3CCEF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cceF00
3VMFB 3AGKA 1YI2F 1VQ7F 3OBWA 3CMAF 2I6DA 1NJIH 3CCQF 3O85A 5GIPC 1VQ4F 3HAXD 1VQLF 1VQ5F 3NK7A 3G6EF 1W40A 1GO0A 2LBWA 2KTVA 1Q7YH 4C4WC 5A2QM 2WALA 4X3LA 3LFOA 5GIOC 2OTLF 1VQ9F 4BY9D 1X7OA 2LBXA 3PAFA 2ALEA 1NMUB 1KC8H 3CCEF 3FFMA 1VQ6F 3CMEF 3PLAC 1GZ0A 1YIJF 3N4ZA 1W41A 3JAMM 1YHQF 3J81M 4NUTA 5EO3A 1QVGF 3ON1A 1SDSA 4LCKA 3GYQA 3JCMM 5GANK 4BW0B 3CPWF 1S72F 1VQ8F 1YITF 1GO1A 4X3MA 2VGMA 1X52A 2FC3A 5EWRA 1M90H 3NK6A 1CN7A 1RA4A 2JNBA 3G4SF 3N4YA 1E7KA 1XBIA 5IT9M 3LWOC 3VI6A 3CC7F 3I55F 3J7AR 5GINC 3HJWC 3RA5A 3NMUC 3CC2F 1W3EX 2KTUA 1VQPF 1QVFF 2VGNA 3OBYA 3CC4F 3V7EA 1T0KB 3J80M 2QEXF 5GAPK 3RA6A 3I56F 1YJNF 4TZZA 5FLXM 1JJ2F 3NVKE 2BO1A 2OTJF 3G71F 2QI2A 2QA4F 1YJ9F 1W2BF 3LWRC 1PXWA 3CCVF 2OZBA 3WXMB 5G4VC 3CCSF 3IR9A 1K73H 3LWVC 3SIUA 1YJWF 3CXCF 3LWQC 3CD6F 2KG4A 3CCJF 1K8AH 2HVYD 1ZWZA 1VQMF 2OHWA 2CZWA 1K9MH 1VQKF 2AIFA 3MCAB 3LWPC 1VQNF 3E20B 3SIVA 1X7PA 3E1YA 1VQOF 3OW2F 1W42A 3CCLF 1KQSF 3CCUF 1Q86H 5DCVA 1N8RH 5FJ4C 1Q81H 1DT9A 3CCRF 3V7QA 3CCMF 5G4UC 1M1KH 1H7MA 3CG6A 3CPQA 1Q82H 1IPAA 1RLGA 1KD1H 3NVIB 1CK2A
chains in the Genus database with same CATH superfamily
3VMFB 5J2TA 4ZK7A 3DDNA 3CMAF 3ELCA 5HXZA 3CCQF 3I7TA 1IV2A 1VK3A 3NK7A 3G6EF 1GO0A 4DXDA 2H8EA 2LBWA 2ZOVA 2KTVA 3HKEA 3VTIC 4BVTA 2CSLA 3M4SA 2WALA 1X7OA 4RQOA 2VAPA 2GZLA 2ALEA 3V4DA 3C9UA 4R40B 2ZVZA 3JAWB 4C82A 1KC8H 3FFMA 1VQ6F 3CMEF 4C8IA 4HNAA 1YIJF 2V9YA 2DYYA 4NUTA 4O4LA 1W5BA 5KMGB 1SDSA 4ZI7A 4FFBA 4BW0B 3L7QA 3FBAA 1KNKA 3S03A 1VQ8F 3E22A 5HY4A 2KGWA 2VGMA 3HKDB 3RYIB 2JNBA 2H6LA 3MCQA 4BT6A 3ZOPA 4BVRA 1FNKA 1R1MA 1GX1A 5MN5A 4C8GA 1QAHA 3RYCA 2UZHA 2HP0A 5CA0B 3HJWC 3RA5A 4G4YA 4X20B 2BTQB 4DRXA 2KTUA 1QVFF 5GONB 1XRGA 3VYSC 4ZHYB 3J80M 3K14A 2HP3A 1SA0B 5FLXM 4M8IA 2VAMA 4X1KA 2OTJF 3GHZA 4C8EA 1W2BF 1UI9A 2OZBA 1QU9A 5LP6C 4WBNB 2GVIA 3WPWA 3CCSF 1JFFB 3IR9A 1K73H 1TUBB 5AVMA 3K12A 4TV8B 3SIUA 3FPIA 2ZAUA 5ITZA 2AIZP 3CCJF 4G88A 3TD3A 1W55A 2EWCA 5EB1B 4F6RB 2CZWA 1VQKF 