQC 1SDSA 5FLXM 3NMUC 2KTUA 5IT9M 2KTVA 3CG6A 3CC7F 3OBYA 1YI2F 2OHWA 1H7MA 3AGKA 5GIOC 1KQSF 5GINC 3E20B 3G71F 1DT9A 1YJ9F 1K73H 5GAPK 3J80M 1VQLF 1VQKF 4BY9D 1W2BF 1Q7YH 1CN7A 1K9MH 3NK6A 4NUTA 1VQ8F 3IR9A 1Q82H 1VQNF 1K8AH 1YJNF 2LBXA 1NJIH 1IPAA 3CCEF 3LFOA 3WXMB 1YJWF 2VGNA 3CMEF 1VQ7F 3I55F 1GO0A 2WALA 2VGMA 3V7EA 2CZWA 2JNBA 3HJWC 2I6DA 1VQ5F 3SIUA 5EO3A 3LWOC 1X7PA 1VQ4F 4LCKA 3CMAF 1X7OA 3GYQA 3MCAB 3N4ZA 3CXCF 2QEXF 1KD1H 3NVIB 3CCMF 5G4UC 3V7QA 1XBIA 3G6EF 1RA4A 3JAMM 1W3EX 2QA4F 3NVKE 3J81M 3CPWF 3PAFA 2KG4A 4X3MA 3J7AR 3PLAC 2BO1A 3CCUF 1RLGA 2FC3A 1ZWZA 5FJ4C 4TZZA 1W41A 2LBWA 1VQ6F 1W42A 1JJ2F 3CCJF 3CCQF 1VQMF 3LWPC 3CCLF 1YIJF 1S72F 1W40A 3NK7A 5GIPC 3N4YA 3O85A 3G4SF 2OTJF 5DCVA 1QVGF 3OW2F 1T0KB 1VQOF 4BW0B
chains in the Genus database with same CATH superfamily
1PXWA 3CCRF 3IKFA 2AIFA 3HKDB 4BT7A 4ZK7A 3CCVF 3CC4F 1U40A 4I55A 5EYPB 2AIZP 2HRYA 2VAPA 2Z1EA 3VYUC 1Q86H 2HX0A 4O2BA 4X20A 5EZYA 1NQ3A 3LYBA 4ZI7A 3RYHB 3HKEB 1YHQF 2B33A 4NQ3A 4TV9A 3CC2F 2QI2A 1NMUB 1W5FA 4G88A 1VQ9F 4LNUB 3KE1A 2UYJA 1H48A 3CG6A 4C8IA 1ODEA 4C8GA 2HP0B 1KQSF 4ZOLA 4M8IA 3HKBA 2G9IA 5AVMA 2UYKA 1K73H 3J80M 5BMVA 3HKCB 1DBFA 3S0HA 3T80A 5IJ9A 1Q7YH 3HKBB 3HKEA 5LP6C 3UT5A 1VQNF 5GONB 2LBXA 3WXMB 3ZO8A 4O4JA 1FFXB 2UZHA 2WALA 3WGJA 1Z5VA 1IV4A 3HJWC 5LP6A 1SZQA 3M4SA 3F0GA 3TD3A 3LWOC 3HKCA 5JCOA 4E6EA 1T0AA 5HP8A 1VQ4F 4LCKA 5HXZA 1QU9A 1X7OA 3CXCF 3DDNA 3WGLA 5G4UC 3V7QA 3VYTC 3B6NA 1TUBA 5EYPA 4LNUA 3L7QA 5JVDA 2KG4A 4U3JB 3K2XA 3PLAC 3VIUA 5LOVB 4O4LA 1RLGA 2FC3A 2OTMA 3ZOPA 4TUYA 3VOAA 5FJ4C 3D01A 2ZODA 4ZHYB 4X1KB 4TZZA 2LBWA 2FGYA 1FNJA 1JJ2F 4FFBA 1UI9A 2RHOA 3CCLF 1FNKA 2OTJF 3E22B 5J2TA 4X1YB 3HAXD 3SIVA 2HVYD 5EIBC 3S06A 1IV1A 1JFFA 5IJ0B 2RHLA 4F6RA 3FFMA 4X1YA 5MN5A 4O4IA 2ZOVA 3CCSF 5EB1B 2PMPA 4C4WC 3V4DA 4BT5A 3ESJA 2ZVZA 1X52A 1QVFF 1OFUA 2CW4A 3MBMA 3JASA 4ZHQA 3MDOA 1U3LA 2MQEA 2AMTA 2Q1YA 3UT5B 3LWVC 4PWTA 2ZVYA 3F0EA 4BT4A 3WPWA 3ON1A 1N8RH 3VI6A 3P4EA 4O4LB 5EWRA 