1VQ4F

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq4F00
1K8AH 3VMFB 1YJNF 3OBWA 1Q81H 5G4UC 4X3MA 3JAMM 1VQ9F 2OTLF 1T0KB 1VQLF 3E20B 3O85A 1VQ4F 3V7QA 1YHQF 3CC7F 3GYQA 3J80M 3NK6A 3AGKA 5EO3A 1IPAA 4BY9D 3CPQA 5FJ4C 5G4VC 3G4SF 1DT9A 3OBYA 3OW2F 1W2BF 3CC2F 3LWVC 1QVGF 1M1KH 2QI2A 1S72F 2LBWA 4X3LA 1VQ7F 1GZ0A 4NUTA 1KD1H 1VQ5F 1VQ6F 1W41A 3RA6A 3NMUC 1W40A 1QVFF 3CCUF 2VGMA 5FLXM 3CCQF 2KTUA 2VGNA 2FC3A 1YJ9F 5GIPC 3LWOC 3LWRC 1VQMF 3N4ZA 3WXMB 3CMAF 4LCKA 3CCLF 1GO1A 1H7MA 1VQNF 2QEXF 1RLGA 3I55F 3CCEF 3CCRF 3LFOA 1YIJF 3V7EA 1N8RH 3CCVF 1XBIA 3HAXD 3CCSF 1X7PA 4TZZA 5GIOC 2OTJF 5DCVA 3CXCF 1X7OA 1GO0A 3PLAC 3N4YA 2LBXA 3CC4F 2HVYD 3J7AR 3PAFA 1NMUB 1X52A 5GANK 2OHWA 3I56F 1JJ2F 2I6DA 4C4WC 5IT9M 1K9MH 1KC8H 2QA4F 1Q82H 2KG4A 1W3EX 5EWRA 1YITF 3CCMF 2WALA 3FFMA 2OZBA 3NVKE 3CMEF 5GINC 1VQOF 5GAPK 1PXWA 1RA4A 3RA5A 1YI2F 2JNBA 3E1YA 1E7KA 1VQPF 2BO1A 1YJWF 1NJIH 3CPWF 2CZWA 3JCMM 3ON1A 1KQSF 3CG6A 1Q86H 3LWPC 1VQKF 3MCAB 3CD6F 1CK2A 3J81M 3SIVA 4BW0B 1W42A 3LWQC 2ALEA 2AIFA 1M90H 3VI6A 1Q7YH 1ZWZA 3CCJF 3SIUA 1CN7A 3NVIB 3G71F 3IR9A 5A2QM 3NK7A 3G6EF 1K73H 2KTVA 1SDSA 3HJWC 1VQ8F
chains in the Genus database with same CATH superfamily
2HRUA 1TUBB 1K8AH 1YJNF 1Q81H 2HRYA 4C8IA 4TUYB 2OTLF 2VAMA 1T0KB 4I50B 3WGJA 4U39A 3E20B 4BT3A 1XRGA 3GYQA 3VIUA 3JATB 4F6RA 1IPAA 1XHOA 2NMUA 3VYSC 5G4VC 3OBYA 1U3LA 5JCOA 1W2BF 2UYNB 3V3TA 5JVDB 4O2BB 3F0GA 2H8CA 1ODEA 1FNKA 4O4HA 2W8BC 2P6YA 5LA6A 3JAWA 4ZHQB 1VQ5F 2VXYA 4ZI7A 1VQ6F 1W41A 4X1KB 1TVKA 3RA6A 5FNVA 3VOBA 5HXZA 4X1YA 3K12A 2VGMA 4X1IB 3C9TA 2KTUA 2L26A 3JAKA 3TD3A 1FFXB 1ONIA 3F0DA 4XCQA 3N4ZA 4BVSA 3CYPB 3I7TA 4LNUA 3S0WA 3DDNA 3E22A 4I55A 3I55F 3IKFA 2ZF8A 3S0YA 3JASA 1VK3A 4ZHVA 3V7EA 1CLIA 1N8RH 3RYFB 2UYKA 5JQGB 3CCSF 4TZZA 1VQVA 3P0ZA 4BVQA 5GIOC 2H8EA 1Z5VA 2GLZA 3RYIA 1X25A 2CVLA 5EIBD 1NMUB 2OHWA 5IT9M 3D54A 2DT4A 5IYZA 3S02A 2KG4A 2Z01A 5ITZA 4U3JA 3CCMF 3FFMA 4F6RB 3ESJA 2GZLA 3N2GA 3CMEF 5GINC 1VQOF 2H6LA 1PXWA 3WGMA 2ZVZA 3RA5A 3TD5A 5BMVA 4O4HB 2HS4A 