3P10A 4BVSA 1IV4A 3IMPA 3CCLF 5LP6A 3KJJA 5EZYA 5LYJB 3CCUF 1N8RH 5DCVA 3JVHA 3B6NA 3HKBB 3CYPB 5J2UB 5CB4B 3JASA 5IYZB 3N2KB 5KX5B 3CPQA 1KD1H 3NVIB 4IIJB 3AGKA 3UT5A 4U3JA 3FD5A 3OBWA 4I55A 3JAKB 2Q1XA 3WJPA 4O4JA 2Q1YA 1W5FA 2NMUA 3IEQA 3O85A 3S02A 3IKEA 5CA1B 5MN4A 1ODEA 5LXTA 2CHTA 3C9TA 5HP7A 5EYPB 5LA6A 1RQ2A 1Q7YH 4C4WC 2Z1FA 5BMVB 5GIOC 4BY9D 2LBXA 3JATA 3S06A 4X1IA 2CW4A 3CCEF 5J2TB 2ZODA 2CWJA 4O4IA 1GZ0A 1W41A 1FSZA 3WGJA 1YHQF 2LBTA 3ZP4A 5JH7B 3RYHA 1QVGF 3ON1A 3LYBA 4LNUB 5EIBD 4I50A 3ZO8A 1QD9A 3HKEB 3CPWF 3MBMA 3JALA 4X3MA 3R0PA 2FC3A 5EWRA 1CN7A 3NK6A 2OTMA 3VOAA 4HNAB 2FGYA 3N4YA 1XBIA 3HKCB 3LWOC 3K0TA 5B8FA 5HXUA 4TV9A 3CC7F 3I55F 4B45A 5GINC 4TUYB 1XV2A 3NMUC 4B46A 2IAFA 3OONA 4FFBB 4ZOLA 1W3EX 3VYTC 3E22B 3WGNA 5JQGA 3CC4F 2LCAA 2B33A 3V7EA 2QEXF 3I56F 2QTPA 1JJ2F 5HY0A 3KHNA 2BO1A 2Z01A 1OFUA 3VCZA 1YJ9F 3JARA 4ERHA 3LWRC 3CCVF 4BVQA 4ZHVA 5FNVA 3RYCB 1VQVA 3DC2A 5G4VC 2Z1EA 1SZQA 4XCQA 3Q8HA 4DRXB 3LWVC 3CXCF 3LWQC 3TD5A 3P0ZA 3VOBA 1K8AH 3HTNA 3K2XA 1H48A 2OHWA 4X1KB 3I3FA 2HS4A 5IJ0A 1U43A 1KQSF 3OW2F 1W42A 2L26A 4NQ3A 2DT4A 2UYPA 3WJQA 1IV1A 1KNJA 2G9IA 1DT9A 1M1KH 1Q82H 4E6EA 1RLGA 1Z5VA 2K1SA 3ESJA 4O4HA 5ITZB 4EB6A 2YYEA 1DBFA 3CYQA 2I6DA 1NJIH 2HS0A 4B5CA 5HWEA 2RHJA 5MN6A 3HAXD 5LP6B 4X1YA 5EZYB 5GONA 2HRUA 3JASB 3VIUA 1VQ9F 3QUWA 3T80A 3PAFA 5IJ9A 5EB0A 3TD4A 4YJ3A 1TVKA 2ZVYA 1J7HA 3UT5B 4I55B 3N4ZA 3JAMM 5JVDB 3IEWA 3MQWA 3M1XA 1JN1A 3WJRA 4O4JB 2ZF8A 5EO3A 5C8YA 2VAWA 2W8BC 5LXTB 1T0AA 3S0HA 5LA6B 1S72F 2RHLA 3N2GB 3JATB 3QTYA 4EI8A 2HQSC 1X52A 4X1IB 1M90H 4O2AA 1RA4A 2RB9A 3M84A 3G4SF 4O4IB 1FFXA 5LOVB 3RYFB 1W59A 3HKBA 2UYNA 5J2UA 5IT9M 3VI6A 3RYHB 4BT7A 4G4ZA 2N48A 4I50B 2PHNA 4ZHQA 1IV3A 3JALB 3V3TA 3ZP7A 3HWUA 3C8LA 5GAPK 3WGMA 3F0EA 1YJNF 2HX0A 4TZZA 4I4TA 3C9SA 4O2BA 3NVKE 2BTUA 3G71F 4PWTA 2QI2A 2QA4F 3C9RA 1Q8RA 4TV9B 5BMVA 4IHJA 3P4EA 4YJ2A 3S0WA 4O4LB 4ZOLB 5JQGB 3CD6F 1U3LA 4ZI7B 2KG4A 5JH7A 3BYQA 2HVYD 1K9MH 2R751 3MCAB 4LNUA 4BT4A 3LWPC 4BT2A 1W5AA 3D01A 3SIVA 3KE1A 3JARB 