1VQ4F

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq4F00
2KG4A 1VQ8F 2OHWA 4NUTA 4X3LA 1GO0A 3RA5A 3CC2F 3CCRF 1W41A 3G71F 3SIUA 3OBWA 3JCMM 3SIVA 1NMUB 1ZWZA 3PLAC 1Q82H 1YJ9F 5GIOC 1N8RH 1VQKF 3CCVF 3HJWC 1RA4A 3CPQA 5G4VC 3OBYA 1Q86H 4TZZA 1KD1H 1K9MH 1KC8H 1YHQF 3FFMA 3E1YA 2WALA 5GIPC 3NK6A 2JNBA 5G4UC 3V7QA 3JAMM 1W42A 3ON1A 1DT9A 2AIFA 5A2QM 3CC7F 2FC3A 3CG6A 1W40A 3HAXD 1NJIH 3CXCF 3CCSF 1YITF 3RA6A 1CK2A 5EWRA 3CCUF 2VGMA 1VQ5F 3G6EF 3CMEF 3CCLF 1VQNF 2CZWA 1W2BF 1K73H 3CCMF 1VQ6F 3VI6A 2QI2A 3CMAF 1YI2F 3N4YA 3J7AR 1S72F 2LBXA 2I6DA 3LFOA 3CPWF 1X7PA 5GANK 3PAFA 1H7MA 2BO1A 3GYQA 1RLGA 3E20B 2QA4F 5FJ4C 1CN7A 3J81M 3CC4F 3AGKA 1VQMF 1GO1A 2OTJF 1Q81H 5GINC 1T0KB 4X3MA 3WXMB 1X52A 3CCJF 1M90H 1W3EX 3LWVC 3LWOC 3CCEF 1QVFF 4C4WC 1SDSA 3N4ZA 1IPAA 3IR9A 3LWRC 1X7OA 1VQPF 2KTUA 3LWPC 3CD6F 3NVIB 3G4SF 2OTLF 3NVKE 1M1KH 1Q7YH 1QVGF 3I56F 1YJWF 1GZ0A 3OW2F 1PXWA 2HVYD 3V7EA 3CCQF 1VQ4F 4BW0B 3I55F 2ALEA 1YJNF 2OZBA 1VQLF 5EO3A 5FLXM 3J80M 3O85A 1KQSF 1VQ9F 4BY9D 4LCKA 1VQ7F 2KTVA 1YIJF 1XBIA 5DCVA 3VMFB 1E7KA 1K8AH 1JJ2F 5GAPK 2VGNA 1VQOF 3NK7A 3NMUC 2QEXF 3MCAB 5IT9M 2LBWA 3LWQC
chains in the Genus database with same CATH superfamily
3VIUA 3LYBA 3RA5A 3CC2F 3WPWA 5HXUA 5MN6A 3G71F 3F0GA 2CWJA 3F6MA 3OBWA 3SIUA 1ZWZA 3PLAC 4WBNA 1XV2A 1KNJA 1Q82H 3ZOPA 3FD5A 1N8RH 4RQOA 4X1YA 1JY8A 2V9YA 3K14A 3CPQA 3OBYA 5C8YB 2GZLA 2HRUA 1KD1H 1K9MH 4BT4A 3FFMA 3JARB 5JVDA 1COMA 1W5EA 2N48A 3E1YA 5ITZB 3WGLA 1KNKA 1W42A 2IQQA 3MCQA 1JFFB 5LXTA 1X25A 3KJKA 1FNJA 2VAPA 2H6LA 4YJ2A 1W5BA 3CG6A 4O4JA 5IYZB 3RA6A 1J7HA 4X1YB 3CCUF 1IV1A 3KJJA 3WGJA 4E6EA 5BMVB 2CZWA 5EIBD 3D00A 4KWEA 1K73H 3CCMF 1VQ6F 3C8LA 1IV4A 3CYPB 4B62A 2Q1YA 3WJQA 3VCZA 3C9TA 3N4YA 1U3LA 1ODEA 2GVIA 3U0OA 3LFOA 1X7PA 3C9RA 4M8IA 3HKEA 2BO1A 3MDOA 1U43A 2KGWA 1XRGA 3WGKA 2UYNA 3AGKA 5HWEA 5KMGB 2LBTA 1GO1A 2B33A 5HP8A 5GINC 3WXMB 2HS0A 1W3EX 4R40B 3S0YA 3LWOC 3WJPA 1QVFF 3R0PA 3WGMA 1X7OA 2KTUA 3VOAA 3M84A 4LNUA 5FNVB 5JCOA 2OTLF 5GONB 1W57A 1Q7YH 1FSZA 1QVGF 