3CCEF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cceF00
1W41A 2LBWA 2HVYD 4LCKA 2CZWA 3CCUF 3G4SF 2QEXF 3CXCF 1PXWA 2QI2A 1KQSF 1NMUB 1YJNF 4BW0B 4X3LA 4C4WC 1X7OA 3O85A 3IR9A 3CMEF 3CCVF 3CCEF 3FFMA 5GIPC 2KTUA 1X52A 1CN7A 3OBYA 3N4ZA 1VQ7F 1IPAA 3SIVA 5EO3A 1YITF 1Q82H 3LWVC 1SDSA 3E1YA 3HJWC 3AGKA 3GYQA 1Q7YH 5FJ4C 3I55F 2QA4F 1NJIH 3I56F 1DT9A 1KD1H 2I6DA 5GIOC 1VQ6F 3CCSF 3CCMF 3NMUC 3MCAB 3LWQC 3V7QA 1YJWF 1S72F 5A2QM 2AIFA 2VGMA 1K9MH 1ZWZA 1YHQF 1RA4A 3E20B 1Q81H 2VGNA 1VQ8F 3JCMM 5FLXM 3CC4F 3CC7F 3G6EF 1JJ2F 1T0KB 1VQMF 2ALEA 1M1KH 1YI2F 3OW2F 3CCLF 4TZZA 3LFOA 2OZBA 1VQKF 5GINC 5GANK 2OHWA 1K8AH 1RLGA 1H7MA 3VMFB 3CC2F 1X7PA 1YIJF 1M90H 5G4UC 1GO1A 2OTJF 1CK2A 5IT9M 1XBIA 5G4VC 3CCQF 1VQLF 1N8RH 4BY9D 3V7EA 3NK6A 1VQ4F 1W42A 5DCVA 1VQPF 2KG4A 2KTVA 2FC3A 3G71F 1QVFF 3CPWF 1VQ5F 3JAMM 3NK7A 3LWPC 3OBWA 3RA5A 1W3EX 3RA6A 1E7KA 2WALA 3CG6A 3CMAF 2BO1A 1Q86H 1QVGF 3LWOC 3HAXD 3J7AR 3SIUA 3N4YA 3WXMB 1K73H 3PLAC 1GO0A 1YJ9F 3ON1A 3CCRF 3PAFA 3CCJF 1W2BF 3J81M 4NUTA 2JNBA 5EWRA 1GZ0A 1VQOF 3NVIB 5GAPK 2OTLF 2LBXA 3NVKE 3CD6F 1VQNF 1VQ9F 3VI6A 3J80M 4X3MA 1W40A 1KC8H 3LWRC 3CPQA
chains in the Genus database with same CATH superfamily
4B45A 2NMUA 4PWTA 5IJ0B 4FFBB 2Q1XA 1NQ3A 3KJJA 4G4ZA 2H8EA 2ZVYA 1OFUA 1X7OA 3CMEF 3FFMA 1JD1A 2KTUA 3GTZA 3ZOPA 3N2KA 1UFYA 5HY4A 4TV8A 2IAFA 3E1YA 3JASB 4TUYB 3AGKA 4YJ2B 4O4LA 5IJ9A 1JFFB 2Q1YA 5LP6A 3CCMF 5KX5A 3MCAB 4IHJB 5EYPA 4WBNB 1K9MH 2EWCA 1YHQF 4G4WA 1U43A 3E20B 4G88A 1Q81H 2ZVZA 3E22B 3I3FA 4HNAB 1VQ8F 3JCMM 4X20A 4O2BA 3G6EF 1JJ2F 1J7HA 3JAKB 1YI2F 1QU9A 3OW2F 4BT7A 3LFOA 4IIJB 3FPIA 4LNUA 5GANK 3KHNA 1K8AH 3ZP4A 4EB6A 4BVRA 4O2AA 1YIJF 1M90H 3D00A 3F0FA 3RE3A 1FNJA 1FSZA 1GO1A 2HP3A 2R751 3VIUA 2HX0A 3IMPA 1ONIA 4ZI7B 3KJKA 3S0WA 2RHOA 3CCQF 3V7EA 4TV8B 4O4HB 5DCVA 3K2XA 2FC3A 4C82A 1Q8RA 4O4LB 5AVMA 5JVDB 4X1KB 3RYFB 3WGNA 2HS0A 3WJRA 4BT2A 5KX5B 3NK7A 3OBWA 3HKEA 3RA5A 2VAMA 2WALA 2BTOA 3P0ZA 1QVGF 4C8GA 4BT6A 1K73H 3CCRF 1VHAA 1DBFA 2JNBA 3T80A 4EI8A 3NVIB 4C8EA 3WGJA 