3CCEF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cceF00
4TZZA 1M1KH 1VQKF 2HVYD 1Q7YH 3RA5A 1VQPF 1YHQF 2OTLF 4C4WC 3J7AR 5EWRA 1W2BF 5GIPC 3LWQC 1VQMF 1K8AH 5G4UC 5IT9M 1W42A 3SIUA 3V7QA 5DCVA 3OW2F 4BY9D 1H7MA 1Q81H 3N4YA 3HAXD 2QI2A 3PLAC 1RLGA 5FLXM 1CN7A 3RA6A 3I55F 2LBWA 1PXWA 3J81M 3V7EA 2VGMA 1K73H 3CMAF 3PAFA 3CCRF 3JAMM 1T0KB 3GYQA 1XBIA 1YIJF 1W3EX 1VQ9F 2CZWA 3CCUF 5GINC 3CC7F 1VQ4F 3VMFB 2JNBA 1NMUB 4X3MA 3CCSF 1NJIH 1X7OA 1VQOF 5GIOC 2ALEA 3OBYA 2I6DA 3HJWC 3CCVF 1VQNF 1QVGF 2LBXA 1KQSF 3JCMM 1W41A 1E7KA 1S72F 1GO1A 1W40A 3LWRC 3FFMA 3NK7A 1IPAA 3I56F 2QEXF 2KTVA 3VI6A 3MCAB 5G4VC 3CPQA 2AIFA 2BO1A 2OZBA 1YI2F 2OHWA 3NK6A 3AGKA 5A2QM 1DT9A 1KD1H 1VQLF 1CK2A 3G6EF 4LCKA 1VQ6F 1X7PA 3LFOA 3E1YA 2QA4F 1X52A 5EO3A 3CCMF 3OBWA 1ZWZA 1M90H 3CPWF 3CCEF 3LWOC 3SIVA 3CC4F 3J80M 3CMEF 1SDSA 3LWVC 1YJ9F 1RA4A 3WXMB 3CCLF 1VQ8F 3CG6A 2FC3A 3LWPC 3CXCF 3NVIB 2KTUA 1KC8H 3NVKE 5GANK 3N4ZA 1VQ5F 5FJ4C 3G71F 1K9MH 2OTJF 4NUTA 1Q82H 1YJWF 1Q86H 1VQ7F 3O85A 2VGNA 3CD6F 1GO0A 1QVFF 2WALA 3ON1A 1YJNF 3E20B 1GZ0A 3G4SF 1N8RH 3IR9A 4X3LA 3CC2F 2KG4A 3CCJF 1YITF 1JJ2F 4BW0B 3NMUC 5GAPK 3CCQF
chains in the Genus database with same CATH superfamily
2ZF8A 4G4XA 5EB0A 2HVYD 2HP0B 3MQWA 1W5FA 3J7AR 1VHAA 3HKBA 1W2BF 5GIPC 3LWQC 5IT9M 5IYZB 5B8FA 3GHZA 4KWEA 3Q8HA 3JATB 5DCVA 1QU9A 3DDNA 5ITZA 1VQVA 1SA0A 3JARA 1TVKB 4O2AB 3VOBA 2QI2A 3VCZA 5IJ0B 2GZLA 3T80A 1CN7A 3RA6A 2HS3A 3JAKA 3I55F 2V9YA 2Z01A 4R40B 3RYFB 3C9TA 3IKEA 3CMAF 3I7TA 5LA6B 4X1KB 2N48A 1T0AA 3R0PA 3C9SA 3F0FA 1RQ2A 3CCUF 4BT5A 1QAHA 3ESJA 4O4IA 4ZOLA 3HKEA 4O2BA 5EIBD 1X7OA 1VQOF 4ZHYB 4ZI7A 1DBFA 4O4LB 2H8CA 3OBYA 3WGJA 4WBNA 3D01A 4EI7A 1QVGF 3E22B 3RYIA 5CB4B 5KMGB 3LWRC 2CWJA 1H48A 3I56F 1W5AA 2RHLA 1KNJA 2KGWA 2HS4A 1FFXA 1JFFA 3CPQA 2B33A 2BO1A 2PHNA 2OZBA 2OHWA 4F6RB 3NK6A 5A2QM 3RYHA 1CK2A 3N2KA 4EI8A 5CA1A 3KE1A 3TD3A 2R751 4TV9A 3LFOA 3F0DA 2ZVYA 3HKDB 4I4TA 2QA4F 3P10A 1XV2A 5EO3A 5LP6A 1M90H 4YJ2B 2MQEA 1XHOA 2AIZP 3IEQA 2BTOA 4NWOB 3LWVC 3K14A 3WXMB 3CYPB 