3CCEF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cceF00
3NVIB 1K9MH 2KTVA 3HAXD 2BO1A 3I55F 2KG4A 3JAMM 3OW2F 1QVGF 3CCLF 3HJWC 1W42A 3CC2F 2WALA 3N4YA 3CCEF 3CXCF 1Q86H 3J7AR 5IT9M 3LWOC 3CCRF 3FFMA 5FJ4C 1YI2F 3G4SF 5EWRA 1VQ9F 1CN7A 1RA4A 3V7QA 2VGMA 3NK7A 3CC4F 3J80M 2LBXA 1N8RH 1VQ5F 1W41A 3J81M 3WXMB 1YJNF 3NVKE 1QVFF 1Q7YH 2LBWA 1T0KB 1KD1H 1W40A 1VQKF 4C4WC 3NK6A 2QI2A 3OBYA 1KQSF 3G71F 1Q81H 2QEXF 3OBWA 3LWRC 3SIUA 3SIVA 3V7EA 3RA5A 3CCJF 1VQPF 3O85A 3ON1A 1DT9A 4BW0B 5GANK 1VQMF 1ZWZA 1YJ9F 1VQLF 3VMFB 1Q82H 1CK2A 1YITF 1YJWF 2OHWA 3CMAF 1IPAA 3JCMM 5GIOC 3CCQF 2AIFA 1GO0A 3CCUF 5FLXM 2QA4F 1X7OA 3CCSF 1W2BF 3RA6A 1JJ2F 3CC7F 3NMUC 1NMUB 2HVYD 1VQOF 1VQ6F 2KTUA 3CD6F 1YHQF 2ALEA 2CZWA 2VGNA 1SDSA 5G4VC 4X3MA 1VQNF 1YIJF 3N4ZA 1K8AH 1VQ4F 1KC8H 5G4UC 3CPWF 4X3LA 3LWVC 3E1YA 1M90H 1X7PA 5GAPK 1PXWA 4TZZA 2I6DA 2OTLF 5EO3A 1VQ7F 3LFOA 1RLGA 2OTJF 1H7MA 3CCVF 1XBIA 1X52A 3CMEF 3CPQA 3GYQA 4LCKA 3G6EF 1NJIH 1M1KH 5GINC 3I56F 3CCMF 5DCVA 1VQ8F 5GIPC 1S72F 1W3EX 4BY9D 3PAFA 2FC3A 3MCAB 2JNBA 1GO1A 2OZBA 1K73H 3LWPC 3CG6A 3LWQC 3AGKA 1E7KA 4NUTA 3IR9A 5A2QM 3VI6A 3PLAC 1GZ0A 3E20B
chains in the Genus database with same CATH superfamily
3P0ZA 2PMPA 2EWCA 3HAXD 2AIZP 5AVMA 2YXZA 2IQQA 3CC2F 2WALA 2GZLA 2RHHA 5EZYB 5LP6A 5IT9M 1TVKA 2GVIA 1YI2F 3HKCB 3P10A 5HP8A 3CC4F 3GHZA 4C8EA 5LYJA 2RHLA 3NVKE 3VYUC 1T0KB 1W40A 3JASA 2NMUA 3M1XA 3NK6A 2VXYA 2QI2A 3F0FA 3G71F 4ZI7B 2QEXF 3LWRC 3SIVA 3TD3A 4LNUA 4O2AB 2F9ZC 1DT9A 4BW0B 1YJ9F 4F6RA 1VQLF 1YJWF 4X1YB 1QAHA 2OHWA 1IPAA 5GIOC 1ODEA 4NQ3A 3CCUF 4TV8B 2VAMA 2HX0A 5CA1B 5LYJB 2Q1YA 3JALA 1JJ2F 1IV1A 5MN6A 5LA6A 5LP6B 5CA0B 4TUYB 1VQ6F 2KTUA 4U3JB 4DRXB 2L26A 4X1KB 3RYFB 3WJPA 4C8IA 3T80A 1VQ4F 4X20B 2KGWA 1VHAA 5GONA 1KC8H 5EB1B 1JFFA 2HQSC 4I4TA 1M90H 1X7PA 4B46A 5CA1A 3IEWA 5EO3A 1VQ7F 1RLGA 3EORA 4YJ3B 2FGYA 4G4WA 1SA0A 2OTJF 3HKDB 4O4IA 3CCVF 3WGMA 1W59A 1X52A 3HWUA 3JASB 1W5EA 3GYQA 4LCKA 3VOAA 5EYPB 4BT6A 2HRUA 3I56F 2K1SA 3IKEA 2CVLA 4U3JA 4DRXA 3GTZA 3CCMF 3VYTC 1YGYA 