1M90H 3WJQA 3RYIB 4I50A 3S02A 1GO1A 3JVHA 1SDSA 3ERNA 3NMUC 5FLXM 5IT9M 2KTUA 4G4XA 2CHTA 3OBYA 3GHZA 3WJRA 2GLZA 5HY0A 1H7MA 3V3TA 4TUYB 1JY8A 4ZHQB 1DT9A 5GAPK 5BMVB 3K12A 2UYNB 2Z01A 3C8LA 3JALA 3R0PA 4BT6A 4XCQA 1K9MH 5CB4A 4NUTA 3P0ZA 2H8CA 3Q8HA 2HP3A 5EIBD 4ZI7B 1GX1A 2K1SA 3LFOA 4ZHVA 1YJWF 3QUWA 1VQ7F 4O2AB 1GO0A 1ONIA 3WGKA 2JNBA 2I6DA 5EB0A 1VQ5F 5IJ9B 3KJJA 4O4HA 3JARB 4I4TA 5HY2A 1X7PA 1JN1A 5B8FA 2HS0A 3MCAB 2QEXF 3FPIA 1XBIA 3OONA 1RA4A 3CB2A 1RLUA 2W8BC 3JAMM 3K0TA 2QA4F 3J81M 2HS3A 1KNJA 2CSLA 2R751 3JAWB 5MN6A 4U39A 1R1MA 2VXYA 3C9SA 3S0WA 3JALB 2HP0A 1JFFB 1ZWZA 5IJ0A 3JAWA 2N48A 1W41A 3RYCA 3JAKB 3F0DA 4TV8B 2HS4A 3LWPC 5ITZB 1XV2A 3JATA 1RQ7A 3N4YA 1YQNA 3E22A 5DCVA 1VK3A 3I7TA 2ZF8A 4HNAB 4X1IA 4EB6A 5IYZA 1T0KB 1VQOF 4TV8A 4BVTA 4WBNA 5JQGA 3RE3A 2Q1XA 5KMGA 1Q81H 1TUBB 3WGMA 1XHOA 4IIJA 3ZP7A 4BT3A 1CK2A 2Z1FA 2NMUA 3RA6A 4WBNB 2OZBA 3M1XA 3ELCA 4DRXA 1YITF 5ITZA 1KC8H 2GVIA 4EI8A 3CD6F 4BVQA 3OBWA 3IEWA 3JCMM 3I56F 1VQPF 1E7KA 3HWUA 5CA1B 1UFYA 2UYNA 4B46A 4X3LA 5JCOC 3N2GA 2ALEA 5A2QM 2CVLA 2LBTA 4DXDA 3RYIA 5GANK 2OTLF 2DT4A 5C8YA 4BT2A 3E1YA 5JH7B 2KTVA 3KIZA 4TV9B 5CA0A 1YI2F 4IHJB 5LOVA 2BTOA 2OHWA 4YJ3B 3AGKA 4C8EA 5MN4A 2CHSA 5LXTA 5GINC 3G71F 4RHAA 5FNVB 2DYYA 4G4VA 3QTYA 3WPXA 3CYPB 2GZLA 3QHDA 1VQLF 1VQKF 1W2BF 4O4HB 1CN7A 4R40B 3NK6A 5IYZB 3IR9A 1JD1A 4YJ2B 1K8AH 4EI9A 5HY4A 3P10A 2YXZA 1IPAA 3CCEF 1SA0B 3VTIC 4DRXB 3C9RA 3MCQA 2VGNA 2H8EA 5C8YB 5J2TB 3CMEF 3IMPA 4IIJB 4F6RB 5HWEA 5CA0B 3K14A 1W581 2KGWA 1H47A 2CZWA 3IKEA 4ERHA 5LYJB 3JARA 5EO3A 4I4TB 1W57A 1FSZA 2YYEA 4C81A 3CMAF 1KD1H 2IAFA 3RYHA 3F6MA 4YJ2A 3N2KA 3RYFB 4KWEA 2I6RA 3S0YA 1J7HA 1W3EX 2RHHA 4YJ3A 3NVKE 3JATB 3CPWF 2IG8A 1X25A 1YGYA 4X1KA 5JH7A 3PAFA 3C9UA 3EORA 3J7AR 3C9TA 2BO1A 2VAMA 4ZHWA 5LXTB 5KX5A 3HKDA 3ZP4A 1W5BA 3LMEA 5FNVA 3GTZA 3CCJF 3CCQF 1VQMF 2CWJA 1S72F 3NK7A 5GIPC 3O85A 1QVGF 3CYQA 1FFXA 1Z5WA 3OW2F 3F0FA 4O2BB 2PHNA 4O4IB 4BW0B 4FFBB 5GONA 3VYSC 3VMFB 1COMA 1W5AA 