3WJRA 2QTPA 3JAWB 5J2TA 3FD5A 4ZI7B 1E7KA 1VQPF 2BO1A 5LOVB 1TVKB 5FNVB 4WBNA 3CPWF 1NJIH 3U0OA 3ON1A 4X1YB 1KQSF 3CG6A 1W5EA 5KMGA 3SIVA 4BW0B 2AIFA 1FSZA 3F0FA 3JAKB 3VI6A 3C9SA 1M90H 3CCJF 3IEQA 3NVIB 3G71F 1DBFA 4O4IA 5MN6A 4ZHYB 5A2QM 5IJ0A 2CW4A 2KTVA 5HY4A 2Z1TA 4LNUB 3S03A 3E22B 3UT5A 4I55B 3VMFB 2G9IA 5HP7A 3OBWA 1W59A 3OONA 1VQ4F 4EI9A 2UYJA 1W57A 3AGKA 3HKCB 3RYIB 2MQEA 2BTUA 2IAFA 3C9RA 3CPQA 5FJ4C 1DT9A 3LWVC 3CB2A 3HKBA 3HKEA 1M1KH 4G4VA 2HP0A 3HTNA 5ITZB 4U3JB 2LBWA 4NQ3A 3TD4A 4PWTA 1NQ3A 1U3PA 3NMUC 4RHAA 3I3FA 3CCUF 5FLXM 1R1MA 4R40B 5KX5A 3L7QA 2FC3A 5GIPC 3LDTA 2CHTA 3R0PA 3LWOC 3LWRC 1VQMF 5CA0B 4LCKA 4BT6A 4WBNB 3CCLF 3ZP7A 1H7MA 2UZHA 3GHZA 1VQNF 3CCEF 4DXDA 3CCRF 3LFOA 3JARA 1YIJF 5EB0A 2R6R1 2Z1EA 5C8YB 2BTOA 3HAXD 3KJJA 1X7PA 5EYPA 2OTJF 1Q8RA 5IJ0B 5DCVA 3CXCF 1GO0A 5IJ9A 3PLAC 3UT5B 3RYCA 2LBXA 3J7AR 1KNKA 1X52A 5GANK 2LCAA 3I56F 1K9MH 3GTZA 4X20A 4BT2A 1Z5WA 2PHNA 5EWRA 3S06A 2WALA 1QU9A 4M8IA 2OZBA 2IQQA 3ZO8A 2YYEA 4O4JA 4NWOB 1SA0B 1U40A 3HKEB 3HKBB 2GVIA 2HP0B 1JFFA 2HX0A 4G4XA 1RLUA 4O2AA 1W5BA 1W55A 2Q1YA 3FD6A 3P4EA 3FBAA 4DRXA 1JY8A 2CSLA 5EIBC 3LWPC 3MCAB 3T80A 1CK2A 3CD6F 4ZHWA 1XV2A 5KX5B 4ZK7A 3SIUA 1CN7A 3VYUC 3KIZA 5HWEA 3NK7A 3QHDA 3G6EF 1K73H 2CHSA 3VTIC 3FPIA 2B33A 1VQ8F 3HJWC 5JH7A 1OFUA 3F0EA 5LP6C 2BTQB 3JARB 2EWCA 1YQNA 4YJ3A 3C9UA 3N2KA 3MBMA 4ERHA 2Q1XA 5EYPB 5LA6B 3O85A 5B8FA 3V7QA 2R751 3IMPA 1SZQA 3NK6A 4C82A 2HQSC 4O4LA 5EO3A 1QAHA 4G88A 3ERNA 4HNAA 3CC2F 5MN5A 4X20B 1QVGF 3KJKA 1S72F 1VQ7F 4NUTA 1YGYA 5EAZA 1JD1A 3VO8A 2FGYA 1W40A 1H48A 2RHJA 3JASB 4O4JB 1H47A 3WPWA 1JFFB 3CCQF 2VGNA 4G4WA 4IIJA 4O2AB 1UFYA 3ZP4A 3M4SA 3CMAF 4TV9A 1GO1A 4DRXB 5EZYA 2QEXF 1RLGA 1QD9A 5HY2A 3WPXA 1IV2A 4X1KA 5IYZB 2RHLA 1XBIA 3M1XA 5LP6A 2IG8A 4TV8A 3N2GB 1FFXA 2UYPA 2ZOVA 5JH7B 3N4YA 4C8EA 3CC4F 2OTMA 5CB4A 1GX1A 4YJ3B 1U43A 5BMVB 2I6DA 2N48A 4B5CA 4C4WC 3N2KB 2AMTA 3RE3A 5J2TB 3D00A 5AVMA 5GONA 4G4YA 3QTYA 1YITF 4O4LB 1UI9A 3NVKE 2ZVYA 4B62A 5KMGB 3WGNA 4HNAB 4FFBA 1RA4A 3KE1A 4O4IB 1FNJA 