3VCZA 2CHTA 3V3TA 4IIJA 5EAZA 1S72F 2CSLA 1OAPA 5HWEA 3PAFA 2FC3A 5FNVB 3S06A 2AMTA 4O4JB 4X1KA 4ZI7A 3HKEA 3LWPC 2ZVZA 4NUTA 4M8IA 4BT2A 1GZ0A 4O4IB 3HKDA 3DC2A 4YJ2B 1U40A 5JCOA 1K9MH 4ZHYB 3N2KB 3RYIA 3WJRA 4ZK7A 5LOVB 1JD1A 3JAMM 3OW2F 3CCLF 4PWTA 3ZP4A 3I7TA 3Q8HA 4HNAA 1IV2A 3J7AR 1VH8A 5ITZB 5C8YB 3CCRF 5FJ4C 3G4SF 5BMVB 3TD4A 2VGMA 3NK7A 2ZODA 3J80M 1N8RH 5J2TA 2Z1TA 1YJNF 3KJJA 3N2GB 3MDOA 5C8YA 4C81A 2HP3A 5JQGB 2H6LA 1KD1H 4C4WC 3QHDA 4RQOA 1VQVA 1Z5WA 1KQSF 1SA0B 1U43A 3SIUA 2CW4A 2HP0A 3LYBA 5JCOC 1W581 2RHOA 3K14A 4BT7A 1VQMF 3UT5A 5HY4A 3VMFB 3WGKA 1RQ7A 1CK2A 5ITZA 3RE3A 3ZO8A 3KHNA 5EZYA 3CMAF 5HXUA 3D01A 4O4LB 3JCMM 2UZHA 5EIBC 3ZOPA 4B5CA 1X7OA 3CCSF 1W2BF 3FD6A 3LMEA 4TV9A 3RA6A 3CC7F 1UFYA 1IV4A 2ZVYA 4G4XA 4U39A 3V4DA 5EIBD 4F6RB 2HVYD 2N48A 5LXTB 2CWJA 2H8EA 2H8CA 3L7QA 3RYCB 3QUWA 1NQ3A 4G4ZA 1VQNF 1YIJF 4O2BA 1COMA 4X20A 2UYKA 4EB6B 5B8FA 3E1YA 1RLUA 3RYHA 5GAPK 1PXWA 5IJ0B 1U3LA 2HP0B 4TZZA 1X25A 4WBNB 2I6DA 4EI7A 2OTLF 3F6MA 2G9IA 3LFOA 4C8GA 1H7MA 1TUBA 1DBFA 2YYEA 4EI8A 4O4HB 3JAWB 2MQEA 5GINC 1U3PA 3K12A 5HY2A 2W8BC 1YQNA 3BYQA 3S0YA 4I4TB 3JATA 1W3EX 3HKBB 3IKFA 3KIZA 4ZHVA 3VTIC 5CB4B 3WJQA 4ZOLA 1GO1A 3MQWA 3CG6A 1FNJA 3LWQC 3AGKA 3IR9A 5A2QM 1FNKA 1GX1A 2UYNB 1QU9A 1T0AA 3VIUA 3E20B 3FPIA 3NVIB 1FSZA 4BT3A 4IHJA 2BO1A 3FBAA 1QVGF 4G88A 4BT5A 3HJWC 3JVHA 1W42A 5EYPA 3C9TA 4BVSA 3N4YA 4I55A 3TD5A 3CCEF 3CXCF 1Q86H 5KMGB 2R6R1 2P6YA 3V7QA 1RQ2A 3C9UA 1VQ5F 1W41A 3WXMB 3C9RA 2LBWA 3F0DA 2HRYA 3OBYA 1TUBB 2BTQB 3VYSC 4HNAB 1Q8RA 2B33A 1SZQA 3D54A 1H47A 3OBWA 5HY1A 3S02A 3JAKA 4ZHQA 2GLZA 2LBTA 3MBMA 3ON1A 5IJ9A 3R0PA 1H48A 5HXZA 3E22B 1YITF 3FD5A 1KNKA 1W5FA 2AIFA 1W57A 3WPWA 4ZOLB 2QA4F 1J7HA 5MN4A 4I50A 3UT5B 5KMGA 4X1IB 2PHNA 2Z1FA 4XCQA 2ALEA 1VK3A 3WPXA 2VGNA 4O4LA 4X3MA 3ERNA 3N4ZA 1K8AH 4X1IA 4YJ3A 5HP7A 4I55B 4BVQA 5G4UC 4IIJB 1W5AA 1UI9A 3CPWF 3LWVC 3M84A 5IJ9B 2R751 2I6RA 3ESJA 5GONB 4TUYA 5IYZA 5J2UA 2IG8A 1XBIA 1XHOA 3VO8A 3CMEF 3DDNA 3E22A 3F0EA 3CPQA 3ZP7A 1FFXA 3G6EF 3P4EA 1NJIH 