1VQ4F

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq4F00
3RA6A 2LBXA 3J7AR 1Q7YH 1M1KH 3OBWA 3V7QA 1W42A 3I56F 3CCEF 3NVKE 1K9MH 1GO0A 1VQMF 4X3LA 3CD6F 3LFOA 1GZ0A 5IT9M 1Q81H 3JCMM 3CC7F 1VQPF 4LCKA 1X52A 3N4ZA 3CPQA 3HJWC 2QA4F 5FLXM 4BY9D 3MCAB 4C4WC 2QEXF 3G6EF 3LWQC 1K8AH 1T0KB 1Q82H 5G4UC 1YHQF 2AIFA 1N8RH 3LWVC 2WALA 1X7PA 5EO3A 3VI6A 3CCUF 2OTJF 5A2QM 3PAFA 3WXMB 1VQ9F 1VQKF 2I6DA 3CC2F 3LWRC 4TZZA 3CPWF 3CCQF 1YJWF 2LBWA 3G71F 1VQ4F 1YJNF 1VQ6F 2JNBA 3CCRF 1XBIA 2OZBA 3GYQA 1VQLF 3VMFB 1W3EX 2VGNA 1VQ5F 3HAXD 1DT9A 1JJ2F 3CCSF 2CZWA 1S72F 3CC4F 1H7MA 3OW2F 3CCLF 3CCVF 1K73H 2QI2A 1W2BF 1PXWA 1M90H 2KTUA 5GANK 1SDSA 3NVIB 2OHWA 3SIVA 2KG4A 1YIJF 1QVFF 3SIUA 3FFMA 5EWRA 1YI2F 1YJ9F 1VQOF 5DCVA 2FC3A 1KD1H 3V7EA 5GIOC 1VQ8F 1GO1A 3RA5A 3CCMF 1QVGF 3AGKA 3CMEF 3CMAF 1ZWZA 1W41A 3NK6A 3LWPC 1CK2A 5GINC 3E20B 2ALEA 2OTLF 3CXCF 3OBYA 3PLAC 3NK7A 1RA4A 1VQNF 3LWOC 3IR9A 1NJIH 5FJ4C 3I55F 2KTVA 1KQSF 3J80M 1RLGA 2BO1A 3CG6A 1X7OA 5GAPK 3JAMM 4BW0B 1Q86H 2VGMA 4NUTA 5GIPC 2HVYD 1CN7A 3G4SF 5G4VC 1W40A 3O85A 3E1YA 3J81M 1KC8H 1E7KA 1IPAA 1NMUB 1YITF 1VQ7F 3ON1A 3NMUC 4X3MA 3CCJF 3N4YA
chains in the Genus database with same CATH superfamily
2CSLA 3KJKA 1VH8A 3M1XA 4C8IA 3J7AR 2K1SA 5EAZA 1TVKB 2V9YA 1TVKA 2GZLA 5EB0A 3CCEF 3NVKE 2Z01A 4XCQA 4ZOLB 3I3FA 5J2TA 3JALA 1JY8A 2G9IA 3MCQA 3HKEA 3MBMA 1VQPF 3RYHA 1X52A 3CPQA 3F0EA 4O2AB 4TV9B 2BTUA 3D54A 3KJJA 2N48A 5FLXM 1IV2A 5MN6A 5JH7A 1JD1A 4BT6A 1FNJA 3ELCA 3OONA 4B5CA 2R6R1 2AIFA 4U3JB 4WBNB 3HKCA 5EO3A 3LWVC 1COMA 2UYKA 5LA6B 4U39A 5LA6A 4BT7A 2UZHA 1YJWF 4YJ3B 2VGNA 5HY1A 1VQ5F 2HP0A 1W55A 4EI9A 1JJ2F 3CCSF 4NQ3A 2BTQB 1S72F 4NWOB 3OW2F 4BT2A 