1W5AA 3S02A 4I50B 1RQ2A 1W55A 3F0DA 4BW0B 3QHDA 4DXDA 2ALEA 1YJNF 3E22B 4FFBA 5FLXM 4HNAA 3CYQA 3L7QA 3J80M 3O85A 4LNUB 5J2TB 5JH7A 3V4DA 5HP7A 4O4LB 2KTVA 2ZF8A 3ZP4A 1XBIA 4X1KA 2HP0A 5DCVA 2VGNA 3CB2A 4ZHVA 4ZHQA 2EWCA 4ZHWA 4HNAB 3JATA 4G4ZA 3MCAB 4DRXA 4F6RA 3HKDA 2KG4A 3P10A 4EI9A 2OHWA 1GO0A 1R1MA 3WPXA 1JD1A 4ZHYB 1YQNA 2DYYA 3N2KA 2UYKA 1W581 3S0HA 2W8BC 3SIVA 1NMUB 3VYSC 3RYIB 1H48A 2IG8A 3ZO8A 1YJ9F 4BT3A 2VAMA 4BVRA 1VQKF 3CCVF 1RA4A 3C9SA 5MN5A 1Q86H 3WGNA 3TD4A 1OAPA 4TZZA 3N2GA 2UYPA 4YJ2B 5EYPA 4O4JB 3HTNA 1Z5VA 2WALA 3EORA 3HKCB 3NK6A 5GIPC 2BTQB 4IHJB 4I4TA 2AIFA 5A2QM 4TV9A 1TVKA 2FC3A 3JAWB 3V3TA 1W40A 1NJIH 4C82A 4RHAA 5EB1B 2CHSA 3G6EF 1VQNF 1W2BF 2ZOVA 5HY1A 2QI2A 3FD6A 3DC2A 3HWUA 5CB4B 5J2UA 5GONA 4I4TB 3K2XA 1NQ3A 5KX5A 2HRYA 4EB6B 3LDTA 4G4WA 3UT5A 3JAWA 2PMPA 3PAFA 5GANK 1W5FA 1H7MA 1RQ7A 2OTMA 3GYQA 3IEWA 5LP6B 2QA4F 3CC4F 5ITZA 3I3FA 3JAKA 2Z1UA 3K0TA 3K12A 1Q81H 1TUBB 2HP3A 1FFXA 5JCOC 4O4LA 2UYNB 5IJ9B 3LWVC 1PF5A 4C8IA 3CD6F 2H8CA 3M1XA 4BT5A 5HY2A 1M1KH 4EI7A 3KIZA 1YJWF 4TV8B 4DRXB 4F6RB 5FNVA 4I55B 1FFXB 1VQ4F 3S0WA 3VYTC 4ZOLB 3DDNA 2G9IA 1VQLF 3GHZA 4B46A 2NMUA 1VH8A 2VAWA 1VQ9F 2AMTA 3RYHB 1RLUA 3P0ZA 1VQ7F 3JVHA 3E22A 5JQGB 5CA0A 4TV8A 1YIJF 3S06A 4B45A 2GLZA 3LMEA 3VMFB 3HKDB 1K8AH 1QAHA 3F0FA 3NMUC 4IHJA 1DBFA 4I50A 2HP0B 1XHOA 2LBWA 3CCRF 4TV9B 3WJRA 2QTPA 3QUWA 4PWTA 1W41A 1SA0B 5IJ0B 5CA0B 4IIJB 4X20B 3N2GB 2I6RA 4NQ3A 3D01A 2VXYA 5EZYB 1IV2A 2HX0A 4O4HB 3JARA 3TD3A 5LA6A 1U40A 2ZAUA 1SA0A 1VK3A 5G4UC 2BTUA 3GTZA 3FPIA 3V7QA 3JATB 1DT9A 3ON1A 2F9ZC 2CW4A 4B5CA 3HAXD 3CXCF 3CCSF 1YITF 5HY0A 5IYZA 3I7TA 5C8YA 5BMVA 2HS3A 3CCLF 2R751 4YJ3B 1UI9A 3VI6A 3KHNA 3CMAF 4TUYB 5EIBC 1YI2F 1OFUA 4C81A 1JFFA 5LXTB 3OONA 2I6DA 3CPWF 5EAZA 3VYUC 4BVSA 2HQSC 3HKCA 1CN7A 3J81M 5KX5B 3D54A 4EB6A 1VQMF 1IV3A 2PHNA 4BT7A 2L26A 2YYEA 2Z1TA 2OTJF 3Q8HA 3JASA 5LYJB 4X3MA 4O4IB 4ZI7A 4ZI7B 2RHJA 3N4ZA 1IPAA 3IR9A 3HKEB 1VQPF 1Q8RA 3G4SF 3NVKE 1ONIA 1U3PA 3HKBB 5LOVA 3LWQC 5LP6A 5CA1A 2RB9A 3CCQF 2CSLA 5B8FA 