4ZOLA 1OAPA 3LYBA 3CYQA 1W581 3K14A 3BYQA 2CZWA 3HKDA 3JCMM 4KWEA 3RYHA 1Q86H 2Z1FA 5HXUA 4IIJB 5LYJA 1Q7YH 4BT7A 3WJQA 3IR9A 4YJ2A 2HP3A 4TV9B 5EZYB 5LOVA 4I4TA 3V4DA 5G4UC 4X3MA 3JAMM 2VAWA 1VQ9F 4EI8A 1VQLF 5LP6B 2VAPA 5MN4A 2I6RA 1YHQF 1KNJA 4TV8B 3CC7F 2KGWA 2HS0A 1VH8A 3Q8HA 3J80M 4RQOA 1IV4A 4BY9D 5CB4B 3G4SF 3OW2F 1IV3A 4C8GA 2QI2A 1J7HA 5GONB 4X3LA 2ZODA 1RQ2A 1GZ0A 2RB9A 3VYTC 4C81A 3DC2A 1KD1H 5CA1A 4BVTA 5J2UA 3MCQA 5LXTA 2AIZP 3HKCA 3JALA 1QVFF 3B6NA 3HWUA 4FFBB 2V9YA 3EORA 2DYYA 4B45A 1IV1A 3F6MA 4ZOLB 1YJ9F 4EB6A 5IJ9B 3RYCB 1VHAA 4IHJA 3S0HA 3WXMB 2RHOA 3HKDB 4G4ZA 3RYHB 3WJPA 3MQWA 2RHHA 1TUBA 1COMA 2HS3A 5LYJB 4TUYA 3CCVF 4I50A 2YXZA 4EI7A 4YJ2B 4B46A 5HY0A 3WGLA 1X7OA 1PF5A 3MDOA 3JATA 3K2XA 4BT5A 2HVYD 5CA0A 3D01A 3PAFA 1W5AA 2CWJA 4I4TB 4E6EA 3IKEA 1JJ2F 2UYNA 1KC8H 2QA4F 1Q82H 3QUWA 2ZAUA 5JVDA 4O2BA 1W3EX 5JCOC 3VCZA 5C8YA 1RQ7A 4ZHQA 2LBTA 5HP8A 1W5FA 2PMPA 3ZOPA 5GAPK 4BVRA 4X1IA 3ELCA 3M84A 5HY1A 2K1SA 1YI2F 2JNBA 3E1YA 5CA1B 5J2UB 3IEWA 5LXTB 1YJWF 3C8LA 3JALB 3P10A 4BT4A 2F9ZC 1VQKF 3VOAA 3K0TA 3WGKA 3J81M 3KHNA 1W42A 1JN1A 2ALEA 2Z1UA 1T0AA 3LWQC 1SA0A 1ZWZA 3RYFA 4EB6B 5JQGA 3JVHA 4IHJB 3LMEA 5EB1B 1SDSA
chains in the Genus database with same CATH topology
1K8AH 3VMFB 1YJNF 3OBWA 1Q81H 5G4UC 4X3MA 3JAMM 1VQ9F 2OTLF 1T0KB 4EI8A 1VQLF 3E20B 3O85A 1VQ4F 4EI9A 3V7QA 1YHQF 3CC7F 3GYQA 3J80M 3NK6A 3AGKA 5EO3A 1IPAA 4BY9D 3CPQA 5FJ4C 5G4VC 3G4SF 1DT9A 3OBYA 3OW2F 1W2BF 3CC2F 3LWVC 3V3TA 1QVGF 1M1KH 2QI2A 1S72F 2LBWA 4X3LA 1VQ7F 4NQ3A 1GZ0A 4NUTA 1KD1H 1VQ5F 4BVTA 1VQ6F 1W41A 3RA6A 2FGYA 5HXZA 1W40A 1QVFF 3NMUC 3CCUF 2VGMA 5FLXM 3CCQF 2KTUA 2VGNA 2FC3A 1YJ9F 5GIPC 3LWOC 3LWRC 4XCQA 1VQMF 3N4ZA 4BVSA 3WXMB 3CMAF 4LCKA 3CCLF 1GO1A 1H7MA 1VQNF 2QEXF 1RLGA 3I55F 3CCEF 5HY2A 3CCRF 3LFOA 1YIJF 3V7EA 1N8RH 3CCVF 1XBIA 3HAXD 3CCSF 1X7PA 4EI7A 5GIOC 4BVQA 4TZZA 2OTJF 5DCVA 5HY0A 3CXCF 1X7OA 1GO0A 3PLAC 2GLZA 3N4YA 2LBXA 3CC4F 2HVYD 3J7AR 3PAFA 1NMUB 1X52A 5GANK 2OHWA 3I56F 1JJ2F 2I6DA 4C4WC 5IT9M 1K9MH 1KC8H 2QA4F 