3CB2A 3E1YA 1VQOF 5FNVB 3VO8A 3MDOA 2BTOA 2RHOA 1Q81H 4C81A 2RHHA 3CCRF 5G4UC 1H7MA 3WGLA 2F9ZC 3QHDA 1IPAA 1XHOA 2HP0B 1RQ7A 3HKCA 1CK2A 3JAWA 1YI2F 3S0YA 1VQ7F 4NWOB 1U3PA 4KWEA 4TUYA 2VXYA 3RE3A 5IJ0B 2YXZA 3EORA 5KMGA 1ONIA 2CVLA 3F0FA 5GIPC 1VHAA 3WGKA 1VQ4F 1VQLF 1VQ5F 2UYJA 1W40A 4BT5A 2AMTA 5A2QM 4X3LA 2OTLF 3LFOA 1U40A 3HKDA 4O4HB 2P6YA 1NMUB 4EB6B 4EI7A 3RYIA 1NQ3A 2UYKA 3PLAC 5HY2A 3J81M 3VYUC 4ZHWA 4X1YB 3ERNA 4LCKA 1PF5A 5CA0A 5EAZA 3GYQA 3WPXA 3JCMM 4X20A 5GANK 1W57A 5EIBC 1YITF 2HRYA 1GO1A 2PMPA 2HS3A 3KIZA 5IJ9B 2Z1UA 4YJ3B 1Z5WA 1TVKB 1H47A 1SA0A 1UFYA 3LMEA 3KJKA 1YQNA 3LDTA 1E7KA 2IQQA 5C8YB 3J7AR 4U3JB 3F0GA 3FD6A 4WBNA 4EI9A 1JFFA 1W581 4B62A 3CC2F 4G4VA 3IKFA 1TUBA 1YGYA 1VQPF 4TV8A 2VGNA 3D00A 3OBYA 1T0KB 2H8CA 2IG8A 4O2AB 3RA6A 1W5EA 4F6RA 1FFXB 2UYNB 1RLUA 1PXWA 5HP8A 5LYJA 3WXMB 5CB4A 2Z1TA 4ZHQB 5IYZA 3F0DA 3N2KA 5JCOC 4G4WA 5KX5A 1YJWF 3U0OA 5JVDA 4IIJA 2MQEA 1CLIA 1OAPA 1ZWZA 4G4XA 1X25A 4I4TB 2CHSA 1VQMF 4O2BB 1JY8A 2AIFA 3D54A 3JAKA 2R6R1 5HY1A 1VQNF 3E20B 4U39A 3F6MA 1FNJA 1X7PA 2GLZA 5FJ4C 5CA1A 1Q86H 3N2GA 4IHJB 4BT3A 2I6RA 1JD1A 4YJ2B 5EYPA 1VH8A 3V7QA 1COMA 3CCMF 5JCOA 4RHAA 3CG6A 5LOVA 3RYFA 3GTZA
chains in the Genus database with same CATH topology
3VMFB 3AGKA 1YI2F 1VQ7F 3OBWA 3CMAF 2I6DA 5HXZA 1NJIH 3CCQF 5HWEA 3O85A 5GIPC 1VQ4F 3HAXD 1VQLF 1VQ5F 3NK7A 3G6EF 1W40A 1GO0A 2LBWA 2KTVA 4BVTA 1Q7YH 4C4WC 5A2QM 2WALA 4X3LA 3LFOA 5GIOC 2OTLF 1VQ9F 4BY9D 1X7OA 2LBXA 3PAFA 2ALEA 1NMUB 4EI7A 1KC8H 3CCEF 3FFMA 1VQ6F 3CMEF 3PLAC 1GZ0A 1YIJF 5HY2A 3N4ZA 1W41A 3JAMM 1YHQF 3J81M 4NUTA 5EO3A 1QVGF 3ON1A 1SDSA 4LCKA 3GYQA 3JCMM 5GANK 4BW0B 3CPWF 1S72F 1VQ8F 1YITF 1GO1A 5HY4A 4X3MA 4EI8A 2VGMA 1X52A 2FC3A 5EWRA 1M90H 3NK6A 1CN7A 1RA4A 2JNBA 3G4SF 2FGYA 4BVRA 3N4YA 1E7KA 1XBIA 5IT9M 3LWOC 3VI6A 5HXUA 3CC7F 3I55F 3J7AR 5GINC 4EI9A 3HJWC 3RA5A 3NMUC 3CC2F 1W3EX 2KTUA 1VQPF 1QVFF 3V3TA 2VGNA 3D00A 3OBYA 1KQSF 3CC4F 3V7EA 1T0KB 3J80M 2QEXF 5GAPK 3RA6A 3I56F 1YJNF 4TZZA 5FLXM 1JJ2F 5HY0A 3NVKE 2BO1A 2OTJF 3G71F 