3P4EA 3IKFA 2IAFA 3RE3A 5IJ0A 3QTYA 1QU9A 2RHHA 3VOBA 4BT6A 3MBMA 4LCKA 4BT2A 3RYCB 4C8EA 3ELCA 3RYCA 1GX1A 5EZYA 2YXZA 4G4XA 1YGYA 4ZK7A 2RHOA 4O4HA 1E7KA 1JJ2F 3S03A 2BTOA 3VO8A 1UFYA 5JQGA 2Z1EA 3JALA 1VQOF 3NK7A 4ZHQB 4BVTA 2QEXF 4X20A 4EI8A 4X1IB 1JN1A 5J2TA 1T0KB 1VQVA 1VQ8F 4NUTA 2CHTA 4X3LA 5EYPB 4ZOLA 2CVLA 3MQWA 3JCMM 3RYFB 4YJ3A 4G4VA 5GIOC 3RYIA 5JVDB 3FBAA 3IEQA 3JALB 4O2AA 3HJWC 4IIJA 5G4VC 4X1IA 2Z1FA 4WBNB 4G88A 3VTIC 1KC8H 2UZHA 1YHQF 2P6YA 2JNBA 3JAMM 2FGYA 3RYFA 2ZVZA 3CC7F 5LA6B 1TVKB 5HY4A 3IMPA 1CK2A 2HS4A 4O2AB 5EWRA 2ZVYA 2VGMA 1VQ5F 4O2BA 3CMEF 4O2BB 2UYJA 2ZODA 4XCQA 3F0EA 3M4SA 4NWOB 3J7AR 5CB4A 5J2UB 1S72F 2LBXA 1W59A 5LOVB 2H8EA 1RLGA 3E20B 5FJ4C 3JASB 4O4IA 3KE1A 5HXZA 2RHLA 2Q1XA 3BYQA 4FFBB 3TD5A 1TUBA 3C9UA 1SZQA 1T0AA 5EB0A 3ERNA 5IJ9A 1FNKA 1X52A 3CCJF 1M90H 3CCEF 4C4WC 3UT5B 1SDSA 2Z01A 3LWRC 3HKBA 4G4YA 4X1KB 3B6NA 3LWPC 3NVIB 4TUYA 5CA1B 1H47A 3JAKB 4ERHA 3ZP7A 2R6R1 3I56F 1CLIA 1GZ0A 3OW2F 1PXWA 4C8GA 2MQEA 4I55A 2HVYD 3V7EA 2LCAA 5JH7B 3I55F 2DT4A 3N2KB 2OZBA 2AIZP 5EO3A 5KMGA 2K1SA 1KQSF 4BY9D 3RYHA 5LYJA 1VHAA 3ESJA 1Z5WA 3T80A 4BVQA 5AVMA 1QD9A 5LP6C 5GAPK 5MN4A 3IKEA 4U3JB 4U3JA 5IT9M 4U39A
chains in the Genus database with same CATH topology
2KG4A 4EI9A 1VQ8F 2OHWA 4NUTA 4X3LA 1GO0A 3RA5A 3CC2F 5HXUA 3CCRF 1W41A 3G71F 3SIUA 3OBWA 3JCMM 3SIVA 1NMUB 1ZWZA 3PLAC 1Q82H 1YJ9F 5GIOC 4NQ3A 1N8RH 1VQKF 4BVRA 3CCVF 3HJWC 1RA4A 3CPQA 5G4VC 3OBYA 1Q86H 4TZZA 1KD1H 1K9MH 1KC8H 1YHQF 3FFMA 3E1YA 2WALA 5GIPC 3NK6A 2JNBA 5G4UC 3V7QA 3JAMM 1W42A 2FGYA 3ON1A 1DT9A 2AIFA 2F9ZC 5A2QM 3CC7F 3V3TA 2FC3A 3CG6A 1W40A 3HAXD 1NJIH 3CXCF 3CCSF 5HY4A 3RA6A 5HY0A 1CK2A 1YITF 5EWRA 3CCUF 2VGMA 1VQ5F 3G6EF 3CMEF 3CCLF 1VQNF 2CZWA 1W2BF 3D00A 1K73H 3CCMF 1VQ6F 3VI6A 4XCQA 5HY1A 2QI2A 3CMAF 1YI2F 3N4YA 3J7AR 1S72F 2LBXA 2I6DA 3LFOA 3CPWF 1X7PA 5GANK 3PAFA 1H7MA 4BVSA 2BO1A 3GYQA 1RLGA 3E20B 2QA4F 5FJ4C 1CN7A 3J81M 3CC4F 5HXZA 3AGKA 1VQMF 5HWEA 1GO1A 2OTJF 1Q81H 5GINC 1T0KB 4X3MA 3WXMB 1X52A 3CCJF 1M90H 1W3EX 3LWVC 