5LXTA 4I50B 3QHDA 4X1YA 3CG6A 1VQ8F 1NQ3A 3P0ZA 5IJ9A 3KHNA 4C82A 5GANK 3N4ZA 5GONB 3V4DA 5EAZA 1VQ5F 5FJ4C 3G71F 3L7QA 5HP7A 4O4HB 3VYUC 1IV2A 1Q86H 3MDOA 2VGNA 1JD1A 3ZP4A 3UT5B 2WALA 2NMUA 1YJNF 1Q8RA 3E20B 4IHJA 3D00A 2HRUA 3S0HA 3U0OA 3CC2F 2KG4A 1YITF 3N2GA 4BW0B 4DRXB 5J2TB 3CCQF 4I55A 5JQGB 2HQSC 5MN5A 1VQKF 2EWCA 5EYPA 1Q7YH 1W5BA 1VQPF 4HNAA 1Z5VA 5JH7A 5EIBC 3F0GA 3KIZA 4YJ3A 4TUYA 5JVDA 4ZHWA 5BMVA 4FFBB 3DC2A 1GX1A 3FD6A 3N4YA 4X1IA 3JALB 3MCQA 5FLXM 3HWUA 5KX5A 4ZHQA 1PXWA 2VXYA 3M1XA 5LP6C 4O4JA 2VGMA 1K73H 3D54A 3PAFA 3WGKA 3GYQA 3VOAA 1TUBB 1W57A 4G4YA 1FNJA 1VQ4F 2JNBA 1NMUB 3S0YA 3S0WA 2Z1FA 4X3MA 5IYZA 3CCSF 1NJIH 2I6RA 2L26A 3ELCA 3WJPA 3TD4A 4EI9A 5GIOC 3HJWC 3LMEA 4IIJA 3VO8A 1W41A 1E7KA 1GO1A 1TVKA 1W40A 4U39A 3FFMA 3M84A 4U3JB 5IJ0A 2QEXF 2KTVA 3VI6A 5ITZB 4BT4A 2AIFA 4PWTA 4G4ZA 5HY0A 1KD1H 2HP3A 4LNUA 5LA6A 2LBTA 4BVQA 1VQ6F 2OTMA 3WGNA 3CCMF 3OBWA 2R6R1 3LWOC 2UYKA 2G9IA 3HKCB 3J80M 2Z1TA 2ZODA 1SDSA 1YJ9F 2VAPA 4M8IA 3WJRA 3LWPC 3CXCF 5EZYB 3NVKE 4O2BB 3I3FA 5HXUA 4X20B 5CB4A 1Q82H 1YJWF 5KMGA 4WBNB 1VK3A 3CD6F 3FPIA 5HY1A 2HRYA 3WJQA 1XRGA 4TV8B 4F6RA 5LOVA 4B62A 4C8GA 1ODEA 3QUWA 1H47A 3CCJF 1W55A 1JJ2F 3NMUC 2VAWA 3K0TA 2RHHA 4TZZA 1M1KH 3HKDA 2CSLA 1W59A 2PMPA 4YJ2A 1YHQF 2OTLF 4C4WC 3RYHB 1SZQA 2UYNB 5C8YB 3JASB 4TV9B 1VQMF 1K8AH 2CHTA 4BT6A 1W42A 4BVTA 4I50A 3GTZA 2P6YA 4RHAA 4BT3A 3SIUA 2Z1EA 3C9UA 3OW2F 5J2UA 5GONA 4G4VA 3S06A 1ONIA 3S03A 2W8BC 3JVHA 5LXTB 4BY9D 2Q1YA 1Q81H 3HAXD 1YGYA 3UT5A 5LYJB 5FNVB 1RLGA 2LCAA 2CVLA 4BVSA 4BT7A 3S02A 5HP8A 2LBWA 2RB9A 4E6EA 3J81M 3V7EA 3M4SA 1UFYA 4EB6B 4B45A 5JQGA 3JAMM 1T0KB 1OAPA 3V3TA 3JAWB 1XBIA 1YIJF 1W3EX 5AVMA 2CZWA 2RHOA 3VYTC 3B6NA 4FFBA 3FD5A 1JN1A 2ALEA 5MN4A 1Z5WA 2LBXA 4TUYB 1RQ7A 5BMVB 3K12A 3QTYA 3CB2A 4ERHA 5HY2A 2UYPA 3KJJA 3VIUA 4BT2A 5MN6A 1IPAA 5CA0B 3RYCA 3MCAB 1R1MA 2VAMA 1YI2F 4G88A 2HP0A 4ZK7A 4C8IA 1VH8A 1VQLF 5JCOA 3G6EF 4LCKA 3ZOPA 3IMPA 1TUBA 1QD9A 1X7PA 2RHJA 3IKFA 3CCEF 2Q1XA 3JATA 3CC4F 3SIVA 3HKBB 1PF5A 1JY8A 3CMEF 