5HXUA 5JQGB 5G4VC 3LWRC 5HY1A 5J2UA 3DC2A 3WGNA 2LCAA 3D54A 2F9ZC 4G4ZA 3M84A 2IQQA 1CLIA 3HTNA 1GZ0A 4I50B 4RQOA 2EWCA 1M1KH 1QAHA 4B62A 3RYCB 2H6LA 4NWOB 1RQ2A 5CA1A 3RA5A 5LA6B 3IEQA 2ZAUA 3FD5A 5CB4B 3S03A 4BVRA 5JVDB 3CPQA 5LP6B 4X1IB 4EB6B 3LWQC 4B45A 3CC7F 3D00A 2RB9A 5HP7A 5GIOC 5KX5B 3VOBA 3MQWA 4C82A 3E20B 1U3PA 3JASB 2V9YA 3KHNA 3JAKA 1YJ9F 3LDTA 2UYPA 1TVKA 1PF5A 4BY9D 2L26A 3TD4A 1VQ8F 2HQSC 5J2UB 4HNAA 4U3JA 1Q82H 4X20B 4O2AA 5EZYB 4B5CA 1U43A 1TVKB 3VO8A 4IHJA 3FBAA 1YJNF 1NJIH 1SA0A 3TD5A 2HRUA 4ZOLB 1QD9A 3N2GB 3I55F 2VGMA 2QTPA 3V7EA 3U0OA 2P6YA 1XRGA 3KJKA 1VHAA 4G4WA 1IV3A 3SIUA 1Q8RA 3FD6A 3GYQA 3N4ZA 3NVIB 3BYQA 3CCMF 2RHJA 1W55A 1W5EA 2R6R1 1W59A 3N2KB 3RYFA 4O4JB 3G6EF 2BTQB 3VCZA 5KMGB 4BVSA 3WJPA 2Z1UA 4X3MA 1KNKA 2VAWA 5LYJA 3CCUF 1OAPA 4I55B 4G4YA 1VQ6F 1W42A 5LA6A 1YIJF 1W40A 2Z1TA 1IV2A 3G4SF 4EI7A 1VH8A 5EAZA 2BTUA 1VQVA 3I3FA
chains in the Genus database with same CATH topology
3HAXD 1PXWA 4BVTA 3VMFB 3SIVA 2HVYD 3CCRF 5HXUA 5G4VC 2AIFA 3CCVF 3LWRC 5HY1A 3CC4F 1Q81H 3CCSF 3FFMA 1CK2A 4C4WC 2F9ZC 3RA6A 1QVFF 2OZBA 1X52A 1YITF 1Q86H 1KC8H 1GZ0A 4EI8A 3CD6F 4BVQA 3LWVC 1M1KH 3OBWA 3JCMM 3I56F 1VQPF 1YHQF 1E7KA 1N8RH 4NQ3A 3ON1A 3RA5A 3VI6A 2QI2A 3CC2F 1NMUB 5EWRA 1M90H 4X3LA 2ALEA 5A2QM 1VQ9F 2OTLF 5GANK 4BVRA 1GO1A 3CPQA 3E1YA 3LWQC 1SDSA 5FLXM 3NMUC 2KTUA 5IT9M 2KTVA 3CG6A 3CC7F 3OBYA 3D00A 1YI2F 2GLZA 2OHWA 5HY0A 1H7MA 3AGKA 3V3TA 5GIOC 1KQSF 5GINC 3E20B 3G71F 1DT9A 1YJ9F 1K73H 5GAPK 3J80M 1VQLF 1VQKF 4BY9D 1W2BF 1Q7YH 1CN7A 4XCQA 1K9MH 3NK6A 4NUTA 1VQ8F 3IR9A 1Q82H 1VQNF 1K8AH 4EI9A 1YJNF 2LBXA 5HY4A 1NJIH 1IPAA 3CCEF 3LFOA 3WXMB 1YJWF 2VGNA 3CMEF 1VQ7F 3I55F 5HWEA 1GO0A 2WALA 2VGMA 3V7EA 2CZWA 2JNBA 3HJWC 2I6DA 1VQ5F 3SIUA 5EO3A 5HY2A 3LWOC 1X7PA 1VQ4F 4LCKA 5HXZA 3CMAF 1X7OA 3GYQA 3MCAB 3N4ZA 3CXCF 2QEXF 1KD1H 3NVIB 3CCMF 5G4UC 3V7QA 1XBIA 3G6EF 1RA4A 1W3EX 3JAMM 2QA4F 3NVKE 3J81M 3CPWF 4BVSA 3PAFA 2KG4A 4X3MA 3J7AR 3PLAC 2BO1A 3CCUF 1RLGA 2FC3A 