2OTLF 4ZHQA 2GVIA 3N2GA 3CYPB 3HKBA 4I50A 4EB6B 2R6R1 1RQ2A 5CA1A 3WPWA 3IKEA 4U3JA 2UYNB 5JQGA 3OONA 5HY0A 3CPQA 1TVKA 2I6RA 5HP8A 3RYHA 3S02A 4BVSA 2CZWA 3CCUF 3JATA 2QEXF 3CXCF 1PXWA 2CWJA 3C9TA 1KQSF 5FNVA 1NMUB 3IKFA 3O85A 3IR9A 3TD3A 3HKEB 2OTMA 4F6RA 5GIPC 1VH8A 2VXYA 1VQ7F 3SIVA 5EO3A 5BMVB 4G4XA 4X1IB 1T0AA 4O4IB 4ZOLA 1CLIA 3GYQA 2V9YA 3I55F 5LA6B 2QA4F 2CHSA 4X1YB 3U0OA 1KD1H 2I6DA 5GIOC 3HTNA 5CA0A 4E6EA 1TUBA 3KIZA 1W581 3DDNA 3V7QA 4ZHQB 3N2GB 1W57A 3HKBB 4KWEA 5LXTA 2VGNA 2HRUA 3FD6A 3JARB 3K14A 1JN1A 4U39A 3RYIA 5FLXM 2Z1FA 5LOVB 4U3JB 1T0KB 2ALEA 5JQGB 3S0HA 4EI9A 3CB2A 5JCOC 3WJQA 3CCLF 2RHLA 5MN5A 1Z5VA 3MBMA 1VQKF 2PHNA 3JATB 3Q8HA 3L7QA 2OHWA 4B5CA 3LDTA 1UI9A 3CC2F 4DRXA 3DC2A 1X7PA 5EB0A 5G4UC 3UT5B 3VOBA 1R1MA 1VK3A 2UYKA 1VQLF 4BY9D 3NK6A 5GONB 2RB9A 4ZOLB 3FD5A 4ERHA 1XV2A 3VYUC 3I7TA 5C8YB 3S0YA 3VYSC 5CA0B 5MN4A 3JAMM 3LWPC 3VCZA 1W3EX 4RQOA 5B8FA 4YJ3A 3CMAF 3LWOC 3HAXD 3KE1A 3WXMB 3TD4A 3PLAC 1GO0A 1YJ9F 3ON1A 1RQ7A 2PMPA 3J81M 4B62A 4NUTA 5LYJA 2IG8A 3N2KB 1JY8A 4RHAA 5JH7A 1KNJA 3CD6F 5HP7A 5ITZA 5IJ9B 3VI6A 2AIZP 2HQSC 5LP6B 3J80M 3JALA 1W40A 2L26A 3VYTC 5EYPB 2QTPA 2BO1A 3S06A 2LBWA 2FGYA 1W5EA 2RHJA 4X20B 4O2BB 3G4SF 4I55A 5EZYA 2VAPA 4BW0B 4X3LA 2MQEA 3HKCA 4LNUB 3HWUA 3CCEF 1SA0A 1VQVA 1X52A 2BTUA 4ZK7A 2AMTA 3N4ZA 1IPAA 1YITF 4O2AB 5J2TA 3M84A 3LWVC 2DT4A 2YYEA 3HJWC 1Q7YH 5FJ4C 5HY1A 2Z1EA 1NJIH 2Z01A 1RLUA 3I56F 2H8CA 1U3PA 3BYQA 3ERNA 3CCSF 1PF5A 3NMUC 2DYYA 3WPXA 3C9SA 5KMGA 5HXZA 5A2QM 5JH7B 2RHHA 3QTYA 1KNKA 5ITZB 5EAZA 5IJ0A 4FFBA 5HWEA 3JALB 3CC7F 2GZLA 3RYCA 1VQMF 2K1SA 2P6YA 1IV4A 3F0DA 5EIBC 2N48A 4BVTA 2OZBA 3V3TA 4I55B 3VOAA 1U40A 1RLGA 1H7MA 2YXZA 2LBTA 1IV2A 3VMFB 3C8LA 4G4VA 3HKCB 2HS3A 3JASA 1SA0B 2OTJF 4YJ2A 3ESJA 1QAHA 4I50B 5IT9M 1JFFA 4O4JA 1XBIA 3QUWA 5G4VC 5CA1B 5HXUA 2CVLA 2KG4A 3G71F 2LCAA 1QVFF 1TVKB 3E22A 3CPWF 3R0PA 4HNAA 3TD5A 3K12A 3RYHB 1VQ5F 3MQWA 4BT4A 5KMGB 3MDOA 1E7KA 3CG6A 3GHZA 4IIJA 1H48A 1YQNA 2ZF8A 5FNVB 3J7AR 3SIUA 3N4YA 2ZAUA 3RYCB 5EB1B 2GLZA 