3LWOC 3CCEF 1QVFF 4C4WC 1SDSA 3N4ZA 1IPAA 3IR9A 3LWRC 1X7OA 1VQPF 2KTUA 3LWPC 3CD6F 3NVIB 3G4SF 2OTLF 3NVKE 5HY2A 1M1KH 4EI7A 1Q7YH 1QVGF 3I56F 1YJWF 1GZ0A 3OW2F 1PXWA 2HVYD 3V7EA 3CCQF 1VQ4F 4BW0B 3I55F 2ALEA 1YJNF 2OZBA 1VQLF 5EO3A 5FLXM 3J80M 3O85A 1KQSF 1VQ9F 4BY9D 4LCKA 1VQ7F 2KTVA 1YIJF 1XBIA 5DCVA 2GLZA 4BVQA 3VMFB 1E7KA 1K8AH 1JJ2F 5GAPK 2VGNA 1VQOF 3NK7A 3NMUC 4BVTA 2QEXF 3MCAB 5IT9M 4EI8A 2LBWA 3LWQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG4 A;  1VQ8 F;  2OHW A;  4NUT A;  4X3L A;  1GO0 A;  3RA5 A;  3CC2 F;  3CCR F;  1W41 A;  3G71 F;  3SIU A;  3OBW A;  3JCM M;  3SIV A;  1NMU B;  1ZWZ A;  3PLA C;  1Q82 H;  1YJ9 F;  5GIO C;  1N8R H;  1VQK F;  3CCV F;  3HJW C;  1RA4 A;  3CPQ A;  5G4V C;  3OBY A;  1Q86 H;  4TZZ A;  1KD1 H;  1K9M H;  1KC8 H;  1YHQ F;  3FFM A;  3E1Y A;  2WAL A;  5GIP C;  3NK6 A;  2JNB A;  5G4U C;  3V7Q A;  3JAM M;  1W42 A;  3ON1 A;  1DT9 A;  2AIF A;  5A2Q M;  3CC7 F;  2FC3 A;  3CG6 A;  1W40 A;  3HAX D;  1NJI H;  3CXC F;  3CCS F;  1YIT F;  3RA6 A;  1CK2 A;  5EWR A;  3CCU F;  2VGM A;  1VQ5 F;  3G6E F;  3CME F;  3CCL F;  1VQN F;  2CZW A;  1W2B F;  1K73 H;  3CCM F;  1VQ6 F;  3VI6 A;  2QI2 A;  3CMA F;  1YI2 F;  3N4Y A;  3J7A R;  1S72 F;  2LBX A;  2I6D A;  3LFO A;  3CPW F;  1X7P A;  5GAN K;  3PAF A;  1H7M A;  2BO1 A;  3GYQ A;  1RLG A;  3E20 B;  2QA4 F;  5FJ4 C;  1CN7 A;  3J81 M;  3CC4 F;  3AGK A;  1VQM F;  1GO1 A;  2OTJ F;  1Q81 H;  5GIN C;  1T0K B;  4X3M A;  3WXM B;  1X52 A;  3CCJ F;  1M90 H;  1W3E X;  3LWV C;  3LWO C;  3CCE F;  1QVF F;  4C4W C;  1SDS A;  3N4Z A;  1IPA A;  3IR9 A;  3LWR C;  1X7O A;  1VQP F;  2KTU A;  3LWP C;  3CD6 F;  3NVI B;  3G4S F;  2OTL F;  3NVK E;  1M1K H;  1Q7Y H;  1QVG F;  3I56 F;  1YJW F;  1GZ0 A;  3OW2 F;  1PXW A;  2HVY D;  3V7E A;  3CCQ F;  1VQ4 F;  4BW0 B;  3I55 F;  2ALE A;  1YJN F;  2OZB A;  1VQL F;  5EO3 A;  5FLX M;  3J80 M;  3O85 A;  1KQS F;  1VQ9 F;  4BY9 D;  4LCK A;  1VQ7 F;  2KTV A;  1YIJ F;  1XBI A;  5DCV A;  3VMF B;  1E7K A;  1K8A H;  1JJ2 F;  5GAP K;  2VGN A;  1VQO F;  3NK7 A;  3NMU C;  2QEX F;  3MCA B;  5IT9 M;  2LBW A;  3LWQ C; 