1ZWZA 5FJ4C 4TZZA 1W41A 2FGYA 2LBWA 1VQ6F 1W42A 1JJ2F 3CCJF 3CCQF 1VQMF 3LWPC 3CCLF 1YIJF 1S72F 1W40A 3NK7A 5GIPC 3N4YA 3O85A 3G4SF 2OTJF 4EI7A 5DCVA 1QVGF 3OW2F 1T0KB 1VQOF 4BW0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAX D;  1PXW A;  3VMF B;  3SIV A;  2HVY D;  3CCR F;  5G4V C;  2AIF A;  3CCV F;  3LWR C;  3CC4 F;  1Q81 H;  3CCS F;  3FFM A;  1CK2 A;  4C4W C;  3RA6 A;  1QVF F;  2OZB A;  1X52 A;  1YIT F;  1Q86 H;  1KC8 H;  1GZ0 A;  3CD6 F;  1M1K H;  3LWV C;  3OBW A;  3JCM M;  3I56 F;  1VQP F;  1YHQ F;  1E7K A;  1N8R H;  3ON1 A;  3RA5 A;  3VI6 A;  2QI2 A;  3CC2 F;  1NMU B;  5EWR A;  1M90 H;  4X3L A;  2ALE A;  5A2Q M;  1VQ9 F;  2OTL F;  5GAN K;  1GO1 A;  3CPQ A;  3E1Y A;  3LWQ C;  1SDS A;  5FLX M;  3NMU C;  2KTU A;  5IT9 M;  2KTV A;  3CG6 A;  3CC7 F;  3OBY A;  1YI2 F;  2OHW A;  1H7M A;  3AGK A;  5GIO C;  1KQS F;  5GIN C;  3E20 B;  3G71 F;  1DT9 A;  1YJ9 F;  1K73 H;  5GAP K;  3J80 M;  1VQL F;  1VQK F;  4BY9 D;  1W2B F;  1Q7Y H;  1CN7 A;  1K9M H;  3NK6 A;  4NUT A;  1VQ8 F;  3IR9 A;  1Q82 H;  1VQN F;  1K8A H;  1YJN F;  2LBX A;  1NJI H;  1IPA A;  3CCE F;  3LFO A;  3WXM B;  1YJW F;  2VGN A;  3CME F;  1VQ7 F;  3I55 F;  1GO0 A;  2WAL A;  2VGM A;  3V7E A;  2CZW A;  2JNB A;  3HJW C;  2I6D A;  1VQ5 F;  3SIU A;  5EO3 A;  3LWO C;  1X7P A;  1VQ4 F;  4LCK A;  3CMA F;  1X7O A;  3GYQ A;  3MCA B;  3N4Z A;  3CXC F;  2QEX F;  1KD1 H;  3NVI B;  3CCM F;  5G4U C;  3V7Q A;  1XBI A;  3G6E F;  1RA4 A;  3JAM M;  1W3E X;  2QA4 F;  3NVK E;  3J81 M;  3CPW F;  3PAF A;  2KG4 A;  4X3M A;  3J7A R;  3PLA C;  2BO1 A;  3CCU F;  1RLG A;  2FC3 A;  1ZWZ A;  5FJ4 C;  4TZZ A;  1W41 A;  2LBW A;  1VQ6 F;  1W42 A;  1JJ2 F;  3CCJ F;  3CCQ F;  1VQM F;  3LWP C;  3CCL F;  1YIJ F;  1S72 F;  1W40 A;  3NK7 A;  5GIP C;  3N4Y A;  3O85 A;  3G4S F;  2OTJ F;  5DCV A;  1QVG F;  3OW2 F;  1T0K B;  1VQO F;  4BW0 B; 
#chains in the Genus database with same CATH topology