2QI2A 2QA4F 1YJ9F 1W2BF 3LWRC 1PXWA 3CCVF 4BVQA 2OZBA 3WXMB 5G4VC 3CCSF 3IR9A 1K73H 4XCQA 3LWVC 3SIUA 1YJWF 3CXCF 3LWQC 3CD6F 2KG4A 3CCJF 1K8AH 2HVYD 1ZWZA 1VQMF 2OHWA 2CZWA 1K9MH 1VQKF 2AIFA 3MCAB 5HY1A 3LWPC 1VQNF 3E20B 3SIVA 4BVSA 1X7PA 3E1YA 2GLZA 3OW2F 1W42A 3CCLF 1VQOF 3CCUF 1Q86H 4NQ3A 1N8RH 5DCVA 5FJ4C 1Q81H 1DT9A 3CCRF 3V7QA 3CCMF 5G4UC 1M1KH 1H7MA 3CG6A 2F9ZC 3CPQA 1IPAA 1Q82H 1RLGA 1KD1H 3NVIB 1CK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMF B;  3AGK A;  1YI2 F;  1VQ7 F;  3OBW A;  3CMA F;  2I6D A;  1NJI H;  3CCQ F;  3O85 A;  5GIP C;  1VQ4 F;  3HAX D;  1VQL F;  1VQ5 F;  3NK7 A;  3G6E F;  1W40 A;  1GO0 A;  2LBW A;  2KTV A;  1Q7Y H;  4C4W C;  5A2Q M;  2WAL A;  4X3L A;  3LFO A;  5GIO C;  2OTL F;  1VQ9 F;  4BY9 D;  1X7O A;  2LBX A;  3PAF A;  2ALE A;  1NMU B;  1KC8 H;  3CCE F;  3FFM A;  1VQ6 F;  3CME F;  3PLA C;  1GZ0 A;  1YIJ F;  3N4Z A;  1W41 A;  3JAM M;  1YHQ F;  3J81 M;  4NUT A;  5EO3 A;  1QVG F;  3ON1 A;  1SDS A;  4LCK A;  3GYQ A;  3JCM M;  5GAN K;  4BW0 B;  3CPW F;  1S72 F;  1VQ8 F;  1YIT F;  1GO1 A;  4X3M A;  2VGM A;  1X52 A;  2FC3 A;  5EWR A;  1M90 H;  3NK6 A;  1CN7 A;  1RA4 A;  2JNB A;  3G4S F;  3N4Y A;  1E7K A;  1XBI A;  5IT9 M;  3LWO C;  3VI6 A;  3CC7 F;  3I55 F;  3J7A R;  5GIN C;  3HJW C;  3RA5 A;  3NMU C;  3CC2 F;  1W3E X;  2KTU A;  1VQP F;  1QVF F;  2VGN A;  3OBY A;  3CC4 F;  3V7E A;  1T0K B;  3J80 M;  2QEX F;  5GAP K;  3RA6 A;  3I56 F;  1YJN F;  4TZZ A;  5FLX M;  1JJ2 F;  3NVK E;  2BO1 A;  2OTJ F;  3G71 F;  2QI2 A;  2QA4 F;  1YJ9 F;  1W2B F;  3LWR C;  1PXW A;  3CCV F;  2OZB A;  3WXM B;  5G4V C;  3CCS F;  3IR9 A;  1K73 H;  3LWV C;  3SIU A;  1YJW F;  3CXC F;  3LWQ C;  3CD6 F;  2KG4 A;  3CCJ F;  1K8A H;  2HVY D;  1ZWZ A;  1VQM F;  2OHW A;  2CZW A;  1K9M H;  1VQK F;  2AIF A;  3MCA B;  3LWP C;  1VQN F;  3E20 B;  3SIV A;  1X7P A;  3E1Y A;  1VQO F;  3OW2 F;  1W42 A;  3CCL F;  1KQS F;  3CCU F;  1Q86 H;  5DCV A;  1N8R H;  5FJ4 C;  1Q81 H;  1DT9 A;  3CCR F;  3V7Q A;  3CCM F;  5G4U C;  1M1K H;  1H7M A;  3CG6 A;  3CPQ A;  1Q82 H;  1IPA A;  1RLG A;  1KD1 H;  3NVI B;  1CK2 A; 