#chains in the Genus database with same CATH topology
 3VIU A;  3LYB A;  3RA5 A;  3CC2 F;  3WPW A;  5HXU A;  5MN6 A;  3G71 F;  3F0G A;  2CWJ A;  3F6M A;  3OBW A;  3SIU A;  1ZWZ A;  3PLA C;  4WBN A;  1XV2 A;  1KNJ A;  1Q82 H;  3ZOP A;  3FD5 A;  1N8R H;  4RQO A;  4X1Y A;  1JY8 A;  2V9Y A;  3K14 A;  3CPQ A;  3OBY A;  5C8Y B;  2GZL A;  2HRU A;  1KD1 H;  1K9M H;  4BT4 A;  3FFM A;  3JAR B;  5JVD A;  1COM A;  1W5E A;  2N48 A;  3E1Y A;  5ITZ B;  3WGL A;  1KNK A;  1W42 A;  2IQQ A;  3MCQ A;  1JFF B;  5LXT A;  1X25 A;  3KJK A;  1FNJ A;  2VAP A;  2H6L A;  4YJ2 A;  1W5B A;  3CG6 A;  4O4J A;  5IYZ B;  3RA6 A;  1J7H A;  4X1Y B;  3CCU F;  1IV1 A;  3KJJ A;  3WGJ A;  4E6E A;  5BMV B;  2CZW A;  5EIB D;  3D00 A;  4KWE A;  1K73 H;  3CCM F;  1VQ6 F;  3C8L A;  1IV4 A;  3CYP B;  4B62 A;  2Q1Y A;  3WJQ A;  3VCZ A;  3C9T A;  3N4Y A;  1U3L A;  1ODE A;  2GVI A;  3U0O A;  3LFO A;  1X7P A;  3C9R A;  4M8I A;  3HKE A;  2BO1 A;  3MDO A;  1U43 A;  2KGW A;  1XRG A;  3WGK A;  2UYN A;  3AGK A;  5HWE A;  5KMG B;  2LBT A;  1GO1 A;  2B33 A;  5HP8 A;  5GIN C;  3WXM B;  2HS0 A;  1W3E X;  4R40 B;  3S0Y A;  3LWO C;  3WJP A;  1QVF F;  3R0P A;  3WGM A;  1X7O A;  2KTU A;  3VOA A;  3M84 A;  4LNU A;  5FNV B;  5JCO A;  2OTL F;  5GON B;  1W57 A;  1Q7Y H;  1FSZ A;  1QVG F;  1W5A A;  3S02 A;  4I50 B;  1RQ2 A;  1W55 A;  3F0D A;  4BW0 B;  3QHD A;  4DXD A;  2ALE A;  1YJN F;  3E22 B;  4FFB A;  5FLX M;  4HNA A;  3CYQ A;  3L7Q A;  3J80 M;  3O85 A;  4LNU B;  5J2T B;  5JH7 A;  3V4D A;  5HP7 A;  4O4L B;  2KTV A;  2ZF8 A;  3ZP4 A;  1XBI A;  4X1K A;  2HP0 A;  5DCV A;  2VGN A;  3CB2 A;  4ZHV A;  4ZHQ A;  2EWC A;  4ZHW A;  4HNA B;  3JAT A;  4G4Z A;  3MCA B;  4DRX A;  4F6R A;  3HKD A;  2KG4 A;  3P10 A;  4EI9 A;  2OHW A;  1GO0 A;  1R1M A;  3WPX A;  1JD1 A;  4ZHY B;  1YQN A;  2DYY A;  3N2K A;  2UYK A;  1W58 1;  3S0H A;  2W8B C;  3SIV A;  1NMU B;  3VYS C;  3RYI B;  1H48 A;  2IG8 A;  3ZO8 A;  1YJ9 F;  4BT3 A;  2VAM A;  4BVR A;  