5JVDA 5EB0A 4EI9A 3I3FA 3JAKB 4ZHQB 3N2KA 3ELCA 2ZAUA 1VQ8F 5GIPC 3HKCA 3HKBA 1TVKB 4ERHA 4O2BB 2OTMA 3C8LA 2JNBA 2LCAA 3MCAB 4RHAA 4BT4A 4FFBB 4BVRA 2OZBA 2CHSA 3JAWA 1XRGA 5IJ0A 5LOVA 5FNVA 1E7KA 5BMVA 2VAPA 3RYIB 3VI6A 3PLAC 1CLIA 1JN1A 2HS4A 3JATB 1QD9A 2KTVA 4I50B 4LNUB 4O2AA 4G4YA 3I55F 2BTUA 2V9YA 2KG4A 3CYPB 5JH7B 3HTNA 3LDTA 4O4HA 3S03A 4BVTA 1JY8A 4X1YA 3CB2A 5JQGA 3LWOC 3U0OA 3FFMA 2UYNA 2DYYA 5EWRA 4WBNA 1VQ9F 1W55A 1CN7A 1RA4A 3JALB 4R40B 3S0HA 4C82A 2LBXA 1JFFB 3J81M 3C9SA 3VOBA 5CA0A 1QVFF 2UYPA 1Q7YH 3JARB 3M4SA 4E6EA 1VQKF 4ZHWA 4TV9B 3OONA 3N2GA 1Q81H 2DT4A 3V7EA 4FFBA 3B6NA 3IEQA 3RA5A 3CCJF 3O85A 1VQPF 4G4VA 3CYQA 3QTYA 5GANK 1ZWZA 1Z5VA 3F0GA 1Q82H 3WGNA 5J2UB 5IYZB 2RHJA 3CCQF 1GO0A 5KX5A 4TV8A 5FLXM 3RYHB 4B62A 3NMUC 1NMUB 2HS3A 2IAFA 1VQOF 2ZOVA 4B45A 3KJKA 2UYJA 3CD6F 1YHQF 2CZWA 2QTPA 5JH7A 1SDSA 1OFUA 5G4VC 5LXTA 2HS0A 3JARA 2Z1UA 3KE1A 5HY0A 1XV2A 4X3LA 3RYCA 3K2XA 2Q1XA 3D00A 2RB9A 3MCQA 4YJ2A 5MN5A 1PF5A 2BTOA 1IV3A 1M1KH 3HKEB 1ONIA 4DXDA 5CB4A 5DCVA 3WGLA 2ZF8A 5LA6B 4EB6A 4BY9D 3IMPA 2Z01A 1KNJA 3S0WA 3K0TA 5LP6C 1R1MA 4KWEA 3WGJA 3RYFA 4O4JA 5J2TB 1K73H 5KX5B 5JVDB 1FFXB 2VAWA 4IHJB 4NWOB 2Z1EA 1W5BA
chains in the Genus database with same CATH topology
3NVIB 1K9MH 2KTVA 3HAXD 2BO1A 3I55F 2KG4A 3JAMM 3OW2F 1QVGF 3CCLF 3HJWC 1W42A 3CC2F 2WALA 4BVTA 4BVSA 3N4YA 3CCEF 3CXCF 1Q86H 3J7AR 5IT9M 3LWOC 3CCRF 3FFMA 5FJ4C 1YI2F 3G4SF 5EWRA 1VQ9F 1CN7A 1RA4A 3V7QA 2VGMA 3NK7A 3CC4F 3J80M 2LBXA 1N8RH 1VQ5F 1W41A 3J81M 3WXMB 1YJNF 3NVKE 1QVFF 1Q7YH 2LBWA 1T0KB 1KD1H 1W40A 1VQKF 4C4WC 3NK6A 2QI2A 3OBYA 1KQSF 3G71F 1Q81H 5HY1A 3OBWA 3LWRC 2QEXF 3SIVA 3SIUA 3V7EA 3RA5A 2GLZA 3CCJF 1VQPF 3O85A 3ON1A 2F9ZC 1DT9A 4BW0B 5GANK 1VQMF 1ZWZA 1YJ9F 1VQLF 5HY4A 3VMFB 5HXZA 1Q82H 1CK2A 1YITF 1YJWF 2OHWA 3CMAF 1IPAA 3JCMM 5HXUA 5GIOC 2AIFA 3CCQF 1GO0A 4NQ3A 3CCUF 5FLXM 2QA4F 1X7OA 3CCSF 1W2BF 3RA6A 1JJ2F 3CC7F 3NMUC 1NMUB 2HVYD 1VQOF 1VQ6F 2KTUA 3CD6F 1YHQF 4XCQA 2ALEA 2CZWA 2VGNA 1SDSA 5G4VC 4X3MA 1VQNF 1YIJF 3N4ZA 1K8AH 