#chains in the Genus database with same CATH topology
 3VMF B;  5J2T A;  4ZK7 A;  3DDN A;  3CMA F;  3ELC A;  5HXZ A;  3CCQ F;  3I7T A;  1IV2 A;  1VK3 A;  3NK7 A;  3G6E F;  1GO0 A;  4DXD A;  2H8E A;  2LBW A;  2ZOV A;  2KTV A;  3HKE A;  3VTI C;  4BVT A;  2CSL A;  3M4S A;  2WAL A;  1X7O A;  4RQO A;  2VAP A;  2GZL A;  2ALE A;  3V4D A;  3C9U A;  4R40 B;  2ZVZ A;  3JAW B;  4C82 A;  1KC8 H;  3FFM A;  1VQ6 F;  3CME F;  4C8I A;  4HNA A;  1YIJ F;  2V9Y A;  2DYY A;  4NUT A;  4O4L A;  1W5B A;  5KMG B;  1SDS A;  4ZI7 A;  4FFB A;  4BW0 B;  3L7Q A;  3FBA A;  1KNK A;  3S03 A;  1VQ8 F;  3E22 A;  5HY4 A;  2KGW A;  2VGM A;  3HKD B;  3RYI B;  2JNB A;  2H6L A;  3MCQ A;  4BT6 A;  3ZOP A;  4BVR A;  1FNK A;  1R1M A;  1GX1 A;  5MN5 A;  4C8G A;  1QAH A;  3RYC A;  2UZH A;  2HP0 A;  5CA0 B;  3HJW C;  3RA5 A;  4G4Y A;  4X20 B;  2BTQ B;  4DRX A;  2KTU A;  1QVF F;  5GON B;  1XRG A;  3VYS C;  4ZHY B;  3J80 M;  3K14 A;  2HP3 A;  1SA0 B;  5FLX M;  4M8I A;  2VAM A;  4X1K A;  2OTJ F;  3GHZ A;  4C8E A;  1W2B F;  1UI9 A;  2OZB A;  1QU9 A;  5LP6 C;  4WBN B;  2GVI A;  3WPW A;  3CCS F;  1JFF B;  3IR9 A;  1K73 H;  1TUB B;  5AVM A;  3K12 A;  4TV8 B;  3SIU A;  3FPI A;  2ZAU A;  5ITZ A;  2AIZ P;  3CCJ F;  4G88 A;  3TD3 A;  1W55 A;  2EWC A;  5EB1 B;  4F6R B;  2CZW A;  1VQK F;  3P10 A;  4BVS A;  1IV4 A;  3IMP A;  3CCL F;  5LP6 A;  3KJJ A;  5EZY A;  5LYJ B;  3CCU F;  1N8R H;  5DCV A;  3JVH A;  3B6N A;  3HKB B;  3CYP B;  5J2U B;  5CB4 B;  3JAS A;  5IYZ B;  3N2K B;  5KX5 B;  3CPQ A;  1KD1 H;  3NVI B;  4IIJ B;  3AGK A;  3UT5 A;  4U3J A;  3FD5 A;  3OBW A;  4I55 A;  3JAK B;  2Q1X A;  3WJP A;  4O4J A;  2Q1Y A;  1W5F A;  2NMU A;  3IEQ A;  3O85 A;  3S02 A;  3IKE A;  5CA1 B;  5MN4 A;  1ODE A;  5LXT A;  2CHT A;  3C9T A;  5HP7 A;  5EYP B;  5LA6 A;  1RQ2 A;  1Q7Y H;  4C4W C;  2Z1F A;  5BMV B;  5GIO C;  4BY9 D;  2LBX A;  3JAT A;  3S06 A;  4X1I A;  2CW4 A;  3CCE F;  5J2T B;  2ZOD A;  2CWJ A;  4O4I A;  1GZ0 A;  1W41 A;  