1RA4A 3CCLF 3TD5A 2FC3A 3NVIB 4O2AA 2CW4A 2GVIA 2OTJF 1U40A 2GLZA 1SA0B 3JARB 2UYJA 3VTIC 3RYFA 4U3JA 5HY4A 3ON1A 3F6MA 3MBMA 4IIJB 4X1KA 3BYQA 3ERNA 1GZ0A 2ZAUA 3JAKB 3G4SF 1J7HA 3IR9A 4X3LA 2BTUA 3WGLA 1U3PA 1FNKA 2IQQA 2YYEA 3RA5A 4O4LA 5EB1B 5HWEA 2HX0A 1U43A 3HKCA 1CLIA 4LNUB 5EWRA 4B46A 4O4IB 4ZOLB 3HKEB 5G4UC 3E22A 4ZI7B 3C9RA 1IV4A 1OFUA 2FGYA 3V7QA 5EZYA 4NQ3A 4B5CA 2Z1UA 4X20A 1IV1A 1H7MA 3RYIB 5HXZA 3IEWA 3C8LA 1YQNA 5JCOC 3PLAC 2HS0A 3ZP7A 1FFXB 1JFFB 4TV8A 1U3LA 2AMTA 3CCRF 3N2KB 2IAFA 5CA1B 4ZHVA 5LOVB 4I4TB 1VQ9F 1W5EA 5LP6B 1IV3A 5GINC 3CC7F 4DXDA 1COMA 2UYNA 3VMFB 5C8YA 3JASA 2BTQB 3CYQA 2ZOVA 4G4WA 4O4HA 1W581 4X1YB 2I6DA 3WGMA 3CCVF 1VQNF 5IJ9B 1FSZA 1X25A 1KQSF 3JCMM 1KNKA 1S72F 2CHSA 4RQOA 2K1SA 3NK7A 5LYJA 5J2UB 5FNVA 1RLUA 4DRXA 5J2TA 4C8EA 5G4VC 4IHJB 2IG8A 3AGKA 3WPXA 3N2GB 1DT9A 4EB6A 3LDTA 2DT4A 4I55B 3JAWA 4XCQA 3ZO8A 2YXZA 3E1YA 2F9ZC 1X52A 5EYPB 3P4EA 1ZWZA 3CPWF 3OONA 4HNAB 2ZVZA 3VYSC 1UI9A 5JH7B 2UZHA 2DYYA 4YJ3B 5JVDB 2QTPA 3HTNA 2KTUA 3FBAA 1KC8H 3JALA 3RE3A 3LYBA 3WPWA 1K9MH 4NUTA 4C81A 3F0EA 1VQ7F 3O85A 1GO0A 4X1IB 1QVFF 4BVRA 5CA0A 5KX5B 1N8RH 2H6LA 4ZHQB 4O4JB 3KJKA 3K2XA 2H8EA 3EORA 5GAPK 3RYCB
chains in the Genus database with same CATH topology
4TZZA 1M1KH 1VQKF 2HVYD 1Q7YH 3RA5A 5HWEA 1VQPF 1YHQF 2OTLF 4C4WC 3J7AR 5EWRA 1W2BF 5GIPC 3LWQC 1VQMF 1K8AH 5G4UC 5IT9M 1W42A 4BVTA 3SIUA 2FGYA 3V7QA 5DCVA 3OW2F 4NQ3A 4BY9D 1H7MA 1Q81H 3N4YA 5HXZA 3HAXD 2QI2A 3PLAC 1RLGA 5FLXM 1CN7A 3RA6A 4BVSA 3I55F 2LBWA 1PXWA 3J81M 3V7EA 2VGMA 1K73H 3CMAF 3PAFA 3CCRF 3JAMM 1T0KB 3V3TA 3GYQA 1XBIA 1YIJF 1W3EX 1VQ9F 2CZWA 3CCUF 5GINC 3CC7F 1VQ4F 3VMFB 2JNBA 1NMUB 4X3MA 3CCSF 1NJIH 1X7OA 1VQOF 4EI9A 5GIOC 2ALEA 3OBYA 2I6DA 3HJWC 3CCVF 1VQNF 4EI7A 1QVGF 2LBXA 1KQSF 3JCMM 1W41A 1E7KA 5HY2A 1S72F 1GO1A 1W40A 3LWRC 3FFMA 3NK7A 1IPAA 3I56F 2QEXF 2KTVA 3VI6A 3MCAB 5G4VC 3CPQA 2AIFA 2BO1A 2OZBA 1YI2F 2OHWA 3NK6A 5HY0A 3AGKA 5A2QM 1DT9A 1KD1H 1VQLF 1CK2A 3G6EF 4LCKA 4EI8A 4XCQA 4BVQA 1VQ6F 1X7PA 3LFOA 3E1YA 2F9ZC 1X52A 