2H6LA 3D54A 4F6RB 3PAFA 3M4SA 5EWRA 3V4DA 1VQOF 4ZHWA 1W5BA 4DXDA 3S03A 2ZOVA 1U3LA 2LBXA 5J2UA 4ZI7A 1VQNF 2IQQA 4NQ3A 4O4HA 1TUBB 2BTQB 5HY2A 5IYZA 4X3MA 1IV3A 3VO8A 1FFXA 3LWRC 1W5FA 3F0EA 5JVDA 4O4JB 4X1KA 1QD9A 3RYFA 5LXTB 1W41A 3IEWA 4LCKA 1W5AA 3RYIB 2KGWA 3JAWA 2QI2A 1COMA 1XRGA 2CW4A 3HKDA 1YJNF 4C4WC 3CCVF 4TV9A 1CN7A 3OBYA 2Z1TA 1OAPA 4C81A 4ZHYB 4DRXB 5JCOA 2HS4A 1Q82H 1SDSA 4C8IA 1W59A 3C9RA 3CYQA 1DT9A 1H47A 1VQ6F 3LWQC 2F9ZC 2UYNA 4I4TA 1YJWF 1S72F 5J2UB 2VGMA 1X25A 1IV1A 1ZWZA 2AIFA 1RA4A 2HVYD 1W55A 3F0GA 2HRYA 3CC4F 5IYZB 3ELCA 4BT5A 1FFXB 1M1KH 2W8BC 5MN6A 4YJ3B 4TZZA 4B46A 4EI7A 5GINC 3JAWB 3P10A 3WGKA 2UZHA 4ZHVA 3B6NA 5BMVA 1XHOA 2ZODA 3HKDB 3IEQA 3WGMA 3WJPA 5LYJB 2HP0A 4X1IA 4O4IA 4TV9B 5CB4A 5LA6A 4X1YA 3UT5A 1CK2A 1ODEA 4R40B 3K0TA 1N8RH 4XCQA 2CSLA 1VQ4F 3EORA 1W42A 1VQPF 2KTVA 2VAWA 3FBAA 3JVHA 2CHTA 4M8IA 3JARA 5LOVA 2B33A 4BVQA 3QHDA 4I4TB 1FNKA 1Z5WA 5EZYB 3RA6A 3VTIC 5LP6C 1Q86H 3D01A 3LYBA 4G4YA 4TUYA 1GX1A 2UYJA 3CCJF 1W2BF 5EIBD 3ZO8A 1GZ0A 5J2TB 5GAPK 1YGYA 4IHJA 3NVKE 4WBNA 3WGLA 3F6MA 3P4EA 4BT3A 3ZP7A 1VQ9F 2G9IA 2HP0B 5GONA 5CB4B 3C9UA 3MCQA 1KC8H 1SZQA 3M1XA 3JAKA 2UYPA 4NWOB 2Z1UA 3LMEA 5C8YA
chains in the Genus database with same CATH topology
1W41A 2LBWA 2HVYD 4LCKA 2FGYA 4BVSA 2CZWA 3CCUF 1K9MH 3G4SF 2QEXF 3CXCF 1PXWA 2QI2A 1KQSF 1NMUB 1YJNF 4BW0B 4X3LA 4C4WC 1X7OA 3O85A 3IR9A 3CMEF 3CCVF 3CCEF 3FFMA 5GIPC 2KTUA 1X52A 1CN7A 3OBYA 3N4ZA 1VQ7F 1IPAA 3SIVA 5EO3A 1YITF 1Q82H 5HY4A 3LWVC 1SDSA 3E1YA 3HJWC 3AGKA 3GYQA 1Q7YH 5FJ4C 5HY1A 3I55F 2QA4F 1NJIH 3I56F 1DT9A 1KD1H 2I6DA 5GIOC 1VQ6F 3CCSF 3CCMF 3NMUC 3MCAB 3LWQC 2F9ZC 3V7QA 1YJWF 5HXZA 5A2QM 2AIFA 2VGMA 1S72F 1ZWZA 1YHQF 1RA4A 3E20B 1Q81H 2VGNA 1VQ8F 3JCMM 5FLXM 5HWEA 3CC4F 3CC7F 3G6EF 1JJ2F 1T0KB 1VQMF 2ALEA 1M1KH 4EI9A 1YI2F 3OW2F 3CCLF 4TZZA 4BVTA 3LFOA 2OZBA 4EI7A 1VQKF 5GINC 3V3TA 5GANK 2OHWA 1K8AH 1RLGA 1H7MA 3VMFB 4BVRA 3CC2F 1X7PA 1YIJF 1M90H 3D00A 5G4UC 1GO1A 2OTJF 1CK2A 5IT9M 1XBIA 5G4VC 3CCQF 1VQLF 1N8RH 4BY9D 3V7EA 3NK6A 