1FSZ A;  3WGJ A;  1YHQ F;  2LBT A;  3ZP4 A;  5JH7 B;  3RYH A;  1QVG F;  3ON1 A;  3LYB A;  4LNU B;  5EIB D;  4I50 A;  3ZO8 A;  1QD9 A;  3HKE B;  3CPW F;  3MBM A;  3JAL A;  4X3M A;  3R0P A;  2FC3 A;  5EWR A;  1CN7 A;  3NK6 A;  2OTM A;  3VOA A;  4HNA B;  2FGY A;  3N4Y A;  1XBI A;  3HKC B;  3LWO C;  3K0T A;  5B8F A;  5HXU A;  4TV9 A;  3CC7 F;  3I55 F;  4B45 A;  5GIN C;  4TUY B;  1XV2 A;  3NMU C;  4B46 A;  2IAF A;  3OON A;  4FFB B;  4ZOL A;  1W3E X;  3VYT C;  3E22 B;  3WGN A;  5JQG A;  3CC4 F;  2LCA A;  2B33 A;  3V7E A;  2QEX F;  3I56 F;  2QTP A;  1JJ2 F;  5HY0 A;  3KHN A;  2BO1 A;  2Z01 A;  1OFU A;  3VCZ A;  1YJ9 F;  3JAR A;  4ERH A;  3LWR C;  3CCV F;  4BVQ A;  4ZHV A;  5FNV A;  3RYC B;  1VQV A;  3DC2 A;  5G4V C;  2Z1E A;  1SZQ A;  4XCQ A;  3Q8H A;  4DRX B;  3LWV C;  3CXC F;  3LWQ C;  3TD5 A;  3P0Z A;  3VOB A;  1K8A H;  3HTN A;  3K2X A;  1H48 A;  2OHW A;  4X1K B;  3I3F A;  2HS4 A;  5IJ0 A;  1U43 A;  1KQS F;  3OW2 F;  1W42 A;  2L26 A;  4NQ3 A;  2DT4 A;  2UYP A;  3WJQ A;  1IV1 A;  1KNJ A;  2G9I A;  1DT9 A;  1M1K H;  1Q82 H;  4E6E A;  1RLG A;  1Z5V A;  2K1S A;  3ESJ A;  4O4H A;  5ITZ B;  4EB6 A;  2YYE A;  1DBF A;  3CYQ A;  2I6D A;  1NJI H;  2HS0 A;  4B5C A;  5HWE A;  2RHJ A;  5MN6 A;  3HAX D;  5LP6 B;  4X1Y A;  5EZY B;  5GON A;  2HRU A;  3JAS B;  3VIU A;  1VQ9 F;  3QUW A;  3T80 A;  3PAF A;  5IJ9 A;  5EB0 A;  3TD4 A;  4YJ3 A;  1TVK A;  2ZVY A;  1J7H A;  3UT5 B;  4I55 B;  3N4Z A;  3JAM M;  5JVD B;  3IEW A;  3MQW A;  3M1X A;  1JN1 A;  3WJR A;  4O4J B;  2ZF8 A;  5EO3 A;  5C8Y A;  2VAW A;  2W8B C;  5LXT B;  1T0A A;  3S0H A;  5LA6 B;  1S72 F;  2RHL A;  3N2G B;  3JAT B;  3QTY A;  4EI8 A;  2HQS C;  1X52 A;  4X1I B;  1M90 H;  4O2A A;  1RA4 A;  2RB9 A;  3M84 A;  3G4S F;  4O4I B;  1FFX A;  5LOV B;  3RYF B;  1W59 A;  3HKB A;  2UYN A;  5J2U A;  5IT9 M;  3VI6 A;  3RYH B;  4BT7 A;  4G4Z A;  2N48 A;  4I50 B;  2PHN A;  4ZHQ A;  1IV3 A;  3JAL B;  3V3T A;  3ZP7 A;  3HWU A;  3C8L A;  5GAP K;  3WGM A;  3F0E A;  1YJN F;  2HX0 A;  4TZZ A;  4I4T A;  3C9S A;  