3CCLF 4G4YA 4I55A 3C9RA 3JAKB 1W5BA 4O4LA 4B62A 1PXWA 4FFBB 1M90H 5GANK 1SDSA 3NVIB 5C8YA 1YIJF 1QU9A 3HTNA 4BVQA 5CA1A 1YJ9F 5DCVA 1RQ7A 3C9UA 3GTZA 5IJ0A 1NQ3A 3D01A 4KWEA 5ITZB 1VQ8F 3F6MA 2LBTA 4F6RB 4I50A 3CMEF 1X25A 3CMAF 3LWPC 2ALEA 2OTLF 4I4TA 3Q8HA 4EB6B 1FFXB 3PLAC 2RHHA 3WGNA 3V4DA 2ZODA 3ERNA 5B8FA 3VYTC 2GVIA 4TUYB 5FJ4C 3I55F 5JVDB 5MN5A 3F0GA 3CG6A 4C8GA 5JQGA 3JAMM 3RYFA 4NUTA 5GIPC 2HVYD 4BVRA 1W40A 4O4HA 1OFUA 1IPAA 4X1IA 4BT3A 1YITF 3ON1A 2VXYA 3DC2A 2GLZA 5EIBC 5EB1B 3RA6A 4O4HB 3RYCB 2IG8A 3N2KB 1M1KH 3OBWA 4B45A 3P4EA 4EI7A 3JAWA 1FSZA 3LFOA 2IAFA 5J2TB 4X1KB 1Q81H 3JASA 2LCAA 3B6NA 3QTYA 3VOAA 4HNAB 4LCKA 1PF5A 3C8LA 4TUYA 3ZOPA 4ZHWA 3WJPA 4BY9D 1Z5WA 1T0KB 1Q82H 3IMPA 5KX5B 5BMVB 1YHQF 3HWUA 3VCZA 3KHNA 5JVDA 4ZHQA 1N8RH 4DRXA 1X7PA 3RYIB 5KX5A 2DT4A 3WJRA 2HQSC 2UYPA 4R40B 3WGJA 2HRUA 3T80A 3CPWF 3CCQF 3HKBB 2HS3A 2HX0A 3TD5A 1VQ4F 5C8YB 3IEQA 3N2KA 3JARB 2JNBA 5HXZA 3CCRF 1FNKA 5EZYA 1XBIA 4HNAA 3GYQA 2KGWA 4I55B 2W8BC 2CW4A 3LDTA 2IQQA 1XV2A 4C82A 2F9ZC 2CZWA 4X1IB 5LP6B 4G4VA 2VAPA 2VAWA 1K73H 4U3JA 5LYJA 1W5FA 2PHNA 2OHWA 3WPXA 5LXTA 2H8CA 5EIBD 2FGYA 2HS4A 4ZI7A 1IV3A 5LYJB 2HRYA 3V7EA 3VYUC 3M4SA 3CCMF 4BT5A 1QVGF 2QTPA 1W41A 1CK2A 3L7QA 1XRGA 2DYYA 2CWJA 4G4ZA 3S02A 3NK7A 5JH7B 3S0YA 2YXZA 1RA4A 4O2AA 3IR9A 3FPIA 4TV9A 1NJIH 1SA0A 2KTVA 3J80M 4WBNA 3CB2A 4EB6A 3UT5B 5LOVB 3RYIA 4TV8A 4BW0B 1Q86H 2MQEA 1CN7A 1YQNA 3JAKA 5HWEA 3JATA 1TUBB 3O85A 5HP7A 3E1YA 5FNVA 5LP6A 2Z1EA 3HKEB 3NMUC 2RHOA 2Q1XA 4X3MA 5CA1B 3RYFB 1U43A 3K2XA 1UFYA 3V3TA 5JCOC 2LBXA 3V7QA 3WGMA 1W42A 3IEWA 5EZYB 3ZP4A 3I56F 3N2GB 3CD6F 3HKBA 3S06A 1GZ0A 5IT9M 1QD9A 3JCMM 3MDOA 3CC7F 1W57A 1IV1A 4I50B 1U3LA 