4XCQA 1VQ4F 1W42A 5HXUA 1VQPF 2KG4A 2KTVA 2FC3A 5DCVA 3G71F 1QVFF 3CPWF 1VQ5F 4BVQA 3JAMM 3NK7A 3LWPC 3OBWA 3RA5A 1W3EX 3RA6A 1E7KA 2WALA 3CG6A 3CMAF 2BO1A 1Q86H 1QVGF 3LWOC 3HAXD 3J7AR 3SIUA 3N4YA 3WXMB 1K73H 3PLAC 2GLZA 1YJ9F 3ON1A 3CCRF 1GO0A 3PAFA 3CCJF 1W2BF 3J81M 4NUTA 2JNBA 5EWRA 4EI8A 1GZ0A 1VQOF 3NVIB 5GAPK 2OTLF 2LBXA 3NVKE 3CD6F 1VQNF 1VQ9F 3VI6A 3J80M 4NQ3A 5HY2A 4X3MA 1W40A 1KC8H 3LWRC 5HY0A 3CPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W41 A;  2LBW A;  2HVY D;  4LCK A;  2CZW A;  3CCU F;  3G4S F;  2QEX F;  3CXC F;  1PXW A;  2QI2 A;  1KQS F;  1NMU B;  1YJN F;  4BW0 B;  4X3L A;  4C4W C;  1X7O A;  3O85 A;  3IR9 A;  3CME F;  3CCV F;  3CCE F;  3FFM A;  5GIP C;  2KTU A;  1X52 A;  1CN7 A;  3OBY A;  3N4Z A;  1VQ7 F;  1IPA A;  3SIV A;  5EO3 A;  1YIT F;  1Q82 H;  3LWV C;  1SDS A;  3E1Y A;  3HJW C;  3AGK A;  3GYQ A;  1Q7Y H;  5FJ4 C;  3I55 F;  2QA4 F;  1NJI H;  3I56 F;  1DT9 A;  1KD1 H;  2I6D A;  5GIO C;  1VQ6 F;  3CCS F;  3CCM F;  3NMU C;  3MCA B;  3LWQ C;  3V7Q A;  1YJW F;  1S72 F;  5A2Q M;  2AIF A;  2VGM A;  1K9M H;  1ZWZ A;  1YHQ F;  1RA4 A;  3E20 B;  1Q81 H;  2VGN A;  1VQ8 F;  3JCM M;  5FLX M;  3CC4 F;  3CC7 F;  3G6E F;  1JJ2 F;  1T0K B;  1VQM F;  2ALE A;  1M1K H;  1YI2 F;  3OW2 F;  3CCL F;  4TZZ A;  3LFO A;  2OZB A;  1VQK F;  5GIN C;  5GAN K;  2OHW A;  1K8A H;  1RLG A;  1H7M A;  3VMF B;  3CC2 F;  1X7P A;  1YIJ F;  1M90 H;  5G4U C;  1GO1 A;  2OTJ F;  1CK2 A;  5IT9 M;  1XBI A;  5G4V C;  3CCQ F;  1VQL F;  1N8R H;  4BY9 D;  3V7E A;  3NK6 A;  1VQ4 F;  1W42 A;  5DCV A;  1VQP F;  2KG4 A;  2KTV A;  2FC3 A;  3G71 F;  1QVF F;  3CPW F;  1VQ5 F;  3JAM M;  3NK7 A;  3LWP C;  3OBW A;  3RA5 A;  1W3E X;  3RA6 A;  1E7K A;  2WAL A;  3CG6 A;  3CMA F;  2BO1 A;  1Q86 H;  1QVG F;  3LWO C;  3HAX D;  3J7A R;  3SIU A;  3N4Y A;  3WXM B;  1K73 H;  3PLA C;  1GO0 A;  1YJ9 F;  3ON1 A;  3CCR F;  3PAF A;  3CCJ F;  1W2B F;  3J81 M;  4NUT A;  2JNB A;  5EWR A;  1GZ0 A;  1VQO F;  3NVI B;  5GAP K;  2OTL F;  2LBX A;  3NVK E;  3CD6 F;  1VQN F;  1VQ9 F;  3VI6 A;  3J80 M;  4X3M A;  1W40 A;  1KC8 H;  3LWR C;  3CPQ A; 