4O2B A;  3NVK E;  2BTU A;  3G71 F;  4PWT A;  2QI2 A;  2QA4 F;  3C9R A;  1Q8R A;  4TV9 B;  5BMV A;  4IHJ A;  3P4E A;  4YJ2 A;  3S0W A;  4O4L B;  4ZOL B;  5JQG B;  3CD6 F;  1U3L A;  4ZI7 B;  2KG4 A;  5JH7 A;  3BYQ A;  2HVY D;  1K9M H;  2R75 1;  3MCA B;  4LNU A;  4BT4 A;  3LWP C;  4BT2 A;  1W5A A;  3D01 A;  3SIV A;  3KE1 A;  3JAR B;  3CB2 A;  3E1Y A;  1VQO F;  5FNV B;  3VO8 A;  3MDO A;  2BTO A;  2RHO A;  1Q81 H;  4C81 A;  2RHH A;  3CCR F;  5G4U C;  1H7M A;  3WGL A;  2F9Z C;  3QHD A;  1IPA A;  1XHO A;  2HP0 B;  1RQ7 A;  3HKC A;  1CK2 A;  3JAW A;  1YI2 F;  3S0Y A;  1VQ7 F;  4NWO B;  1U3P A;  4KWE A;  4TUY A;  2VXY A;  3RE3 A;  5IJ0 B;  2YXZ A;  3EOR A;  5KMG A;  1ONI A;  2CVL A;  3F0F A;  5GIP C;  1VHA A;  3WGK A;  1VQ4 F;  1VQL F;  1VQ5 F;  2UYJ A;  1W40 A;  4BT5 A;  2AMT A;  5A2Q M;  4X3L A;  2OTL F;  3LFO A;  1U40 A;  3HKD A;  4O4H B;  2P6Y A;  1NMU B;  4EB6 B;  4EI7 A;  3RYI A;  1NQ3 A;  2UYK A;  3PLA C;  5HY2 A;  3J81 M;  3VYU C;  4ZHW A;  4X1Y B;  3ERN A;  4LCK A;  1PF5 A;  5CA0 A;  5EAZ A;  3GYQ A;  3WPX A;  3JCM M;  4X20 A;  5GAN K;  1W57 A;  5EIB C;  1YIT F;  2HRY A;  1GO1 A;  2PMP A;  2HS3 A;  3KIZ A;  5IJ9 B;  2Z1U A;  4YJ3 B;  1Z5W A;  1TVK B;  1H47 A;  1SA0 A;  1UFY A;  3LME A;  3KJK A;  1YQN A;  3LDT A;  1E7K A;  2IQQ A;  5C8Y B;  3J7A R;  4U3J B;  3F0G A;  3FD6 A;  4WBN A;  4EI9 A;  1JFF A;  1W58 1;  4B62 A;  3CC2 F;  4G4V A;  3IKF A;  1TUB A;  1YGY A;  1VQP F;  4TV8 A;  2VGN A;  3D00 A;  3OBY A;  1T0K B;  2H8C A;  2IG8 A;  4O2A B;  3RA6 A;  1W5E A;  4F6R A;  1FFX B;  2UYN B;  1RLU A;  1PXW A;  5HP8 A;  5LYJ A;  3WXM B;  5CB4 A;  2Z1T A;  4ZHQ B;  5IYZ A;  3F0D A;  3N2K A;  5JCO C;  4G4W A;  5KX5 A;  1YJW F;  3U0O A;  5JVD A;  4IIJ A;  2MQE A;  1CLI A;  1OAP A;  1ZWZ A;  4G4X A;  1X25 A;  4I4T B;  2CHS A;  1VQM F;  4O2B B;  1JY8 A;  2AIF A;  3D54 A;  3JAK A;  2R6R 1;  5HY1 A;  1VQN F;  3E20 B;  4U39 A;  3F6M A;  1FNJ A;  1X7P A;  2GLZ A;  5FJ4 C;  5CA1 A;  1Q86 H;  3N2G A;  4IHJ B;  4BT3 A;  2I6R A;  1JD1 A;  4YJ2 B;  5EYP A;  1VH8 A;  3V7Q A;  1COM A;  3CCM F;  5JCO A;  4RHA A;  3CG6 A;  5LOV A;  3RYF A;  3GTZ A; 