1VQ4F 5HY0A 4BVQA 1KC8H 5G4UC 3CPWF 4X3LA 3LWVC 3E1YA 1M90H 1X7PA 5GAPK 1PXWA 4TZZA 3D00A 4EI7A 2I6DA 2OTLF 5EO3A 1VQ7F 3LFOA 1RLGA 2OTJF 2FGYA 1H7MA 3CCVF 1XBIA 1X52A 3CMEF 3CPQA 3GYQA 4LCKA 4EI8A 3G6EF 1NJIH 1M1KH 5GINC 3I56F 4EI9A 5HY2A 3CCMF 5DCVA 3V3TA 1VQ8F 5GIPC 1S72F 1W3EX 4BY9D 5HWEA 3PAFA 2FC3A 3MCAB 2JNBA 4BVRA 1GO1A 2OZBA 1K73H 3LWPC 3CG6A 3LWQC 3AGKA 1E7KA 4NUTA 3IR9A 5A2QM 3VI6A 3PLAC 1GZ0A 3E20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVI B;  1K9M H;  2KTV A;  3HAX D;  2BO1 A;  3I55 F;  2KG4 A;  3JAM M;  3OW2 F;  1QVG F;  3CCL F;  3HJW C;  1W42 A;  3CC2 F;  2WAL A;  3N4Y A;  3CCE F;  3CXC F;  1Q86 H;  3J7A R;  5IT9 M;  3LWO C;  3CCR F;  3FFM A;  5FJ4 C;  1YI2 F;  3G4S F;  5EWR A;  1VQ9 F;  1CN7 A;  1RA4 A;  3V7Q A;  2VGM A;  3NK7 A;  3CC4 F;  3J80 M;  2LBX A;  1N8R H;  1VQ5 F;  1W41 A;  3J81 M;  3WXM B;  1YJN F;  3NVK E;  1QVF F;  1Q7Y H;  2LBW A;  1T0K B;  1KD1 H;  1W40 A;  1VQK F;  4C4W C;  3NK6 A;  2QI2 A;  3OBY A;  1KQS F;  3G71 F;  1Q81 H;  2QEX F;  3OBW A;  3LWR C;  3SIU A;  3SIV A;  3V7E A;  3RA5 A;  3CCJ F;  1VQP F;  3O85 A;  3ON1 A;  1DT9 A;  4BW0 B;  5GAN K;  1VQM F;  1ZWZ A;  1YJ9 F;  1VQL F;  3VMF B;  1Q82 H;  1CK2 A;  1YIT F;  1YJW F;  2OHW A;  3CMA F;  1IPA A;  3JCM M;  5GIO C;  3CCQ F;  2AIF A;  1GO0 A;  3CCU F;  5FLX M;  2QA4 F;  1X7O A;  3CCS F;  1W2B F;  3RA6 A;  1JJ2 F;  3CC7 F;  3NMU C;  1NMU B;  2HVY D;  1VQO F;  1VQ6 F;  2KTU A;  3CD6 F;  1YHQ F;  2ALE A;  2CZW A;  2VGN A;  1SDS A;  5G4V C;  4X3M A;  1VQN F;  1YIJ F;  3N4Z A;  1K8A H;  1VQ4 F;  1KC8 H;  5G4U C;  3CPW F;  4X3L A;  3LWV C;  3E1Y A;  1M90 H;  1X7P A;  5GAP K;  1PXW A;  4TZZ A;  2I6D A;  2OTL F;  5EO3 A;  1VQ7 F;  3LFO A;  1RLG A;  2OTJ F;  1H7M A;  3CCV F;  1XBI A;  1X52 A;  3CME F;  3CPQ A;  3GYQ A;  4LCK A;  3G6E F;  1NJI H;  1M1K H;  5GIN C;  3I56 F;  3CCM F;  5DCV A;  1VQ8 F;  5GIP C;  1S72 F;  1W3E X;  4BY9 D;  3PAF A;  2FC3 A;  3MCA B;  2JNB A;  1GO1 A;  2OZB A;  1K73 H;  3LWP C;  3CG6 A;  3LWQ C;  3AGK A;  1E7K A;  4NUT A;  3IR9 A;  5A2Q M;  3VI6 A;  3PLA C;  1GZ0 A;  3E20 B; 