1Q82H 3D00A 2KG4A 1W3EX 5EWRA 1YITF 3CCMF 2WALA 3FFMA 2OZBA 3NVKE 3CMEF 5GINC 1VQOF 5GAPK 1PXWA 4BVRA 1RA4A 3RA5A 5HY1A 1YI2F 2JNBA 3E1YA 1E7KA 1VQPF 2BO1A 1YJWF 1NJIH 3CPWF 2CZWA 3JCMM 3ON1A 1KQSF 3CG6A 1Q86H 2F9ZC 3LWPC 1VQKF 3MCAB 3CD6F 1CK2A 3J81M 5HXUA 3SIVA 4BW0B 1W42A 3LWQC 2ALEA 2AIFA 1M90H 3VI6A 1Q7YH 1ZWZA 3CCJF 3SIUA 1CN7A 3NVIB 3G71F 3IR9A 5A2QM 3NK7A 5HWEA 3G6EF 1K73H 2KTVA 5HY4A 1SDSA 3HJWC 1VQ8F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A H;  3VMF B;  1YJN F;  3OBW A;  1Q81 H;  5G4U C;  4X3M A;  3JAM M;  1VQ9 F;  2OTL F;  1T0K B;  1VQL F;  3E20 B;  3O85 A;  1VQ4 F;  3V7Q A;  1YHQ F;  3CC7 F;  3GYQ A;  3J80 M;  3NK6 A;  3AGK A;  5EO3 A;  1IPA A;  4BY9 D;  3CPQ A;  5FJ4 C;  5G4V C;  3G4S F;  1DT9 A;  3OBY A;  3OW2 F;  1W2B F;  3CC2 F;  3LWV C;  1QVG F;  1M1K H;  2QI2 A;  1S72 F;  2LBW A;  4X3L A;  1VQ7 F;  1GZ0 A;  4NUT A;  1KD1 H;  1VQ5 F;  1VQ6 F;  1W41 A;  3RA6 A;  3NMU C;  1W40 A;  1QVF F;  3CCU F;  2VGM A;  5FLX M;  3CCQ F;  2KTU A;  2VGN A;  2FC3 A;  1YJ9 F;  5GIP C;  3LWO C;  3LWR C;  1VQM F;  3N4Z A;  3WXM B;  3CMA F;  4LCK A;  3CCL F;  1GO1 A;  1H7M A;  1VQN F;  2QEX F;  1RLG A;  3I55 F;  3CCE F;  3CCR F;  3LFO A;  1YIJ F;  3V7E A;  1N8R H;  3CCV F;  1XBI A;  3HAX D;  3CCS F;  1X7P A;  4TZZ A;  5GIO C;  2OTJ F;  5DCV A;  3CXC F;  1X7O A;  1GO0 A;  3PLA C;  3N4Y A;  2LBX A;  3CC4 F;  2HVY D;  3J7A R;  3PAF A;  1NMU B;  1X52 A;  5GAN K;  2OHW A;  3I56 F;  1JJ2 F;  2I6D A;  4C4W C;  5IT9 M;  1K9M H;  1KC8 H;  2QA4 F;  1Q82 H;  2KG4 A;  1W3E X;  5EWR A;  1YIT F;  3CCM F;  2WAL A;  3FFM A;  2OZB A;  3NVK E;  3CME F;  5GIN C;  1VQO F;  5GAP K;  1PXW A;  1RA4 A;  3RA5 A;  1YI2 F;  2JNB A;  3E1Y A;  1E7K A;  1VQP F;  2BO1 A;  1YJW F;  1NJI H;  3CPW F;  2CZW A;  3JCM M;  3ON1 A;  1KQS F;  3CG6 A;  1Q86 H;  3LWP C;  1VQK F;  3MCA B;  3CD6 F;  1CK2 A;  3J81 M;  3SIV A;  4BW0 B;  1W42 A;  3LWQ C;  2ALE A;  2AIF A;  1M90 H;  3VI6 A;  1Q7Y H;  1ZWZ A;  3CCJ F;  3SIU A;  1CN7 A;  3NVI B;  3G71 F;  3IR9 A;  5A2Q M;  3NK7 A;  3G6E F;  1K73 H;  2KTV A;  1SDS A;  3HJW C;  1VQ8 F; 