1VQK F;  3CCV F;  1RA4 A;  3C9S A;  5MN5 A;  1Q86 H;  3WGN A;  3TD4 A;  1OAP A;  4TZZ A;  3N2G A;  2UYP A;  4YJ2 B;  5EYP A;  4O4J B;  3HTN A;  1Z5V A;  2WAL A;  3EOR A;  3HKC B;  3NK6 A;  5GIP C;  2BTQ B;  4IHJ B;  4I4T A;  2AIF A;  5A2Q M;  4TV9 A;  1TVK A;  2FC3 A;  3JAW B;  3V3T A;  1W40 A;  1NJI H;  4C82 A;  4RHA A;  5EB1 B;  2CHS A;  3G6E F;  1VQN F;  1W2B F;  2ZOV A;  5HY1 A;  2QI2 A;  3FD6 A;  3DC2 A;  3HWU A;  5CB4 B;  5J2U A;  5GON A;  4I4T B;  3K2X A;  1NQ3 A;  5KX5 A;  2HRY A;  4EB6 B;  3LDT A;  4G4W A;  3UT5 A;  3JAW A;  2PMP A;  3PAF A;  5GAN K;  1W5F A;  1H7M A;  1RQ7 A;  2OTM A;  3GYQ A;  3IEW A;  5LP6 B;  2QA4 F;  3CC4 F;  5ITZ A;  3I3F A;  3JAK A;  2Z1U A;  3K0T A;  3K12 A;  1Q81 H;  1TUB B;  2HP3 A;  1FFX A;  5JCO C;  4O4L A;  2UYN B;  5IJ9 B;  3LWV C;  1PF5 A;  4C8I A;  3CD6 F;  2H8C A;  3M1X A;  4BT5 A;  5HY2 A;  1M1K H;  4EI7 A;  3KIZ A;  1YJW F;  4TV8 B;  4DRX B;  4F6R B;  5FNV A;  4I55 B;  1FFX B;  1VQ4 F;  3S0W A;  3VYT C;  4ZOL B;  3DDN A;  2G9I A;  1VQL F;  3GHZ A;  4B46 A;  2NMU A;  1VH8 A;  2VAW A;  1VQ9 F;  2AMT A;  3RYH B;  1RLU A;  3P0Z A;  1VQ7 F;  3JVH A;  3E22 A;  5JQG B;  5CA0 A;  4TV8 A;  1YIJ F;  3S06 A;  4B45 A;  2GLZ A;  3LME A;  3VMF B;  3HKD B;  1K8A H;  1QAH A;  3F0F A;  3NMU C;  4IHJ A;  1DBF A;  4I50 A;  2HP0 B;  1XHO A;  2LBW A;  3CCR F;  4TV9 B;  3WJR A;  2QTP A;  3QUW A;  4PWT A;  1W41 A;  1SA0 B;  5IJ0 B;  5CA0 B;  4IIJ B;  4X20 B;  3N2G B;  2I6R A;  4NQ3 A;  3D01 A;  2VXY A;  5EZY B;  1IV2 A;  2HX0 A;  4O4H B;  3JAR A;  3TD3 A;  5LA6 A;  1U40 A;  2ZAU A;  1SA0 A;  1VK3 A;  5G4U C;  2BTU A;  3GTZ A;  3FPI A;  3V7Q A;  3JAT B;  1DT9 A;  3ON1 A;  2F9Z C;  2CW4 A;  4B5C A;  3HAX D;  3CXC F;  3CCS F;  1YIT F;  5HY0 A;  5IYZ A;  3I7T A;  5C8Y A;  5BMV A;  2HS3 A;  3CCL F;  2R75 1;  4YJ3 B;  1UI9 A;  3VI6 A;  3KHN A;  3CMA F;  4TUY B;  5EIB C;  1YI2 F;  1OFU A;  4C81 A;  1JFF A;  5LXT B;  3OON A;  2I6D A;  3CPW F;  5EAZ A;  3VYU C;  4BVS A;  2HQS C;  3HKC A;  1CN7 A;  3J81 M;  5KX5 B;  