#chains in the Genus database with same CATH topology
 4B45 A;  2NMU A;  4PWT A;  5IJ0 B;  4FFB B;  2Q1X A;  1NQ3 A;  3KJJ A;  4G4Z A;  2H8E A;  2ZVY A;  1OFU A;  1X7O A;  3CME F;  3FFM A;  1JD1 A;  2KTU A;  3GTZ A;  3ZOP A;  3N2K A;  1UFY A;  5HY4 A;  4TV8 A;  2IAF A;  3E1Y A;  3JAS B;  4TUY B;  3AGK A;  4YJ2 B;  4O4L A;  5IJ9 A;  1JFF B;  2Q1Y A;  5LP6 A;  3CCM F;  5KX5 A;  3MCA B;  4IHJ B;  5EYP A;  4WBN B;  1K9M H;  2EWC A;  1YHQ F;  4G4W A;  1U43 A;  3E20 B;  4G88 A;  1Q81 H;  2ZVZ A;  3E22 B;  3I3F A;  4HNA B;  1VQ8 F;  3JCM M;  4X20 A;  4O2B A;  3G6E F;  1JJ2 F;  1J7H A;  3JAK B;  1YI2 F;  1QU9 A;  3OW2 F;  4BT7 A;  3LFO A;  4IIJ B;  3FPI A;  4LNU A;  5GAN K;  3KHN A;  1K8A H;  3ZP4 A;  4EB6 A;  4BVR A;  4O2A A;  1YIJ F;  1M90 H;  3D00 A;  3F0F A;  3RE3 A;  1FNJ A;  1FSZ A;  1GO1 A;  2HP3 A;  2R75 1;  3VIU A;  2HX0 A;  3IMP A;  1ONI A;  4ZI7 B;  3KJK A;  3S0W A;  2RHO A;  3CCQ F;  3V7E A;  4TV8 B;  4O4H B;  5DCV A;  3K2X A;  2FC3 A;  4C82 A;  1Q8R A;  4O4L B;  5AVM A;  5JVD B;  4X1K B;  3RYF B;  3WGN A;  2HS0 A;  3WJR A;  4BT2 A;  5KX5 B;  3NK7 A;  3OBW A;  3HKE A;  3RA5 A;  2VAM A;  2WAL A;  2BTO A;  3P0Z A;  1QVG F;  4C8G A;  4BT6 A;  1K73 H;  3CCR F;  1VHA A;  1DBF A;  2JNB A;  3T80 A;  4EI8 A;  3NVI B;  4C8E A;  3WGJ A;  2OTL F;  4ZHQ A;  2GVI A;  3N2G A;  3CYP B;  3HKB A;  4I50 A;  4EB6 B;  2R6R 1;  1RQ2 A;  5CA1 A;  3WPW A;  3IKE A;  4U3J A;  2UYN B;  5JQG A;  3OON A;  5HY0 A;  3CPQ A;  1TVK A;  2I6R A;  5HP8 A;  3RYH A;  3S02 A;  4BVS A;  2CZW A;  3CCU F;  3JAT A;  2QEX F;  3CXC F;  1PXW A;  2CWJ A;  3C9T A;  1KQS F;  5FNV A;  1NMU B;  3IKF A;  3O85 A;  3IR9 A;  3TD3 A;  3HKE B;  2OTM A;  4F6R A;  5GIP C;  1VH8 A;  2VXY A;  1VQ7 F;  3SIV A;  5EO3 A;  5BMV B;  4G4X A;  4X1I B;  1T0A A;  4O4I B;  4ZOL A;  1CLI A;  3GYQ A;  2V9Y A;  3I55 F;  5LA6 B;  2QA4 F;  2CHS A;  4X1Y B;  3U0O A;  1KD1 H;  2I6D A;  5GIO C;  3HTN A;  5CA0 A;  4E6E A;  1TUB A;  