#chains in the Genus database with same CATH topology
 2HRU A;  1TUB B;  1K8A H;  1YJN F;  1Q81 H;  2HRY A;  4C8I A;  4TUY B;  2OTL F;  2VAM A;  1T0K B;  4I50 B;  3WGJ A;  4U39 A;  3E20 B;  4BT3 A;  1XRG A;  3GYQ A;  3VIU A;  3JAT B;  4F6R A;  1IPA A;  1XHO A;  2NMU A;  3VYS C;  5G4V C;  3OBY A;  1U3L A;  5JCO A;  1W2B F;  2UYN B;  3V3T A;  5JVD B;  4O2B B;  3F0G A;  2H8C A;  1ODE A;  1FNK A;  4O4H A;  2W8B C;  2P6Y A;  5LA6 A;  3JAW A;  4ZHQ B;  1VQ5 F;  2VXY A;  4ZI7 A;  1VQ6 F;  1W41 A;  4X1K B;  1TVK A;  3RA6 A;  5FNV A;  3VOB A;  5HXZ A;  4X1Y A;  3K12 A;  2VGM A;  4X1I B;  3C9T A;  2KTU A;  2L26 A;  3JAK A;  3TD3 A;  1FFX B;  1ONI A;  3F0D A;  4XCQ A;  3N4Z A;  4BVS A;  3CYP B;  3I7T A;  4LNU A;  3S0W A;  3DDN A;  3E22 A;  4I55 A;  3I55 F;  3IKF A;  2ZF8 A;  3S0Y A;  3JAS A;  1VK3 A;  4ZHV A;  3V7E A;  1CLI A;  1N8R H;  3RYF B;  2UYK A;  5JQG B;  3CCS F;  4TZZ A;  1VQV A;  3P0Z A;  4BVQ A;  5GIO C;  2H8E A;  1Z5V A;  2GLZ A;  3RYI A;  1X25 A;  2CVL A;  5EIB D;  1NMU B;  2OHW A;  5IT9 M;  3D54 A;  2DT4 A;  5IYZ A;  3S02 A;  2KG4 A;  2Z01 A;  5ITZ A;  4U3J A;  3CCM F;  3FFM A;  4F6R B;  3ESJ A;  2GZL A;  3N2G A;  3CME F;  5GIN C;  1VQO F;  2H6L A;  1PXW A;  3WGM A;  2ZVZ A;  3RA5 A;  3TD5 A;  5BMV A;  4O4H B;  2HS4 A;  3WJR A;  2QTP A;  3JAW B;  5J2T A;  3FD5 A;  4ZI7 B;  1E7K A;  1VQP F;  2BO1 A;  5LOV B;  1TVK B;  5FNV B;  4WBN A;  3CPW F;  1NJI H;  3U0O A;  3ON1 A;  4X1Y B;  1KQS F;  3CG6 A;  1W5E A;  5KMG A;  3SIV A;  4BW0 B;  2AIF A;  1FSZ A;  3F0F A;  3JAK B;  3VI6 A;  3C9S A;  1M90 H;  3CCJ F;  3IEQ A;  3NVI B;  3G71 F;  1DBF A;  4O4I A;  5MN6 A;  4ZHY B;  5A2Q M;  5IJ0 A;  2CW4 A;  2KTV A;  5HY4 A;  2Z1T A;  4LNU B;  3S03 A;  3E22 B;  3UT5 A;  4I55 B;  3VMF B;  2G9I A;  5HP7 A;  3OBW A;  1W59 A;  3OON A;  1VQ4 F;  4EI9 A;  2UYJ A;  1W57 A;  3AGK A;  3HKC B;  3RYI B;  2MQE A;  2BTU A;  2IAF A;  3C9R A;  3CPQ A;  5FJ4 C;  1DT9 A;  3LWV C;  3CB2 A;  3HKB