 1PXW A;  3CCR F;  3IKF A;  2AIF A;  3HKD B;  4BT7 A;  4ZK7 A;  3CCV F;  3CC4 F;  1U40 A;  4I55 A;  5EYP B;  2AIZ P;  2HRY A;  2VAP A;  2Z1E A;  3VYU C;  1Q86 H;  2HX0 A;  4O2B A;  4X20 A;  5EZY A;  1NQ3 A;  3LYB A;  4ZI7 A;  3RYH B;  3HKE B;  1YHQ F;  2B33 A;  4NQ3 A;  4TV9 A;  3CC2 F;  2QI2 A;  1NMU B;  1W5F A;  4G88 A;  1VQ9 F;  4LNU B;  3KE1 A;  2UYJ A;  1H48 A;  3CG6 A;  4C8I A;  1ODE A;  4C8G A;  2HP0 B;  1KQS F;  4ZOL A;  4M8I A;  3HKB A;  2G9I A;  5AVM A;  2UYK A;  1K73 H;  3J80 M;  5BMV A;  3HKC B;  1DBF A;  3S0H A;  3T80 A;  5IJ9 A;  1Q7Y H;  3HKB B;  3HKE A;  5LP6 C;  3UT5 A;  1VQN F;  5GON B;  2LBX A;  3WXM B;  3ZO8 A;  4O4J A;  1FFX B;  2UZH A;  2WAL A;  3WGJ A;  1Z5V A;  1IV4 A;  3HJW C;  5LP6 A;  1SZQ A;  3M4S A;  3F0G A;  3TD3 A;  3LWO C;  3HKC A;  5JCO A;  4E6E A;  1T0A A;  5HP8 A;  1VQ4 F;  4LCK A;  5HXZ A;  1QU9 A;  1X7O A;  3CXC F;  3DDN A;  3WGL A;  5G4U C;  3V7Q A;  3VYT C;  3B6N A;  1TUB A;  5EYP A;  4LNU A;  3L7Q A;  5JVD A;  2KG4 A;  4U3J B;  3K2X A;  3PLA C;  3VIU A;  5LOV B;  4O4L A;  1RLG A;  2FC3 A;  2OTM A;  3ZOP A;  4TUY A;  3VOA A;  5FJ4 C;  3D01 A;  2ZOD A;  4ZHY B;  4X1K B;  4TZZ A;  2LBW A;  2FGY A;  1FNJ A;  1JJ2 F;  4FFB A;  1UI9 A;  2RHO A;  3CCL F;  1FNK A;  2OTJ F;  3E22 B;  5J2T A;  4X1Y B;  3HAX D;  3SIV A;  2HVY D;  5EIB C;  3S06 A;  1IV1 A;  1JFF A;  5IJ0 B;  2RHL A;  4F6R A;  3FFM A;  4X1Y A;  5MN5 A;  4O4I A;  2ZOV A;  3CCS F;  5EB1 B;  2PMP A;  4C4W C;  3V4D A;  4BT5 A;  3ESJ A;  2ZVZ A;  1X52 A;  1QVF F;  1OFU A;  2CW4 A;  3MBM A;  3JAS A;  4ZHQ A;  3MDO A;  1U3L A;  2MQE A;  2AMT A;  2Q1Y A;  3UT5 B;  3LWV C;  4PWT A;  2ZVY A;  3F0E A;  4BT4 A;  3WPW A;  3ON1 A;  1N8R H;  3VI6 A;  3P4E A;  4O4L B;  5EWR A;  1M90 H;  3WJQ A;  3RYI B;  4I50 A;  3S02 A;  1GO1 A;  3JVH A;  1SDS A;  3ERN A;  3NMU C;  5FLX M;  5IT9 M;  2KTU A;  4G4X A;  2CHT A;  3OBY A;  3GHZ A;  3WJR A;  2GLZ A;  5HY0 A;  1H7M A;  3V3T A;  4TUY B;  1JY8 A;  4ZHQ B;  1DT9 A;  5GAP K;  5BMV B;  3K12 A;  2UYN B;  2Z01 A;  3C8L A;  3JAL A;  