3D54 A;  4EB6 A;  1VQM F;  1IV3 A;  2PHN A;  4BT7 A;  2L26 A;  2YYE A;  2Z1T A;  2OTJ F;  3Q8H A;  3JAS A;  5LYJ B;  4X3M A;  4O4I B;  4ZI7 A;  4ZI7 B;  2RHJ A;  3N4Z A;  1IPA A;  3IR9 A;  3HKE B;  1VQP F;  1Q8R A;  3G4S F;  3NVK E;  1ONI A;  1U3P A;  3HKB B;  5LOV A;  3LWQ C;  5LP6 A;  5CA1 A;  2RB9 A;  3CCQ F;  2CSL A;  5B8F A;  3P4E A;  3IKF A;  2IAF A;  3RE3 A;  5IJ0 A;  3QTY A;  1QU9 A;  2RHH A;  3VOB A;  4BT6 A;  3MBM A;  4LCK A;  4BT2 A;  3RYC B;  4C8E A;  3ELC A;  3RYC A;  1GX1 A;  5EZY A;  2YXZ A;  4G4X A;  1YGY A;  4ZK7 A;  2RHO A;  4O4H A;  1E7K A;  1JJ2 F;  3S03 A;  2BTO A;  3VO8 A;  1UFY A;  5JQG A;  2Z1E A;  3JAL A;  1VQO F;  3NK7 A;  4ZHQ B;  4BVT A;  2QEX F;  4X20 A;  4EI8 A;  4X1I B;  1JN1 A;  5J2T A;  1T0K B;  1VQV A;  1VQ8 F;  4NUT A;  2CHT A;  4X3L A;  5EYP B;  4ZOL A;  2CVL A;  3MQW A;  3JCM M;  3RYF B;  4YJ3 A;  4G4V A;  5GIO C;  3RYI A;  5JVD B;  3FBA A;  3IEQ A;  3JAL B;  4O2A A;  3HJW C;  4IIJ A;  5G4V C;  4X1I A;  2Z1F A;  4WBN B;  4G88 A;  3VTI C;  1KC8 H;  2UZH A;  1YHQ F;  2P6Y A;  2JNB A;  3JAM M;  2FGY A;  3RYF A;  2ZVZ A;  3CC7 F;  5LA6 B;  1TVK B;  5HY4 A;  3IMP A;  1CK2 A;  2HS4 A;  4O2A B;  5EWR A;  2ZVY A;  2VGM A;  1VQ5 F;  4O2B A;  3CME F;  4O2B B;  2UYJ A;  2ZOD A;  4XCQ A;  3F0E A;  3M4S A;  4NWO B;  3J7A R;  5CB4 A;  5J2U B;  1S72 F;  2LBX A;  1W59 A;  5LOV B;  2H8E A;  1RLG A;  3E20 B;  5FJ4 C;  3JAS B;  4O4I A;  3KE1 A;  5HXZ A;  2RHL A;  2Q1X A;  3BYQ A;  4FFB B;  3TD5 A;  1TUB A;  3C9U A;  1SZQ A;  1T0A A;  5EB0 A;  3ERN A;  5IJ9 A;  1FNK A;  1X52 A;  3CCJ F;  1M90 H;  3CCE F;  4C4W C;  3UT5 B;  1SDS A;  2Z01 A;  3LWR C;  3HKB A;  4G4Y A;  4X1K B;  3B6N A;  3LWP C;  3NVI B;  4TUY A;  5CA1 B;  1H47 A;  3JAK B;  4ERH A;  3ZP7 A;  2R6R 1;  3I56 F;  1CLI A;  1GZ0 A;  3OW2 F;  1PXW A;  4C8G A;  2MQE A;  4I55 A;  2HVY D;  3V7E A;  2LCA A;  5JH7 B;  3I55 F;  2DT4 A;  3N2K B;  2OZB A;  2AIZ P;  5EO3 A;  5KMG A;  2K1S A;  1KQS F;  4BY9 D;  3RYH A;  5LYJ A;  1VHA A;  3ESJ A;  1Z5W A;  3T80 A;  4BVQ A;  5AVM A;  1QD9 A;  5LP6 C;  5GAP K;  5MN4 A;  3IKE A;  4U3J B;  4U3J A;  5IT9 M;  4U39 A; 