A;  3HKE A;  1M1K H;  4G4V A;  2HP0 A;  3HTN A;  5ITZ B;  4U3J B;  2LBW A;  4NQ3 A;  3TD4 A;  4PWT A;  1NQ3 A;  1U3P A;  3NMU C;  4RHA A;  3I3F A;  3CCU F;  5FLX M;  1R1M A;  4R40 B;  5KX5 A;  3L7Q A;  2FC3 A;  5GIP C;  3LDT A;  2CHT A;  3R0P A;  3LWO C;  3LWR C;  1VQM F;  5CA0 B;  4LCK A;  4BT6 A;  4WBN B;  3CCL F;  3ZP7 A;  1H7M A;  2UZH A;  3GHZ A;  1VQN F;  3CCE F;  4DXD A;  3CCR F;  3LFO A;  3JAR A;  1YIJ F;  5EB0 A;  2R6R 1;  2Z1E A;  5C8Y B;  2BTO A;  3HAX D;  3KJJ A;  1X7P A;  5EYP A;  2OTJ F;  1Q8R A;  5IJ0 B;  5DCV A;  3CXC F;  1GO0 A;  5IJ9 A;  3PLA C;  3UT5 B;  3RYC A;  2LBX A;  3J7A R;  1KNK A;  1X52 A;  5GAN K;  2LCA A;  3I56 F;  1K9M H;  3GTZ A;  4X20 A;  4BT2 A;  1Z5W A;  2PHN A;  5EWR A;  3S06 A;  2WAL A;  1QU9 A;  4M8I A;  2OZB A;  2IQQ A;  3ZO8 A;  2YYE A;  4O4J A;  4NWO B;  1SA0 B;  1U40 A;  3HKE B;  3HKB B;  2GVI A;  2HP0 B;  1JFF A;  2HX0 A;  4G4X A;  1RLU A;  4O2A A;  1W5B A;  1W55 A;  2Q1Y A;  3FD6 A;  3P4E A;  3FBA A;  4DRX A;  1JY8 A;  2CSL A;  5EIB C;  3LWP C;  3MCA B;  3T80 A;  1CK2 A;  3CD6 F;  4ZHW A;  1XV2 A;  5KX5 B;  4ZK7 A;  3SIU A;  1CN7 A;  3VYU C;  3KIZ A;  5HWE A;  3NK7 A;  3QHD A;  3G6E F;  1K73 H;  2CHS A;  3VTI C;  3FPI A;  2B33 A;  1VQ8 F;  3HJW C;  5JH7 A;  1OFU A;  3F0E A;  5LP6 C;  2BTQ B;  3JAR B;  2EWC A;  1YQN A;  4YJ3 A;  3C9U A;  3N2K A;  3MBM A;  4ERH A;  2Q1X A;  5EYP B;  5LA6 B;  3O85 A;  5B8F A;  3V7Q A;  2R75 1;  3IMP A;  1SZQ A;  3NK6 A;  4C82 A;  2HQS C;  4O4L A;  5EO3 A;  1QAH A;  4G88 A;  3ERN A;  4HNA A;  3CC2 F;  5MN5 A;  4X20 B;  1QVG F;  3KJK A;  1S72 F;  1VQ7 F;  4NUT A;  1YGY A;  5EAZ A;  1JD1 A;  3VO8 A;  2FGY A;  1W40 A;  1H48 A;  2RHJ A;  3JAS B;  4O4J B;  1H47 A;  3WPW A;  1JFF B;  3CCQ F;  2VGN A;  4G4W A;  4IIJ A;  4O2A B;  1UFY A;  3ZP4 A;  3M4S A;  3CMA F;  4TV9 A;  1GO1 A;  4DRX B;  5EZY A;  2QEX F;  1RLG A;  1QD9 A;  5HY2 A;  3WPX A;  1IV2 A;  4X1K A;  5IYZ B;  2RHL A;  1XBI A;  3M1X A;  5LP6 A;  2IG8 A;  4TV8 A;  3N2G B;  1FFX A;  2UYP A;  2ZOV A;  