3R0P A;  4BT6 A;  4XCQ A;  1K9M H;  5CB4 A;  4NUT A;  3P0Z A;  2H8C A;  3Q8H A;  2HP3 A;  5EIB D;  4ZI7 B;  1GX1 A;  2K1S A;  3LFO A;  4ZHV A;  1YJW F;  3QUW A;  1VQ7 F;  4O2A B;  1GO0 A;  1ONI A;  3WGK A;  2JNB A;  2I6D A;  5EB0 A;  1VQ5 F;  5IJ9 B;  3KJJ A;  4O4H A;  3JAR B;  4I4T A;  5HY2 A;  1X7P A;  1JN1 A;  5B8F A;  2HS0 A;  3MCA B;  2QEX F;  3FPI A;  1XBI A;  3OON A;  1RA4 A;  3CB2 A;  1RLU A;  2W8B C;  3JAM M;  3K0T A;  2QA4 F;  3J81 M;  2HS3 A;  1KNJ A;  2CSL A;  2R75 1;  3JAW B;  5MN6 A;  4U39 A;  1R1M A;  2VXY A;  3C9S A;  3S0W A;  3JAL B;  2HP0 A;  1JFF B;  1ZWZ A;  5IJ0 A;  3JAW A;  2N48 A;  1W41 A;  3RYC A;  3JAK B;  3F0D A;  4TV8 B;  2HS4 A;  3LWP C;  5ITZ B;  1XV2 A;  3JAT A;  1RQ7 A;  3N4Y A;  1YQN A;  3E22 A;  5DCV A;  1VK3 A;  3I7T A;  2ZF8 A;  4HNA B;  4X1I A;  4EB6 A;  5IYZ A;  1T0K B;  1VQO F;  4TV8 A;  4BVT A;  4WBN A;  5JQG A;  3RE3 A;  2Q1X A;  5KMG A;  1Q81 H;  1TUB B;  3WGM A;  1XHO A;  4IIJ A;  3ZP7 A;  4BT3 A;  1CK2 A;  2Z1F A;  2NMU A;  3RA6 A;  4WBN B;  2OZB A;  3M1X A;  3ELC A;  4DRX A;  1YIT F;  5ITZ A;  1KC8 H;  2GVI A;  4EI8 A;  3CD6 F;  4BVQ A;  3OBW A;  3IEW A;  3JCM M;  3I56 F;  1VQP F;  1E7K A;  3HWU A;  5CA1 B;  1UFY A;  2UYN A;  4B46 A;  4X3L A;  5JCO C;  3N2G A;  2ALE A;  5A2Q M;  2CVL A;  2LBT A;  4DXD A;  3RYI A;  5GAN K;  2OTL F;  2DT4 A;  5C8Y A;  4BT2 A;  3E1Y A;  5JH7 B;  2KTV A;  3KIZ A;  4TV9 B;  5CA0 A;  1YI2 F;  4IHJ B;  5LOV A;  2BTO A;  2OHW A;  4YJ3 B;  3AGK A;  4C8E A;  5MN4 A;  2CHS A;  5LXT A;  5GIN C;  3G71 F;  4RHA A;  5FNV B;  2DYY A;  4G4V A;  3QTY A;  3WPX A;  3CYP B;  2GZL A;  3QHD A;  1VQL F;  1VQK F;  1W2B F;  4O4H B;  1CN7 A;  4R40 B;  3NK6 A;  5IYZ B;  3IR9 A;  1JD1 A;  4YJ2 B;  1K8A H;  4EI9 A;  5HY4 A;  3P10 A;  2YXZ A;  1IPA A;  3CCE F;  1SA0 B;  3VTI C;  4DRX B;  3C9R A;  3MCQ A;  2VGN A;  2H8E A;  5C8Y B;  5J2T B;  3CME F;  3IMP A;  4IIJ B;  4F6R B;  5HWE A;  5CA0 B;  3K14 A;  1W58 1;  2KGW A;  1H47 A;  2CZW