#chains in the Genus database with same CATH topology
 3P0Z A;  2PMP A;  2EWC A;  3HAX D;  2AIZ P;  5AVM A;  2YXZ A;  2IQQ A;  3CC2 F;  2WAL A;  2GZL A;  2RHH A;  5EZY B;  5LP6 A;  5IT9 M;  1TVK A;  2GVI A;  1YI2 F;  3HKC B;  3P10 A;  5HP8 A;  3CC4 F;  3GHZ A;  4C8E A;  5LYJ A;  2RHL A;  3NVK E;  3VYU C;  1T0K B;  1W40 A;  3JAS A;  2NMU A;  3M1X A;  3NK6 A;  2VXY A;  2QI2 A;  3F0F A;  3G71 F;  4ZI7 B;  2QEX F;  3LWR C;  3SIV A;  3TD3 A;  4LNU A;  4O2A B;  2F9Z C;  1DT9 A;  4BW0 B;  1YJ9 F;  4F6R A;  1VQL F;  1YJW F;  4X1Y B;  1QAH A;  2OHW A;  1IPA A;  5GIO C;  1ODE A;  4NQ3 A;  3CCU F;  4TV8 B;  2VAM A;  2HX0 A;  5CA1 B;  5LYJ B;  2Q1Y A;  3JAL A;  1JJ2 F;  1IV1 A;  5MN6 A;  5LA6 A;  5LP6 B;  5CA0 B;  4TUY B;  1VQ6 F;  2KTU A;  4U3J B;  4DRX B;  2L26 A;  4X1K B;  3RYF B;  3WJP A;  4C8I A;  3T80 A;  1VQ4 F;  4X20 B;  2KGW A;  1VHA A;  5GON A;  1KC8 H;  5EB1 B;  1JFF A;  2HQS C;  4I4T A;  1M90 H;  1X7P A;  4B46 A;  5CA1 A;  3IEW A;  5EO3 A;  1VQ7 F;  1RLG A;  3EOR A;  4YJ3 B;  2FGY A;  4G4W A;  1SA0 A;  2OTJ F;  3HKD B;  4O4I A;  3CCV F;  3WGM A;  1W59 A;  1X52 A;  3HWU A;  3JAS B;  1W5E A;  3GYQ A;  4LCK A;  3VOA A;  5EYP B;  4BT6 A;  2HRU A;  3I56 F;  2K1S A;  3IKE A;  2CVL A;  4U3J A;  4DRX A;  3GTZ A;  3CCM F;  3VYT C;  1YGY A;  3VCZ A;  2CHT A;  3V3T A;  4IIJ A;  5EAZ A;  1S72 F;  2CSL A;  1OAP A;  5HWE A;  3PAF A;  2FC3 A;  5FNV B;  3S06 A;  2AMT A;  4O4J B;  4X1K A;  4ZI7 A;  3HKE A;  3LWP C;  2ZVZ A;  4NUT A;  4M8I A;  4BT2 A;  1GZ0 A;  4O4I B;  3HKD A;  3DC2 A;  4YJ2 B;  1U40 A;  5JCO A;  1K9M H;  4ZHY B;  3N2K B;  3RYI A;  3WJR A;  4ZK7 A;  5LOV B;  1JD1 A;  3JAM M;  3OW2 F;  3CCL F;  4PWT A;  3ZP4 A;  3I7T A;  3Q8H A;  4HNA A;  1IV2 A;  3J7A R;  1VH8 A;  5ITZ B;  5C8Y B;  3CCR F;  5FJ4 C;  3G4S F;  5BMV B;  3TD4 A;  2VGM A;  3NK7 A;  2ZOD A;  3J80 M;  1N8R H;  5J2T A;  2Z1T A;  1YJN F;  3KJJ A;  3N2G B;  3MDO A;  5C8Y A;  4C81 A;  2HP3 A;  5JQG B;  