3KIZ A;  1W58 1;  3DDN A;  3V7Q A;  4ZHQ B;  3N2G B;  1W57 A;  3HKB B;  4KWE A;  5LXT A;  2VGN A;  2HRU A;  3FD6 A;  3JAR B;  3K14 A;  1JN1 A;  4U39 A;  3RYI A;  5FLX M;  2Z1F A;  5LOV B;  4U3J B;  1T0K B;  2ALE A;  5JQG B;  3S0H A;  4EI9 A;  3CB2 A;  5JCO C;  3WJQ A;  3CCL F;  2RHL A;  5MN5 A;  1Z5V A;  3MBM A;  1VQK F;  2PHN A;  3JAT B;  3Q8H A;  3L7Q A;  2OHW A;  4B5C A;  3LDT A;  1UI9 A;  3CC2 F;  4DRX A;  3DC2 A;  1X7P A;  5EB0 A;  5G4U C;  3UT5 B;  3VOB A;  1R1M A;  1VK3 A;  2UYK A;  1VQL F;  4BY9 D;  3NK6 A;  5GON B;  2RB9 A;  4ZOL B;  3FD5 A;  4ERH A;  1XV2 A;  3VYU C;  3I7T A;  5C8Y B;  3S0Y A;  3VYS C;  5CA0 B;  5MN4 A;  3JAM M;  3LWP C;  3VCZ A;  1W3E X;  4RQO A;  5B8F A;  4YJ3 A;  3CMA F;  3LWO C;  3HAX D;  3KE1 A;  3WXM B;  3TD4 A;  3PLA C;  1GO0 A;  1YJ9 F;  3ON1 A;  1RQ7 A;  2PMP A;  3J81 M;  4B62 A;  4NUT A;  5LYJ A;  2IG8 A;  3N2K B;  1JY8 A;  4RHA A;  5JH7 A;  1KNJ A;  3CD6 F;  5HP7 A;  5ITZ A;  5IJ9 B;  3VI6 A;  2AIZ P;  2HQS C;  5LP6 B;  3J80 M;  3JAL A;  1W40 A;  2L26 A;  3VYT C;  5EYP B;  2QTP A;  2BO1 A;  3S06 A;  2LBW A;  2FGY A;  1W5E A;  2RHJ A;  4X20 B;  4O2B B;  3G4S F;  4I55 A;  5EZY A;  2VAP A;  4BW0 B;  4X3L A;  2MQE A;  3HKC A;  4LNU B;  3HWU A;  3CCE F;  1SA0 A;  1VQV A;  1X52 A;  2BTU A;  4ZK7 A;  2AMT A;  3N4Z A;  1IPA A;  1YIT F;  4O2A B;  5J2T A;  3M84 A;  3LWV C;  2DT4 A;  2YYE A;  3HJW C;  1Q7Y H;  5FJ4 C;  5HY1 A;  2Z1E A;  1NJI H;  2Z01 A;  1RLU A;  3I56 F;  2H8C A;  1U3P A;  3BYQ A;  3ERN A;  3CCS F;  1PF5 A;  3NMU C;  2DYY A;  3WPX A;  3C9S A;  5KMG A;  5HXZ A;  5A2Q M;  5JH7 B;  2RHH A;  3QTY A;  1KNK A;  5ITZ B;  5EAZ A;  5IJ0 A;  4FFB A;  5HWE A;  3JAL B;  3CC7 F;  2GZL A;  3RYC A;  1VQM F;  2K1S A;  2P6Y A;  1IV4 A;  3F0D A;  5EIB C;  2N48 A;  4BVT A;  2OZB A;  3V3T A;  4I55 B;  3VOA A;  1U40 A;  1RLG A;  1H7M A;  2YXZ A;  2LBT A;  1IV2 A;  3VMF B;  3C8L A;  4G4V A;  3HKC B;  2HS3 A;  3JAS A;  1SA0 B;  2OTJ F;  4YJ2 A;  3ESJ A;  1QAH A;  4I50 B;  5IT9 M;  1JFF A;  4O4J A;  1XBI A;  