2QA4F 5EO3A 3CCMF 3OBWA 1ZWZA 1M90H 3CPWF 3CCEF 3LWOC 3SIVA 3CC4F 3J80M 3CMEF 1SDSA 3LWVC 1YJ9F 1RA4A 3WXMB 3CCLF 1VQ8F 3CG6A 2FC3A 3LWPC 3CXCF 3NVIB 2KTUA 1KC8H 3NVKE 5GANK 3N4ZA 1VQ5F 5FJ4C 3G71F 5HXUA 1K9MH 2OTJF 4NUTA 1Q82H 2GLZA 1YJWF 1Q86H 1VQ7F 3O85A 2VGNA 3CD6F 5HY1A 1GO0A 1QVFF 2WALA 5HY4A 3ON1A 4BVRA 1YJNF 3E20B 1GZ0A 3D00A 3G4SF 1N8RH 3IR9A 4X3LA 3CC2F 2KG4A 3CCJF 1YITF 1JJ2F 4BW0B 3NMUC 5GAPK 3CCQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZZ A;  1M1K H;  1VQK F;  2HVY D;  1Q7Y H;  3RA5 A;  1VQP F;  1YHQ F;  2OTL F;  4C4W C;  3J7A R;  5EWR A;  1W2B F;  5GIP C;  3LWQ C;  1VQM F;  1K8A H;  5G4U C;  5IT9 M;  1W42 A;  3SIU A;  3V7Q A;  5DCV A;  3OW2 F;  4BY9 D;  1H7M A;  1Q81 H;  3N4Y A;  3HAX D;  2QI2 A;  3PLA C;  1RLG A;  5FLX M;  1CN7 A;  3RA6 A;  3I55 F;  2LBW A;  1PXW A;  3J81 M;  3V7E A;  2VGM A;  1K73 H;  3CMA F;  3PAF A;  3CCR F;  3JAM M;  1T0K B;  3GYQ A;  1XBI A;  1YIJ F;  1W3E X;  1VQ9 F;  2CZW A;  3CCU F;  5GIN C;  3CC7 F;  1VQ4 F;  3VMF B;  2JNB A;  1NMU B;  4X3M A;  3CCS F;  1NJI H;  1X7O A;  1VQO F;  5GIO C;  2ALE A;  3OBY A;  2I6D A;  3HJW C;  3CCV F;  1VQN F;  1QVG F;  2LBX A;  1KQS F;  3JCM M;  1W41 A;  1E7K A;  1S72 F;  1GO1 A;  1W40 A;  3LWR C;  3FFM A;  3NK7 A;  1IPA A;  3I56 F;  2QEX F;  2KTV A;  3VI6 A;  3MCA B;  5G4V C;  3CPQ A;  2AIF A;  2BO1 A;  2OZB A;  1YI2 F;  2OHW A;  3NK6 A;  3AGK A;  5A2Q M;  1DT9 A;  1KD1 H;  1VQL F;  1CK2 A;  3G6E F;  4LCK A;  1VQ6 F;  1X7P A;  3LFO A;  3E1Y A;  2QA4 F;  1X52 A;  5EO3 A;  3CCM F;  3OBW A;  1ZWZ A;  1M90 H;  3CPW F;  3CCE F;  3LWO C;  3SIV A;  3CC4 F;  3J80 M;  3CME F;  1SDS A;  3LWV C;  1YJ9 F;  1RA4 A;  3WXM B;  3CCL F;  1VQ8 F;  3CG6 A;  2FC3 A;  3LWP C;  3CXC F;  3NVI B;  2KTU A;  1KC8 H;  3NVK E;  5GAN K;  3N4Z A;  1VQ5 F;  5FJ4 C;  3G71 F;  1K9M H;  2OTJ F;  4NUT A;  1Q82 H;  1YJW F;  1Q86 H;  1VQ7 F;  3O85 A;  2VGN A;  3CD6 F;  1GO0 A;  1QVF F;  2WAL A;  3ON1 A;  1YJN F;  3E20 B;  1GZ0 A;  3G4S F;  1N8R H;  3IR9 A;  4X3L A;  3CC2 F;  2KG4 A;  3CCJ F;  1YIT F;  1JJ2 F;  4BW0 B;  3NMU C;  5GAP K;  3CCQ F; 