2H6L A;  1KD1 H;  4C4W C;  3QHD A;  4RQO A;  1VQV A;  1Z5W A;  1KQS F;  1SA0 B;  1U43 A;  3SIU A;  2CW4 A;  2HP0 A;  3LYB A;  5JCO C;  1W58 1;  2RHO A;  3K14 A;  4BT7 A;  1VQM F;  3UT5 A;  5HY4 A;  3VMF B;  3WGK A;  1RQ7 A;  1CK2 A;  5ITZ A;  3RE3 A;  3ZO8 A;  3KHN A;  5EZY A;  3CMA F;  5HXU A;  3D01 A;  4O4L B;  3JCM M;  2UZH A;  5EIB C;  3ZOP A;  4B5C A;  1X7O A;  3CCS F;  1W2B F;  3FD6 A;  3LME A;  4TV9 A;  3RA6 A;  3CC7 F;  1UFY A;  1IV4 A;  2ZVY A;  4G4X A;  4U39 A;  3V4D A;  5EIB D;  4F6R B;  2HVY D;  2N48 A;  5LXT B;  2CWJ A;  2H8E A;  2H8C A;  3L7Q A;  3RYC B;  3QUW A;  1NQ3 A;  4G4Z A;  1VQN F;  1YIJ F;  4O2B A;  1COM A;  4X20 A;  2UYK A;  4EB6 B;  5B8F A;  3E1Y A;  1RLU A;  3RYH A;  5GAP K;  1PXW A;  5IJ0 B;  1U3L A;  2HP0 B;  4TZZ A;  1X25 A;  4WBN B;  2I6D A;  4EI7 A;  2OTL F;  3F6M A;  2G9I A;  3LFO A;  4C8G A;  1H7M A;  1TUB A;  1DBF A;  2YYE A;  4EI8 A;  4O4H B;  3JAW B;  2MQE A;  5GIN C;  1U3P A;  3K12 A;  5HY2 A;  2W8B C;  1YQN A;  3BYQ A;  3S0Y A;  4I4T B;  3JAT A;  1W3E X;  3HKB B;  3IKF A;  3KIZ A;  4ZHV A;  3VTI C;  5CB4 B;  3WJQ A;  4ZOL A;  1GO1 A;  3MQW A;  3CG6 A;  1FNJ A;  3LWQ C;  3AGK A;  3IR9 A;  5A2Q M;  1FNK A;  1GX1 A;  2UYN B;  1QU9 A;  1T0A A;  3VIU A;  3E20 B;  3FPI A;  3NVI B;  1FSZ A;  4BT3 A;  4IHJ A;  2BO1 A;  3FBA A;  1QVG F;  4G88 A;  4BT5 A;  3HJW C;  3JVH A;  1W42 A;  5EYP A;  3C9T A;  4BVS A;  3N4Y A;  4I55 A;  3TD5 A;  3CCE F;  3CXC F;  1Q86 H;  5KMG B;  2R6R 1;  2P6Y A;  3V7Q A;  1RQ2 A;  3C9U A;  1VQ5 F;  1W41 A;  3WXM B;  3C9R A;  2LBW A;  3F0D A;  2HRY A;  3OBY A;  1TUB B;  2BTQ B;  3VYS C;  4HNA B;  1Q8R A;  2B33 A;  1SZQ A;  3D54 A;  1H47 A;  3OBW A;  5HY1 A;  3S02 A;  3JAK A;  4ZHQ A;  2GLZ A;  2LBT A;  3MBM A;  3ON1 A;  5IJ9 A;  3R0P A;  1H48 A;  5HXZ A;  3E22 B;  1YIT F;  3FD5 A;  1KNK A;  1W5F A;  2AIF A;  1W57 A;  3WPW A;  4ZOL B;  2QA4 F;  1J7H A;  5MN4 A;  4I50 A;  3UT5 B;  5KMG A;  4X1I B;  2PHN A;  2Z1F A;  4XCQ A;  2ALE A;  1VK3 A;  3WPX A;  2VGN A;  4O4L A;  4X3M A;  