A;  3IKE A;  4ERH A;  5LYJ B;  3JAR A;  5EO3 A;  4I4T B;  1W57 A;  1FSZ A;  2YYE A;  4C81 A;  3CMA F;  1KD1 H;  2IAF A;  3RYH A;  3F6M A;  4YJ2 A;  3N2K A;  3RYF B;  4KWE A;  2I6R A;  3S0Y A;  1J7H A;  1W3E X;  2RHH A;  4YJ3 A;  3NVK E;  3JAT B;  3CPW F;  2IG8 A;  1X25 A;  1YGY A;  4X1K A;  5JH7 A;  3PAF A;  3C9U A;  3EOR A;  3J7A R;  3C9T A;  2BO1 A;  2VAM A;  4ZHW A;  5LXT B;  5KX5 A;  3HKD A;  3ZP4 A;  1W5B A;  3LME A;  5FNV A;  3GTZ A;  3CCJ F;  3CCQ F;  1VQM F;  2CWJ A;  1S72 F;  3NK7 A;  5GIP C;  3O85 A;  1QVG F;  3CYQ A;  1FFX A;  1Z5W A;  3OW2 F;  3F0F A;  4O2B B;  2PHN A;  4O4I B;  4BW0 B;  4FFB B;  5GON A;  3VYS C;  3VMF B;  1COM A;  1W5A A;  5HXU A;  5JQG B;  5G4V C;  3LWR C;  5HY1 A;  5J2U A;  3DC2 A;  3WGN A;  2LCA A;  3D54 A;  2F9Z C;  4G4Z A;  3M84 A;  2IQQ A;  1CLI A;  3HTN A;  1GZ0 A;  4I50 B;  4RQO A;  2EWC A;  1M1K H;  1QAH A;  4B62 A;  3RYC B;  2H6L A;  4NWO B;  1RQ2 A;  5CA1 A;  3RA5 A;  5LA6 B;  3IEQ A;  2ZAU A;  3FD5 A;  5CB4 B;  3S03 A;  4BVR A;  5JVD B;  3CPQ A;  5LP6 B;  4X1I B;  4EB6 B;  3LWQ C;  4B45 A;  3CC7 F;  3D00 A;  2RB9 A;  5HP7 A;  5GIO C;  5KX5 B;  3VOB A;  3MQW A;  4C82 A;  3E20 B;  1U3P A;  3JAS B;  2V9Y A;  3KHN A;  3JAK A;  1YJ9 F;  3LDT A;  2UYP A;  1TVK A;  1PF5 A;  4BY9 D;  2L26 A;  3TD4 A;  1VQ8 F;  2HQS C;  5J2U B;  4HNA A;  4U3J A;  1Q82 H;  4X20 B;  4O2A A;  5EZY B;  4B5C A;  1U43 A;  1TVK B;  3VO8 A;  4IHJ A;  3FBA A;  1YJN F;  1NJI H;  1SA0 A;  3TD5 A;  2HRU A;  4ZOL B;  1QD9 A;  3N2G B;  3I55 F;  2VGM A;  2QTP A;  3V7E A;  3U0O A;  2P6Y A;  1XRG A;  3KJK A;  1VHA A;  4G4W A;  1IV3 A;  3SIU A;  1Q8R A;  3FD6 A;  3GYQ A;  3N4Z A;  3NVI B;  3BYQ A;  3CCM F;  2RHJ A;  1W55 A;  1W5E A;  2R6R 1;  1W59 A;  3N2K B;  3RYF A;  4O4J B;  3G6E F;  2BTQ B;  3VCZ A;  5KMG B;  4BVS A;  3WJP A;  2Z1U A;  4X3M A;  1KNK A;  2VAW A;  5LYJ A;  3CCU F;  1OAP A;  4I55 B;  4G4Y A;  1VQ6 F;  1W42 A;  5LA6 A;  1YIJ F;  1W40 A;  2Z1T A;  1IV2 A;  3G4S F;  4EI7 A;  1VH8 A;  5EAZ A;  2BTU A;  1VQV A;  3I3F A; 