3QUW A;  5G4V C;  5CA1 B;  5HXU A;  2CVL A;  2KG4 A;  3G71 F;  2LCA A;  1QVF F;  1TVK B;  3E22 A;  3CPW F;  3R0P A;  4HNA A;  3TD5 A;  3K12 A;  3RYH B;  1VQ5 F;  3MQW A;  4BT4 A;  5KMG B;  3MDO A;  1E7K A;  3CG6 A;  3GHZ A;  4IIJ A;  1H48 A;  1YQN A;  2ZF8 A;  5FNV B;  3J7A R;  3SIU A;  3N4Y A;  2ZAU A;  3RYC B;  5EB1 B;  2GLZ A;  2H6L A;  3D54 A;  4F6R B;  3PAF A;  3M4S A;  5EWR A;  3V4D A;  1VQO F;  4ZHW A;  1W5B A;  4DXD A;  3S03 A;  2ZOV A;  1U3L A;  2LBX A;  5J2U A;  4ZI7 A;  1VQN F;  2IQQ A;  4NQ3 A;  4O4H A;  1TUB B;  2BTQ B;  5HY2 A;  5IYZ A;  4X3M A;  1IV3 A;  3VO8 A;  1FFX A;  3LWR C;  1W5F A;  3F0E A;  5JVD A;  4O4J B;  4X1K A;  1QD9 A;  3RYF A;  5LXT B;  1W41 A;  3IEW A;  4LCK A;  1W5A A;  3RYI B;  2KGW A;  3JAW A;  2QI2 A;  1COM A;  1XRG A;  2CW4 A;  3HKD A;  1YJN F;  4C4W C;  3CCV F;  4TV9 A;  1CN7 A;  3OBY A;  2Z1T A;  1OAP A;  4C81 A;  4ZHY B;  4DRX B;  5JCO A;  2HS4 A;  1Q82 H;  1SDS A;  4C8I A;  1W59 A;  3C9R A;  3CYQ A;  1DT9 A;  1H47 A;  1VQ6 F;  3LWQ C;  2F9Z C;  2UYN A;  4I4T A;  1YJW F;  1S72 F;  5J2U B;  2VGM A;  1X25 A;  1IV1 A;  1ZWZ A;  2AIF A;  1RA4 A;  2HVY D;  1W55 A;  3F0G A;  2HRY A;  3CC4 F;  5IYZ B;  3ELC A;  4BT5 A;  1FFX B;  1M1K H;  2W8B C;  5MN6 A;  4YJ3 B;  4TZZ A;  4B46 A;  4EI7 A;  5GIN C;  3JAW B;  3P10 A;  3WGK A;  2UZH A;  4ZHV A;  3B6N A;  5BMV A;  1XHO A;  2ZOD A;  3HKD B;  3IEQ A;  3WGM A;  3WJP A;  5LYJ B;  2HP0 A;  4X1I A;  4O4I A;  4TV9 B;  5CB4 A;  5LA6 A;  4X1Y A;  3UT5 A;  1CK2 A;  1ODE A;  4R40 B;  3K0T A;  1N8R H;  4XCQ A;  2CSL A;  1VQ4 F;  3EOR A;  1W42 A;  1VQP F;  2KTV A;  2VAW A;  3FBA A;  3JVH A;  2CHT A;  4M8I A;  3JAR A;  5LOV A;  2B33 A;  4BVQ A;  3QHD A;  4I4T B;  1FNK A;  1Z5W A;  5EZY B;  3RA6 A;  3VTI C;  5LP6 C;  1Q86 H;  3D01 A;  3LYB A;  4G4Y A;  4TUY A;  1GX1 A;  2UYJ A;  3CCJ F;  1W2B F;  5EIB D;  3ZO8 A;  1GZ0 A;  5J2T B;  5GAP K;  1YGY A;  4IHJ A;  3NVK E;  4WBN A;  3WGL A;  3F6M A;  3P4E A;  4BT3 A;  3ZP7 A;  1VQ9 F;  2G9I A;  2HP0 B;  5GON A;  5CB4 B;  3C9U A;  3MCQ A;  1KC8 H;  1SZQ A;  3M1X A;  3JAK A;  2UYP A;  4NWO B;  2Z1U A;  3LME A;  5C8Y A; 