#chains in the Genus database with same CATH homology
 2KG4 A;  4EI9 A;  1VQ8 F;  2OHW A;  4NUT A;  4X3L A;  1GO0 A;  3RA5 A;  3CC2 F;  5HXU A;  3CCR F;  1W41 A;  3G71 F;  3SIU A;  3OBW A;  3JCM M;  3SIV A;  1NMU B;  1ZWZ A;  3PLA C;  1Q82 H;  1YJ9 F;  5GIO C;  4NQ3 A;  1N8R H;  1VQK F;  4BVR A;  3CCV F;  3HJW C;  1RA4 A;  3CPQ A;  5G4V C;  3OBY A;  1Q86 H;  4TZZ A;  1KD1 H;  1K9M H;  1KC8 H;  1YHQ F;  3FFM A;  3E1Y A;  2WAL A;  5GIP C;  3NK6 A;  2JNB A;  5G4U C;  3V7Q A;  3JAM M;  1W42 A;  2FGY A;  3ON1 A;  1DT9 A;  2AIF A;  2F9Z C;  5A2Q M;  3CC7 F;  3V3T A;  2FC3 A;  3CG6 A;  1W40 A;  3HAX D;  1NJI H;  3CXC F;  3CCS F;  5HY4 A;  3RA6 A;  5HY0 A;  1CK2 A;  1YIT F;  5EWR A;  3CCU F;  2VGM A;  1VQ5 F;  3G6E F;  3CME F;  3CCL F;  1VQN F;  2CZW A;  1W2B F;  3D00 A;  1K73 H;  3CCM F;  1VQ6 F;  3VI6 A;  4XCQ A;  5HY1 A;  2QI2 A;  3CMA F;  1YI2 F;  3N4Y A;  3J7A R;  1S72 F;  2LBX A;  2I6D A;  3LFO A;  3CPW F;  1X7P A;  5GAN K;  3PAF A;  1H7M A;  4BVS A;  2BO1 A;  3GYQ A;  1RLG A;  3E20 B;  2QA4 F;  5FJ4 C;  1CN7 A;  3J81 M;  3CC4 F;  5HXZ A;  3AGK A;  1VQM F;  5HWE A;  1GO1 A;  2OTJ F;  1Q81 H;  5GIN C;  1T0K B;  4X3M A;  3WXM B;  1X52 A;  3CCJ F;  1M90 H;  1W3E X;  3LWV C;  3LWO C;  3CCE F;  1QVF F;  4C4W C;  1SDS A;  3N4Z A;  1IPA A;  3IR9 A;  3LWR C;  1X7O A;  1VQP F;  2KTU A;  3LWP C;  3CD6 F;  3NVI B;  3G4S F;  2OTL F;  3NVK E;  5HY2 A;  1M1K H;  4EI7 A;  1Q7Y H;  1QVG F;  3I56 F;  1YJW F;  1GZ0 A;  3OW2 F;  1PXW A;  2HVY D;  3V7E A;  3CCQ F;  1VQ4 F;  4BW0 B;  3I55 F;  2ALE A;  1YJN F;  2OZB A;  1VQL F;  5EO3 A;  5FLX M;  3J80 M;  3O85 A;  1KQS F;  1VQ9 F;  4BY9 D;  4LCK A;  1VQ7 F;  2KTV A;  1YIJ F;  1XBI A;  5DCV A;  2GLZ A;  4BVQ A;  3VMF B;  1E7K A;  1K8A H;  1JJ2 F;  5GAP K;  2VGN A;  1VQO F;  3NK7 A;  3NMU C;  4BVT A;  2QEX F;  3MCA B;  5IT9 M;  4EI8 A;  2LBW A;  3LWQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...