#chains in the Genus database with same CATH topology
 2ZF8 A;  4G4X A;  5EB0 A;  2HVY D;  2HP0 B;  3MQW A;  1W5F A;  3J7A R;  1VHA A;  3HKB A;  1W2B F;  5GIP C;  3LWQ C;  5IT9 M;  5IYZ B;  5B8F A;  3GHZ A;  4KWE A;  3Q8H A;  3JAT B;  5DCV A;  1QU9 A;  3DDN A;  5ITZ A;  1VQV A;  1SA0 A;  3JAR A;  1TVK B;  4O2A B;  3VOB A;  2QI2 A;  3VCZ A;  5IJ0 B;  2GZL A;  3T80 A;  1CN7 A;  3RA6 A;  2HS3 A;  3JAK A;  3I55 F;  2V9Y A;  2Z01 A;  4R40 B;  3RYF B;  3C9T A;  3IKE A;  3CMA F;  3I7T A;  5LA6 B;  4X1K B;  2N48 A;  1T0A A;  3R0P A;  3C9S A;  3F0F A;  1RQ2 A;  3CCU F;  4BT5 A;  1QAH A;  3ESJ A;  4O4I A;  4ZOL A;  3HKE A;  4O2B A;  5EIB D;  1X7O A;  1VQO F;  4ZHY B;  4ZI7 A;  1DBF A;  4O4L B;  2H8C A;  3OBY A;  3WGJ A;  4WBN A;  3D01 A;  4EI7 A;  1QVG F;  3E22 B;  3RYI A;  5CB4 B;  5KMG B;  3LWR C;  2CWJ A;  1H48 A;  3I56 F;  1W5A A;  2RHL A;  1KNJ A;  2KGW A;  2HS4 A;  1FFX A;  1JFF A;  3CPQ A;  2B33 A;  2BO1 A;  2PHN A;  2OZB A;  2OHW A;  4F6R B;  3NK6 A;  5A2Q M;  3RYH A;  1CK2 A;  3N2K A;  4EI8 A;  5CA1 A;  3KE1 A;  3TD3 A;  2R75 1;  4TV9 A;  3LFO A;  3F0D A;  2ZVY A;  3HKD B;  4I4T A;  2QA4 F;  3P10 A;  1XV2 A;  5EO3 A;  5LP6 A;  1M90 H;  4YJ2 B;  2MQE A;  1XHO A;  2AIZ P;  3IEQ A;  2BTO A;  4NWO B;  3LWV C;  3K14 A;  3WXM B;  3CYP B;  5LXT A;  4I50 B;  3QHD A;  4X1Y A;  3CG6 A;  1VQ8 F;  1NQ3 A;  3P0Z A;  5IJ9 A;  3KHN A;  4C82 A;  5GAN K;  3N4Z A;  5GON B;  3V4D A;  5EAZ A;  1VQ5 F;  5FJ4 C;  3G71 F;  3L7Q A;  5HP7 A;  4O4H B;  3VYU C;  1IV2 A;  1Q86 H;  3MDO A;  2VGN A;  1JD1 A;  3ZP4 A;  3UT5 B;  2WAL A;  2NMU A;  1YJN F;  1Q8R A;  3E20 B;  4IHJ A;  3D00 A;  2HRU A;  3S0H A;  3U0O A;  3CC2 F;  2KG4 A;  1YIT F;  3N2G A;  4BW0 B;  4DRX B;  5J2T B;  3CCQ F;  4I55 A;  5JQG B;  2HQS C;  5MN5 A;  1VQK F;  2EWC A;  5EYP A;  1Q7Y H;  1W5B A;  1VQP F;  4HNA A;  1Z5V A;  5JH7 A;  5EIB C;  3F0G A;  3KIZ A;  4YJ3 A;  4TUY A;  5JVD A;  4ZHW A;  5BMV A;  4FFB B;  3DC2 A;  