3RE3A 3HJWC 2VAMA 2YYEA 3QUWA 3WPWA 2I6RA 3E22B 4O4LB 4DRXB 4EI8A 4ZHQB 2ZVZA 2QEXF 3JASB 4ERHA 3LWQC 2L26A 4X1KA 1K8AH 5LOVA 4BVSA 5HP8A 3IKEA 1U40A 3K14A 2HP0B 1SA0B 2ZAUA 5HY2A 3CCUF 3LWRC 2Z1TA 4TZZA 1YJNF 4ZHVA 4M8IA 2H8EA 2OZBA 3S0HA 3C9TA 4BT4A 1W3EX 3VMFB 3VIUA 4BVTA 4DXDA 2EWCA 3HAXD 3JALB 1IV4A 1SZQA 5JCOA 5JQGB 5LXTB 1T0AA 5IJ9B 4X1YB 5GONB 5CB4B 3P10A 3CC4F 2P6YA 3JVHA 4E6EA 2QI2A 1W2BF 1J7HA 5IJ0B 3IKFA 1CLIA 5MN4A 3F0FA 1VQVA 3WGKA 1U3PA 1XHOA 1QVFF 3FFMA 5EWRA 1YI2F 5HY0A 1Q8RA 2Z1FA 3N2GA 1VQOF 4RQOA 2NMUA 1Z5VA 2FC3A 4G88A 3S03A 1KD1H 4X20B 5GIOC 4ZHYB 5ITZA 1VK3A 3RA5A 5HXUA 4IIJB 5BMVA 3ESJA 1ZWZA 3NK6A 4I4TB 3E20B 5GINC 5CA0B 3UT5A 3OBYA 4LNUA 4RHAA 2H6LA 1VQNF 3K12A 3FD5A 4ZK7A 1KQSF 3QHDA 3M84A 3ZP7A 5EYPA 5IYZB 1RLGA 2BO1A 1X7OA 3VOBA 1JFFB 4O4IB 5GAPK 3LYBA 2AMTA 5J2UB 4YJ3A 3VTIC 4IHJB 3G4SF 4FFBA 1YGYA 3VO8A 2HS0A 3TD3A 1RLUA 1KC8H 1VQ7F 2Q1YA 3N4YA 2RHLA 2BTOA 1GX1A 5EYPB 3TD4A 3R0PA 5IYZA 1KNJA 2UYNB 2OTMA 1JN1A 1Q7YH 1QAHA 3VYSC 1W5EA 4ZI7B 5J2UA 1K9MH 1GO0A 1VQMF 4X3LA 3C9SA 3LMEA 4ZOLA 5AVMA 4YJ2A 3WGLA 2RHJA 4IIJA 1RQ2A 3N4ZA 2HP3A 5LP6C 3S0WA 2QA4F 3E22A 3HKCB 2RB9A 3MCAB 1FFXA 4C4WC 2ZF8A 3G6EF 1W581 3EORA 2B33A 4LNUB 5G4UC 4F6RA 1DBFA 4PWTA 2WALA 3VI6A 2OTJF 5A2QM 3PAFA 3WXMB 5CB4A 1VQ9F 1VQKF 2I6DA 3CYPB 4O2BA 3CC2F 3HKDB 2LBWA 3WJQA 3G71F 1ODEA 5KMGA 1VQ6F 4C81A 3ZO8A 3KE1A 1OAPA 2ZOVA 5FNVB 3F0DA 3U0OA 1VQLF 1H48A 1DT9A 2CHSA 4O4JA 3KIZA 1W59A 4YJ2B 2UYJA 3MQWA 1H7MA 4O2BB 3JAWB 3CCVF 1UI9A 3K0TA 2KTUA 2UYNA 3SIVA 2KG4A 1VHAA 4X1YA 5GONA 3SIUA 3GHZA 2CHTA 1ONIA 1H47A 3BYQA 4C8EA 3RYCA 3FBAA 1GO1A 3AGKA 2R751 4O4JB 2AIZP 3CXCF 1KNKA 4B46A 5HY4A 3RYHB 3LWOC 3DDNA 2CVLA 3FD6A 4IHJA 3HKDA 5CA0A 4G4XA 1W5AA 1JFFA 4G4WA 4O4IA 1R1MA 2VGMA 3I7TA 1TUBA 3JATB 5G4VC 3CYQA 2ZVYA 4X20A 2Z1UA 3P0ZA 5KMGB 3J81M 3JARA 2PMPA 5IJ9A 1E7KA 1NMUB 4TV8B 3CCJF 3D00A