#chains in the Genus database with same CATH homology
 1W41 A;  2LBW A;  2HVY D;  4LCK A;  2FGY A;  4BVS A;  2CZW A;  3CCU F;  1K9M H;  3G4S F;  2QEX F;  3CXC F;  1PXW A;  2QI2 A;  1KQS F;  1NMU B;  1YJN F;  4BW0 B;  4X3L A;  4C4W C;  1X7O A;  3O85 A;  3IR9 A;  3CME F;  3CCV F;  3CCE F;  3FFM A;  5GIP C;  2KTU A;  1X52 A;  1CN7 A;  3OBY A;  3N4Z A;  1VQ7 F;  1IPA A;  3SIV A;  5EO3 A;  1YIT F;  1Q82 H;  5HY4 A;  3LWV C;  1SDS A;  3E1Y A;  3HJW C;  3AGK A;  3GYQ A;  1Q7Y H;  5FJ4 C;  5HY1 A;  3I55 F;  2QA4 F;  1NJI H;  3I56 F;  1DT9 A;  1KD1 H;  2I6D A;  5GIO C;  1VQ6 F;  3CCS F;  3CCM F;  3NMU C;  3MCA B;  3LWQ C;  2F9Z C;  3V7Q A;  1YJW F;  5HXZ A;  5A2Q M;  2AIF A;  2VGM A;  1S72 F;  1ZWZ A;  1YHQ F;  1RA4 A;  3E20 B;  1Q81 H;  2VGN A;  1VQ8 F;  3JCM M;  5FLX M;  5HWE A;  3CC4 F;  3CC7 F;  3G6E F;  1JJ2 F;  1T0K B;  1VQM F;  2ALE A;  1M1K H;  4EI9 A;  1YI2 F;  3OW2 F;  3CCL F;  4TZZ A;  4BVT A;  3LFO A;  2OZB A;  4EI7 A;  1VQK F;  5GIN C;  3V3T A;  5GAN K;  2OHW A;  1K8A H;  1RLG A;  1H7M A;  3VMF B;  4BVR A;  3CC2 F;  1X7P A;  1YIJ F;  1M90 H;  3D00 A;  5G4U C;  1GO1 A;  2OTJ F;  1CK2 A;  5IT9 M;  1XBI A;  5G4V C;  3CCQ F;  1VQL F;  1N8R H;  4BY9 D;  3V7E A;  3NK6 A;  4XCQ A;  1VQ4 F;  1W42 A;  5HXU A;  1VQP F;  2KG4 A;  2KTV A;  2FC3 A;  5DCV A;  3G71 F;  1QVF F;  3CPW F;  1VQ5 F;  4BVQ A;  3JAM M;  3NK7 A;  3LWP C;  3OBW A;  3RA5 A;  1W3E X;  3RA6 A;  1E7K A;  2WAL A;  3CG6 A;  3CMA F;  2BO1 A;  1Q86 H;  1QVG F;  3LWO C;  3HAX D;  3J7A R;  3SIU A;  3N4Y A;  3WXM B;  1K73 H;  3PLA C;  2GLZ A;  1YJ9 F;  3ON1 A;  3CCR F;  1GO0 A;  3PAF A;  3CCJ F;  1W2B F;  3J81 M;  4NUT A;  2JNB A;  5EWR A;  4EI8 A;  1GZ0 A;  1VQO F;  3NVI B;  5GAP K;  2OTL F;  2LBX A;  3NVK E;  3CD6 F;  1VQN F;  1VQ9 F;  3VI6 A;  3J80 M;  4NQ3 A;  5HY2 A;  4X3M A;  1W40 A;  1KC8 H;  3LWR C;  5HY0 A;  3CPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...