1GX1 A;  3FD6 A;  3N4Y A;  4X1I A;  3JAL B;  3MCQ A;  5FLX M;  3HWU A;  5KX5 A;  4ZHQ A;  1PXW A;  2VXY A;  3M1X A;  5LP6 C;  4O4J A;  2VGM A;  1K73 H;  3D54 A;  3PAF A;  3WGK A;  3GYQ A;  3VOA A;  1TUB B;  1W57 A;  4G4Y A;  1FNJ A;  1VQ4 F;  2JNB A;  1NMU B;  3S0Y A;  3S0W A;  2Z1F A;  4X3M A;  5IYZ A;  3CCS F;  1NJI H;  2I6R A;  2L26 A;  3ELC A;  3WJP A;  3TD4 A;  4EI9 A;  5GIO C;  3HJW C;  3LME A;  4IIJ A;  3VO8 A;  1W41 A;  1E7K A;  1GO1 A;  1TVK A;  1W40 A;  4U39 A;  3FFM A;  3M84 A;  4U3J B;  5IJ0 A;  2QEX F;  2KTV A;  3VI6 A;  5ITZ B;  4BT4 A;  2AIF A;  4PWT A;  4G4Z A;  5HY0 A;  1KD1 H;  2HP3 A;  4LNU A;  5LA6 A;  2LBT A;  4BVQ A;  1VQ6 F;  2OTM A;  3WGN A;  3CCM F;  3OBW A;  2R6R 1;  3LWO C;  2UYK A;  2G9I A;  3HKC B;  3J80 M;  2Z1T A;  2ZOD A;  1SDS A;  1YJ9 F;  2VAP A;  4M8I A;  3WJR A;  3LWP C;  3CXC F;  5EZY B;  3NVK E;  4O2B B;  3I3F A;  5HXU A;  4X20 B;  5CB4 A;  1Q82 H;  1YJW F;  5KMG A;  4WBN B;  1VK3 A;  3CD6 F;  3FPI A;  5HY1 A;  2HRY A;  3WJQ A;  1XRG A;  4TV8 B;  4F6R A;  5LOV A;  4B62 A;  4C8G A;  1ODE A;  3QUW A;  1H47 A;  3CCJ F;  1W55 A;  1JJ2 F;  3NMU C;  2VAW A;  3K0T A;  2RHH A;  4TZZ A;  1M1K H;  3HKD A;  2CSL A;  1W59 A;  2PMP A;  4YJ2 A;  1YHQ F;  2OTL F;  4C4W C;  3RYH B;  1SZQ A;  2UYN B;  5C8Y B;  3JAS B;  4TV9 B;  1VQM F;  1K8A H;  2CHT A;  4BT6 A;  1W42 A;  4BVT A;  4I50 A;  3GTZ A;  2P6Y A;  4RHA A;  4BT3 A;  3SIU A;  2Z1E A;  3C9U A;  3OW2 F;  5J2U A;  5GON A;  4G4V A;  3S06 A;  1ONI A;  3S03 A;  2W8B C;  3JVH A;  5LXT B;  4BY9 D;  2Q1Y A;  1Q81 H;  3HAX D;  1YGY A;  3UT5 A;  5LYJ B;  5FNV B;  1RLG A;  2LCA A;  2CVL A;  4BVS A;  4BT7 A;  3S02 A;  5HP8 A;  2LBW A;  2RB9 A;  4E6E A;  3J81 M;  3V7E A;  3M4S A;  1UFY A;  4EB6 B;  4B45 A;  5JQG A;  3JAM M;  1T0K B;  1OAP A;  3V3T A;  3JAW B;  1XBI A;  1YIJ F;  1W3E X;  5AVM A;  2CZW A;  2RHO A;  3VYT C;  3B6N A;  4FFB A;  3FD5 A;  1JN1 A;  2ALE A;  5MN4 A;  1Z5W A;  2LBX A;  4TUY B;  1RQ7 A;  5BMV B;  3K12 A;  3QTY A;  3CB2 A;  4ERH A;  5HY2 A;  