#chains in the Genus database with same CATH homology
 3HAX D;  1PXW A;  4BVT A;  3VMF B;  3SIV A;  2HVY D;  3CCR F;  5HXU A;  5G4V C;  2AIF A;  3CCV F;  3LWR C;  5HY1 A;  3CC4 F;  1Q81 H;  3CCS F;  3FFM A;  1CK2 A;  4C4W C;  2F9Z C;  3RA6 A;  1QVF F;  2OZB A;  1X52 A;  1YIT F;  1Q86 H;  1KC8 H;  1GZ0 A;  4EI8 A;  3CD6 F;  4BVQ A;  3LWV C;  1M1K H;  3OBW A;  3JCM M;  3I56 F;  1VQP F;  1YHQ F;  1E7K A;  1N8R H;  4NQ3 A;  3ON1 A;  3RA5 A;  3VI6 A;  2QI2 A;  3CC2 F;  1NMU B;  5EWR A;  1M90 H;  4X3L A;  2ALE A;  5A2Q M;  1VQ9 F;  2OTL F;  5GAN K;  4BVR A;  1GO1 A;  3CPQ A;  3E1Y A;  3LWQ C;  1SDS A;  5FLX M;  3NMU C;  2KTU A;  5IT9 M;  2KTV A;  3CG6 A;  3CC7 F;  3OBY A;  3D00 A;  1YI2 F;  2GLZ A;  2OHW A;  5HY0 A;  1H7M A;  3AGK A;  3V3T A;  5GIO C;  1KQS F;  5GIN C;  3E20 B;  3G71 F;  1DT9 A;  1YJ9 F;  1K73 H;  5GAP K;  3J80 M;  1VQL F;  1VQK F;  4BY9 D;  1W2B F;  1Q7Y H;  1CN7 A;  4XCQ A;  1K9M H;  3NK6 A;  4NUT A;  1VQ8 F;  3IR9 A;  1Q82 H;  1VQN F;  1K8A H;  4EI9 A;  1YJN F;  2LBX A;  5HY4 A;  1NJI H;  1IPA A;  3CCE F;  3LFO A;  3WXM B;  1YJW F;  2VGN A;  3CME F;  1VQ7 F;  3I55 F;  5HWE A;  1GO0 A;  2WAL A;  2VGM A;  3V7E A;  2CZW A;  2JNB A;  3HJW C;  2I6D A;  1VQ5 F;  3SIU A;  5EO3 A;  5HY2 A;  3LWO C;  1X7P A;  1VQ4 F;  4LCK A;  5HXZ A;  3CMA F;  1X7O A;  3GYQ A;  3MCA B;  3N4Z A;  3CXC F;  2QEX F;  1KD1 H;  3NVI B;  3CCM F;  5G4U C;  3V7Q A;  1XBI A;  3G6E F;  1RA4 A;  1W3E X;  3JAM M;  2QA4 F;  3NVK E;  3J81 M;  3CPW F;  4BVS A;  3PAF A;  2KG4 A;  4X3M A;  3J7A R;  3PLA C;  2BO1 A;  3CCU F;  1RLG A;  2FC3 A;  1ZWZ A;  5FJ4 C;  4TZZ A;  1W41 A;  2FGY A;  2LBW A;  1VQ6 F;  1W42 A;  1JJ2 F;  3CCJ F;  3CCQ F;  1VQM F;  3LWP C;  3CCL F;  1YIJ F;  1S72 F;  1W40 A;  3NK7 A;  5GIP C;  3N4Y A;  3O85 A;  3G4S F;  2OTJ F;  4EI7 A;  5DCV A;  1QVG F;  3OW2 F;  1T0K B;  1VQO F;  4BW0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...