#chains in the Genus database with same CATH homology
 3VMF B;  3AGK A;  1YI2 F;  1VQ7 F;  3OBW A;  3CMA F;  2I6D A;  5HXZ A;  1NJI H;  3CCQ F;  5HWE A;  3O85 A;  5GIP C;  1VQ4 F;  3HAX D;  1VQL F;  1VQ5 F;  3NK7 A;  3G6E F;  1W40 A;  1GO0 A;  2LBW A;  2KTV A;  4BVT A;  1Q7Y H;  4C4W C;  5A2Q M;  2WAL A;  4X3L A;  3LFO A;  5GIO C;  2OTL F;  1VQ9 F;  4BY9 D;  1X7O A;  2LBX A;  3PAF A;  2ALE A;  1NMU B;  4EI7 A;  1KC8 H;  3CCE F;  3FFM A;  1VQ6 F;  3CME F;  3PLA C;  1GZ0 A;  1YIJ F;  5HY2 A;  3N4Z A;  1W41 A;  3JAM M;  1YHQ F;  3J81 M;  4NUT A;  5EO3 A;  1QVG F;  3ON1 A;  1SDS A;  4LCK A;  3GYQ A;  3JCM M;  5GAN K;  4BW0 B;  3CPW F;  1S72 F;  1VQ8 F;  1YIT F;  1GO1 A;  5HY4 A;  4X3M A;  4EI8 A;  2VGM A;  1X52 A;  2FC3 A;  5EWR A;  1M90 H;  3NK6 A;  1CN7 A;  1RA4 A;  2JNB A;  3G4S F;  2FGY A;  4BVR A;  3N4Y A;  1E7K A;  1XBI A;  5IT9 M;  3LWO C;  3VI6 A;  5HXU A;  3CC7 F;  3I55 F;  3J7A R;  5GIN C;  4EI9 A;  3HJW C;  3RA5 A;  3NMU C;  3CC2 F;  1W3E X;  2KTU A;  1VQP F;  1QVF F;  3V3T A;  2VGN A;  3D00 A;  3OBY A;  1KQS F;  3CC4 F;  3V7E A;  1T0K B;  3J80 M;  2QEX F;  5GAP K;  3RA6 A;  3I56 F;  1YJN F;  4TZZ A;  5FLX M;  1JJ2 F;  5HY0 A;  3NVK E;  2BO1 A;  2OTJ F;  3G71 F;  2QI2 A;  2QA4 F;  1YJ9 F;  1W2B F;  3LWR C;  1PXW A;  3CCV F;  4BVQ A;  2OZB A;  3WXM B;  5G4V C;  3CCS F;  3IR9 A;  1K73 H;  4XCQ A;  3LWV C;  3SIU A;  1YJW F;  3CXC F;  3LWQ C;  3CD6 F;  2KG4 A;  3CCJ F;  1K8A H;  2HVY D;  1ZWZ A;  1VQM F;  2OHW A;  2CZW A;  1K9M H;  1VQK F;  2AIF A;  3MCA B;  5HY1 A;  3LWP C;  1VQN F;  3E20 B;  3SIV A;  4BVS A;  1X7P A;  3E1Y A;  2GLZ A;  3OW2 F;  1W42 A;  3CCL F;  1VQO F;  3CCU F;  1Q86 H;  4NQ3 A;  1N8R H;  5DCV A;  5FJ4 C;  1Q81 H;  1DT9 A;  3CCR F;  3V7Q A;  3CCM F;  5G4U C;  1M1K H;  1H7M A;  3CG6 A;  2F9Z C;  3CPQ A;  1IPA A;  1Q82 H;  1RLG A;  1KD1 H;  3NVI B;  1CK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...