5JH7 B;  3N4Y A;  4C8E A;  3CC4 F;  2OTM A;  5CB4 A;  1GX1 A;  4YJ3 B;  1U43 A;  5BMV B;  2I6D A;  2N48 A;  4B5C A;  4C4W C;  3N2K B;  2AMT A;  3RE3 A;  5J2T B;  3D00 A;  5AVM A;  5GON A;  4G4Y A;  3QTY A;  1YIT F;  4O4L B;  1UI9 A;  3NVK E;  2ZVY A;  4B62 A;  5KMG B;  3WGN A;  4HNA B;  4FFB A;  1RA4 A;  3KE1 A;  4O4I B;  1FNJ A;  4ZOL A;  1OAP A;  3LYB A;  3CYQ A;  1W58 1;  3K14 A;  3BYQ A;  2CZW A;  3HKD A;  3JCM M;  4KWE A;  3RYH A;  1Q86 H;  2Z1F A;  5HXU A;  4IIJ B;  5LYJ A;  1Q7Y H;  4BT7 A;  3WJQ A;  3IR9 A;  4YJ2 A;  2HP3 A;  4TV9 B;  5EZY B;  5LOV A;  4I4T A;  3V4D A;  5G4U C;  4X3M A;  3JAM M;  2VAW A;  1VQ9 F;  4EI8 A;  1VQL F;  5LP6 B;  2VAP A;  5MN4 A;  2I6R A;  1YHQ F;  1KNJ A;  4TV8 B;  3CC7 F;  2KGW A;  2HS0 A;  1VH8 A;  3Q8H A;  3J80 M;  4RQO A;  1IV4 A;  4BY9 D;  5CB4 B;  3G4S F;  3OW2 F;  1IV3 A;  4C8G A;  2QI2 A;  1J7H A;  5GON B;  4X3L A;  2ZOD A;  1RQ2 A;  1GZ0 A;  2RB9 A;  3VYT C;  4C81 A;  3DC2 A;  1KD1 H;  5CA1 A;  4BVT A;  5J2U A;  3MCQ A;  5LXT A;  2AIZ P;  3HKC A;  3JAL A;  1QVF F;  3B6N A;  3HWU A;  4FFB B;  2V9Y A;  3EOR A;  2DYY A;  4B45 A;  1IV1 A;  3F6M A;  4ZOL B;  1YJ9 F;  4EB6 A;  5IJ9 B;  3RYC B;  1VHA A;  4IHJ A;  3S0H A;  3WXM B;  2RHO A;  3HKD B;  4G4Z A;  3RYH B;  3WJP A;  3MQW A;  2RHH A;  1TUB A;  1COM A;  2HS3 A;  5LYJ B;  4TUY A;  3CCV F;  4I50 A;  2YXZ A;  4EI7 A;  4YJ2 B;  4B46 A;  5HY0 A;  3WGL A;  1X7O A;  1PF5 A;  3MDO A;  3JAT A;  3K2X A;  4BT5 A;  2HVY D;  5CA0 A;  3D01 A;  3PAF A;  1W5A A;  2CWJ A;  4I4T B;  4E6E A;  3IKE A;  1JJ2 F;  2UYN A;  1KC8 H;  2QA4 F;  1Q82 H;  3QUW A;  2ZAU A;  5JVD A;  4O2B A;  1W3E X;  5JCO C;  3VCZ A;  5C8Y A;  1RQ7 A;  4ZHQ A;  2LBT A;  5HP8 A;  1W5F A;  2PMP A;  3ZOP A;  5GAP K;  4BVR A;  4X1I A;  3ELC A;  3M84 A;  5HY1 A;  2K1S A;  1YI2 F;  2JNB A;  3E1Y A;  5CA1 B;  5J2U B;  3IEW A;  5LXT B;  1YJW F;  3C8L A;  3JAL B;  3P10 A;  4BT4 A;  2F9Z C;  1VQK F;  3VOA A;  3K0T A;  3WGK A;  3J81 M;  3KHN A;  1W42 A;  1JN1 A;  2ALE A;  2Z1U A;  1T0A A;  3LWQ C;  1SA0 A;  1ZWZ A;  3RYF A;  4EB6 B;  5JQG A;  3JVH A;  4IHJ B;  3LME A;  5EB1 B;  1SDS A; 