2UYP A;  3KJJ A;  3VIU A;  4BT2 A;  5MN6 A;  1IPA A;  5CA0 B;  3RYC A;  3MCA B;  1R1M A;  2VAM A;  1YI2 F;  4G88 A;  2HP0 A;  4ZK7 A;  4C8I A;  1VH8 A;  1VQL F;  5JCO A;  3G6E F;  4LCK A;  3ZOP A;  3IMP A;  1TUB A;  1QD9 A;  1X7P A;  2RHJ A;  3IKF A;  3CCE F;  2Q1X A;  3JAT A;  3CC4 F;  3SIV A;  3HKB B;  1PF5 A;  1JY8 A;  3CME F;  1RA4 A;  3CCL F;  3TD5 A;  2FC3 A;  3NVI B;  4O2A A;  2CW4 A;  2GVI A;  2OTJ F;  1U40 A;  2GLZ A;  1SA0 B;  3JAR B;  2UYJ A;  3VTI C;  3RYF A;  4U3J A;  5HY4 A;  3ON1 A;  3F6M A;  3MBM A;  4IIJ B;  4X1K A;  3BYQ A;  3ERN A;  1GZ0 A;  2ZAU A;  3JAK B;  3G4S F;  1J7H A;  3IR9 A;  4X3L A;  2BTU A;  3WGL A;  1U3P A;  1FNK A;  2IQQ A;  2YYE A;  3RA5 A;  4O4L A;  5EB1 B;  5HWE A;  2HX0 A;  1U43 A;  3HKC A;  1CLI A;  4LNU B;  5EWR A;  4B46 A;  4O4I B;  4ZOL B;  3HKE B;  5G4U C;  3E22 A;  4ZI7 B;  3C9R A;  1IV4 A;  1OFU A;  2FGY A;  3V7Q A;  5EZY A;  4NQ3 A;  4B5C A;  2Z1U A;  4X20 A;  1IV1 A;  1H7M A;  3RYI B;  5HXZ A;  3IEW A;  3C8L A;  1YQN A;  5JCO C;  3PLA C;  2HS0 A;  3ZP7 A;  1FFX B;  1JFF B;  4TV8 A;  1U3L A;  2AMT A;  3CCR F;  3N2K B;  2IAF A;  5CA1 B;  4ZHV A;  5LOV B;  4I4T B;  1VQ9 F;  1W5E A;  5LP6 B;  1IV3 A;  5GIN C;  3CC7 F;  4DXD A;  1COM A;  2UYN A;  3VMF B;  5C8Y A;  3JAS A;  2BTQ B;  3CYQ A;  2ZOV A;  4G4W A;  4O4H A;  1W58 1;  4X1Y B;  2I6D A;  3WGM A;  3CCV F;  1VQN F;  5IJ9 B;  1FSZ A;  1X25 A;  1KQS F;  3JCM M;  1KNK A;  1S72 F;  2CHS A;  4RQO A;  2K1S A;  3NK7 A;  5LYJ A;  5J2U B;  5FNV A;  1RLU A;  4DRX A;  5J2T A;  4C8E A;  5G4V C;  4IHJ B;  2IG8 A;  3AGK A;  3WPX A;  3N2G B;  1DT9 A;  4EB6 A;  3LDT A;  2DT4 A;  4I55 B;  3JAW A;  4XCQ A;  3ZO8 A;  2YXZ A;  3E1Y A;  2F9Z C;  1X52 A;  5EYP B;  3P4E A;  1ZWZ A;  3CPW F;  3OON A;  4HNA B;  2ZVZ A;  3VYS C;  1UI9 A;  5JH7 B;  2UZH A;  2DYY A;  4YJ3 B;  5JVD B;  2QTP A;  3HTN A;  2KTU A;  3FBA A;  1KC8 H;  3JAL A;  3RE3 A;  3LYB A;  3WPW A;  1K9M H;  4NUT A;  4C81 A;  3F0E A;  1VQ7 F;  3O85 A;  1GO0 A;  4X1I B;  1QVF F;  4BVR A;  5CA0 A;  5KX5 B;  1N8R H;  2H6L A;  4ZHQ B;  4O4J B;  3KJK A;  3K2X A;  2H8E A;  3EOR A;  5GAP K;  3RYC B; 