3ERN A;  3N4Z A;  1K8A H;  4X1I A;  4YJ3 A;  5HP7 A;  4I55 B;  4BVQ A;  5G4U C;  4IIJ B;  1W5A A;  1UI9 A;  3CPW F;  3LWV C;  3M84 A;  5IJ9 B;  2R75 1;  2I6R A;  3ESJ A;  5GON B;  4TUY A;  5IYZ A;  5J2U A;  2IG8 A;  1XBI A;  1XHO A;  3VO8 A;  3CME F;  3DDN A;  3E22 A;  3F0E A;  3CPQ A;  3ZP7 A;  1FFX A;  3G6E F;  3P4E A;  1NJI H;  5JVD A;  5EB0 A;  4EI9 A;  3I3F A;  3JAK B;  4ZHQ B;  3N2K A;  3ELC A;  2ZAU A;  1VQ8 F;  5GIP C;  3HKC A;  3HKB A;  1TVK B;  4ERH A;  4O2B B;  2OTM A;  3C8L A;  2JNB A;  2LCA A;  3MCA B;  4RHA A;  4BT4 A;  4FFB B;  4BVR A;  2OZB A;  2CHS A;  3JAW A;  1XRG A;  5IJ0 A;  5LOV A;  5FNV A;  1E7K A;  5BMV A;  2VAP A;  3RYI B;  3VI6 A;  3PLA C;  1CLI A;  1JN1 A;  2HS4 A;  3JAT B;  1QD9 A;  2KTV A;  4I50 B;  4LNU B;  4O2A A;  4G4Y A;  3I55 F;  2BTU A;  2V9Y A;  2KG4 A;  3CYP B;  5JH7 B;  3HTN A;  3LDT A;  4O4H A;  3S03 A;  4BVT A;  1JY8 A;  4X1Y A;  3CB2 A;  5JQG A;  3LWO C;  3U0O A;  3FFM A;  2UYN A;  2DYY A;  5EWR A;  4WBN A;  1VQ9 F;  1W55 A;  1CN7 A;  1RA4 A;  3JAL B;  4R40 B;  3S0H A;  4C82 A;  2LBX A;  1JFF B;  3J81 M;  3C9S A;  3VOB A;  5CA0 A;  1QVF F;  2UYP A;  1Q7Y H;  3JAR B;  3M4S A;  4E6E A;  1VQK F;  4ZHW A;  4TV9 B;  3OON A;  3N2G A;  1Q81 H;  2DT4 A;  3V7E A;  4FFB A;  3B6N A;  3IEQ A;  3RA5 A;  3CCJ F;  3O85 A;  1VQP F;  4G4V A;  3CYQ A;  3QTY A;  5GAN K;  1ZWZ A;  1Z5V A;  3F0G A;  1Q82 H;  3WGN A;  5J2U B;  5IYZ B;  2RHJ A;  3CCQ F;  1GO0 A;  5KX5 A;  4TV8 A;  5FLX M;  3RYH B;  4B62 A;  3NMU C;  1NMU B;  2HS3 A;  2IAF A;  1VQO F;  2ZOV A;  4B45 A;  3KJK A;  2UYJ A;  3CD6 F;  1YHQ F;  2CZW A;  2QTP A;  5JH7 A;  1SDS A;  1OFU A;  5G4V C;  5LXT A;  2HS0 A;  3JAR A;  2Z1U A;  3KE1 A;  5HY0 A;  1XV2 A;  4X3L A;  3RYC A;  3K2X A;  2Q1X A;  3D00 A;  2RB9 A;  3MCQ A;  4YJ2 A;  5MN5 A;  1PF5 A;  2BTO A;  1IV3 A;  1M1K H;  3HKE B;  1ONI A;  4DXD A;  5CB4 A;  5DCV A;  3WGL A;  2ZF8 A;  5LA6 B;  4EB6 A;  4BY9 D;  3IMP A;  2Z01 A;  1KNJ A;  3S0W A;  3K0T A;  5LP6 C;  1R1M A;  4KWE A;  3WGJ A;  3RYF A;  4O4J A;  5J2T B;  1K73 H;  5KX5 B;  5JVD B;  1FFX B;  2VAW A;  4IHJ B;  4NWO B;  2Z1E A;  1W5B A; 