#chains in the Genus database with same CATH homology
 1K8A H;  3VMF B;  1YJN F;  3OBW A;  1Q81 H;  5G4U C;  4X3M A;  3JAM M;  1VQ9 F;  2OTL F;  1T0K B;  4EI8 A;  1VQL F;  3E20 B;  3O85 A;  1VQ4 F;  4EI9 A;  3V7Q A;  1YHQ F;  3CC7 F;  3GYQ A;  3J80 M;  3NK6 A;  3AGK A;  5EO3 A;  1IPA A;  4BY9 D;  3CPQ A;  5FJ4 C;  5G4V C;  3G4S F;  1DT9 A;  3OBY A;  3OW2 F;  1W2B F;  3CC2 F;  3LWV C;  3V3T A;  1QVG F;  1M1K H;  2QI2 A;  1S72 F;  2LBW A;  4X3L A;  1VQ7 F;  4NQ3 A;  1GZ0 A;  4NUT A;  1KD1 H;  1VQ5 F;  4BVT A;  1VQ6 F;  1W41 A;  3RA6 A;  2FGY A;  5HXZ A;  1W40 A;  1QVF F;  3NMU C;  3CCU F;  2VGM A;  5FLX M;  3CCQ F;  2KTU A;  2VGN A;  2FC3 A;  1YJ9 F;  5GIP C;  3LWO C;  3LWR C;  4XCQ A;  1VQM F;  3N4Z A;  4BVS A;  3WXM B;  3CMA F;  4LCK A;  3CCL F;  1GO1 A;  1H7M A;  1VQN F;  2QEX F;  1RLG A;  3I55 F;  3CCE F;  5HY2 A;  3CCR F;  3LFO A;  1YIJ F;  3V7E A;  1N8R H;  3CCV F;  1XBI A;  3HAX D;  3CCS F;  1X7P A;  4EI7 A;  5GIO C;  4BVQ A;  4TZZ A;  2OTJ F;  5DCV A;  5HY0 A;  3CXC F;  1X7O A;  1GO0 A;  3PLA C;  2GLZ A;  3N4Y A;  2LBX A;  3CC4 F;  2HVY D;  3J7A R;  3PAF A;  1NMU B;  1X52 A;  5GAN K;  2OHW A;  3I56 F;  1JJ2 F;  2I6D A;  4C4W C;  5IT9 M;  1K9M H;  1KC8 H;  2QA4 F;  1Q82 H;  3D00 A;  2KG4 A;  1W3E X;  5EWR A;  1YIT F;  3CCM F;  2WAL A;  3FFM A;  2OZB A;  3NVK E;  3CME F;  5GIN C;  1VQO F;  5GAP K;  1PXW A;  4BVR A;  1RA4 A;  3RA5 A;  5HY1 A;  1YI2 F;  2JNB A;  3E1Y A;  1E7K A;  1VQP F;  2BO1 A;  1YJW F;  1NJI H;  3CPW F;  2CZW A;  3JCM M;  3ON1 A;  1KQS F;  3CG6 A;  1Q86 H;  2F9Z C;  3LWP C;  1VQK F;  3MCA B;  3CD6 F;  1CK2 A;  3J81 M;  5HXU A;  3SIV A;  4BW0 B;  1W42 A;  3LWQ C;  2ALE A;  2AIF A;  1M90 H;  3VI6 A;  1Q7Y H;  1ZWZ A;  3CCJ F;  3SIU A;  1CN7 A;  3NVI B;  3G71 F;  3IR9 A;  5A2Q M;  3NK7 A;  5HWE A;  3G6E F;  1K73 H;  2KTV A;  5HY4 A;  1SDS A;  3HJW C;  1VQ8 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...