#chains in the Genus database with same CATH homology
 4TZZ A;  1M1K H;  1VQK F;  2HVY D;  1Q7Y H;  3RA5 A;  5HWE A;  1VQP F;  1YHQ F;  2OTL F;  4C4W C;  3J7A R;  5EWR A;  1W2B F;  5GIP C;  3LWQ C;  1VQM F;  1K8A H;  5G4U C;  5IT9 M;  1W42 A;  4BVT A;  3SIU A;  2FGY A;  3V7Q A;  5DCV A;  3OW2 F;  4NQ3 A;  4BY9 D;  1H7M A;  1Q81 H;  3N4Y A;  5HXZ A;  3HAX D;  2QI2 A;  3PLA C;  1RLG A;  5FLX M;  1CN7 A;  3RA6 A;  4BVS A;  3I55 F;  2LBW A;  1PXW A;  3J81 M;  3V7E A;  2VGM A;  1K73 H;  3CMA F;  3PAF A;  3CCR F;  3JAM M;  1T0K B;  3V3T A;  3GYQ A;  1XBI A;  1YIJ F;  1W3E X;  1VQ9 F;  2CZW A;  3CCU F;  5GIN C;  3CC7 F;  1VQ4 F;  3VMF B;  2JNB A;  1NMU B;  4X3M A;  3CCS F;  1NJI H;  1X7O A;  1VQO F;  4EI9 A;  5GIO C;  2ALE A;  3OBY A;  2I6D A;  3HJW C;  3CCV F;  1VQN F;  4EI7 A;  1QVG F;  2LBX A;  1KQS F;  3JCM M;  1W41 A;  1E7K A;  5HY2 A;  1S72 F;  1GO1 A;  1W40 A;  3LWR C;  3FFM A;  3NK7 A;  1IPA A;  3I56 F;  2QEX F;  2KTV A;  3VI6 A;  3MCA B;  5G4V C;  3CPQ A;  2AIF A;  2BO1 A;  2OZB A;  1YI2 F;  2OHW A;  3NK6 A;  5HY0 A;  3AGK A;  5A2Q M;  1DT9 A;  1KD1 H;  1VQL F;  1CK2 A;  3G6E F;  4LCK A;  4EI8 A;  4XCQ A;  4BVQ A;  1VQ6 F;  1X7P A;  3LFO A;  3E1Y A;  2F9Z C;  1X52 A;  2QA4 F;  5EO3 A;  3CCM F;  3OBW A;  1ZWZ A;  1M90 H;  3CPW F;  3CCE F;  3LWO C;  3SIV A;  3CC4 F;  3J80 M;  3CME F;  1SDS A;  3LWV C;  1YJ9 F;  1RA4 A;  3WXM B;  3CCL F;  1VQ8 F;  3CG6 A;  2FC3 A;  3LWP C;  3CXC F;  3NVI B;  2KTU A;  1KC8 H;  3NVK E;  5GAN K;  3N4Z A;  1VQ5 F;  5FJ4 C;  3G71 F;  5HXU A;  1K9M H;  2OTJ F;  4NUT A;  1Q82 H;  2GLZ A;  1YJW F;  1Q86 H;  1VQ7 F;  3O85 A;  2VGN A;  3CD6 F;  5HY1 A;  1GO0 A;  1QVF F;  2WAL A;  5HY4 A;  3ON1 A;  4BVR A;  1YJN F;  3E20 B;  1GZ0 A;  3D00 A;  3G4S F;  1N8R H;  3IR9 A;  4X3L A;  3CC2 F;  2KG4 A;  3CCJ F;  1YIT F;  1JJ2 F;  4BW0 B;  3NMU C;  5GAP K;  3CCQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...