#chains in the Genus database with same CATH homology
 3NVI B;  1K9M H;  2KTV A;  3HAX D;  2BO1 A;  3I55 F;  2KG4 A;  3JAM M;  3OW2 F;  1QVG F;  3CCL F;  3HJW C;  1W42 A;  3CC2 F;  2WAL A;  4BVT A;  4BVS A;  3N4Y A;  3CCE F;  3CXC F;  1Q86 H;  3J7A R;  5IT9 M;  3LWO C;  3CCR F;  3FFM A;  5FJ4 C;  1YI2 F;  3G4S F;  5EWR A;  1VQ9 F;  1CN7 A;  1RA4 A;  3V7Q A;  2VGM A;  3NK7 A;  3CC4 F;  3J80 M;  2LBX A;  1N8R H;  1VQ5 F;  1W41 A;  3J81 M;  3WXM B;  1YJN F;  3NVK E;  1QVF F;  1Q7Y H;  2LBW A;  1T0K B;  1KD1 H;  1W40 A;  1VQK F;  4C4W C;  3NK6 A;  2QI2 A;  3OBY A;  1KQS F;  3G71 F;  1Q81 H;  5HY1 A;  3OBW A;  3LWR C;  2QEX F;  3SIV A;  3SIU A;  3V7E A;  3RA5 A;  2GLZ A;  3CCJ F;  1VQP F;  3O85 A;  3ON1 A;  2F9Z C;  1DT9 A;  4BW0 B;  5GAN K;  1VQM F;  1ZWZ A;  1YJ9 F;  1VQL F;  5HY4 A;  3VMF B;  5HXZ A;  1Q82 H;  1CK2 A;  1YIT F;  1YJW F;  2OHW A;  3CMA F;  1IPA A;  3JCM M;  5HXU A;  5GIO C;  2AIF A;  3CCQ F;  1GO0 A;  4NQ3 A;  3CCU F;  5FLX M;  2QA4 F;  1X7O A;  3CCS F;  1W2B F;  3RA6 A;  1JJ2 F;  3CC7 F;  3NMU C;  1NMU B;  2HVY D;  1VQO F;  1VQ6 F;  2KTU A;  3CD6 F;  1YHQ F;  4XCQ A;  2ALE A;  2CZW A;  2VGN A;  1SDS A;  5G4V C;  4X3M A;  1VQN F;  1YIJ F;  3N4Z A;  1K8A H;  1VQ4 F;  5HY0 A;  4BVQ A;  1KC8 H;  5G4U C;  3CPW F;  4X3L A;  3LWV C;  3E1Y A;  1M90 H;  1X7P A;  5GAP K;  1PXW A;  4TZZ A;  3D00 A;  4EI7 A;  2I6D A;  2OTL F;  5EO3 A;  1VQ7 F;  3LFO A;  1RLG A;  2OTJ F;  2FGY A;  1H7M A;  3CCV F;  1XBI A;  1X52 A;  3CME F;  3CPQ A;  3GYQ A;  4LCK A;  4EI8 A;  3G6E F;  1NJI H;  1M1K H;  5GIN C;  3I56 F;  4EI9 A;  5HY2 A;  3CCM F;  5DCV A;  3V3T A;  1VQ8 F;  5GIP C;  1S72 F;  1W3E X;  4BY9 D;  5HWE A;  3PAF A;  2FC3 A;  3MCA B;  2JNB A;  4BVR A;  1GO1 A;  2OZB A;  1K73 H;  3LWP C;  3CG6 A;  3LWQ C;  3AGK A;  1E7K A;  4NUT A;  3IR9 A;  5A2Q M;  3VI6 A;  3PLA C;  1GZ0 A;  3E20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...