chains in the Genus database with same CATH topology
2GLZA 3RA6A 3V3TA 2LBXA 3J7AR 1Q7YH 1M1KH 3OBWA 3V7QA 1W42A 3I56F 3CCEF 3NVKE 4XCQA 4EI7A 1K9MH 1GO0A 1VQMF 4X3LA 3CD6F 3LFOA 1GZ0A 5IT9M 1Q81H 3JCMM 3CC7F 1VQPF 4LCKA 1X52A 3N4ZA 3CPQA 3HJWC 2QA4F 5FLXM 4EI8A 4BY9D 3MCAB 4C4WC 2QEXF 3G6EF 3LWQC 1K8AH 1T0KB 4BVSA 1Q82H 5G4UC 1YHQF 2AIFA 1N8RH 5HY2A 3LWVC 2WALA 1X7PA 5EO3A 3VI6A 3CCUF 2OTJF 5A2QM 3PAFA 3WXMB 1VQ9F 1VQKF 2I6DA 3CC2F 3LWRC 4TZZA 3CPWF 3CCQF 1YJWF 2LBWA 3G71F 1VQ4F 1YJNF 1VQ6F 2JNBA 5HXZA 3CCRF 1XBIA 2OZBA 3GYQA 1VQLF 4BVTA 3VMFB 1W3EX 2VGNA 5HY1A 1VQ5F 4EI9A 3HAXD 1DT9A 1JJ2F 2F9ZC 3CCSF 4NQ3A 2CZWA 1S72F 3CC4F 1H7MA 3OW2F 3CCLF 3CCVF 1K73H 2QI2A 1W2BF 1PXWA 1M90H 2KTUA 5GANK 1SDSA 3NVIB 2OHWA 3SIVA 2KG4A 1YIJF 1QVFF 3SIUA 4BVQA 3FFMA 2FGYA 5EWRA 5HY0A 1VQOF 1YJ9F 1YI2F 5DCVA 2FC3A 1KD1H 3V7EA 5GIOC 1VQ8F 1GO1A 3RA5A 5HXUA 3CCMF 1QVGF 3AGKA 3CMEF 3CMAF 1ZWZA 1W41A 3NK6A 3LWPC 1CK2A 3E20B 2ALEA 5GINC 2OTLF 3CXCF 3OBYA 3PLAC 3NK7A 5HY4A 1RA4A 1VQNF 3LWOC 3IR9A 1NJIH 5FJ4C 3I55F 2KTVA 1KQSF 3J80M 1RLGA 2BO1A 3CG6A 1X7OA 5GAPK 3JAMM 4BW0B 1Q86H 2VGMA 4NUTA 5GIPC 2HVYD 1CN7A 4BVRA 5HWEA 3G4SF 5G4VC 1W40A 3O85A 3E1YA 3J81M 1KC8H 1E7KA 1IPAA 1NMUB 1YITF 1VQ7F 3ON1A 3NMUC 4X3MA 3CCJF 3D00A 3N4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RA6 A;  2LBX A;  3J7A R;  1Q7Y H;  1M1K H;  3OBW A;  3V7Q A;  1W42 A;  3I56 F;  3CCE F;  3NVK E;  1K9M H;  1GO0 A;  1VQM F;  4X3L A;  3CD6 F;  3LFO A;  1GZ0 A;  5IT9 M;  1Q81 H;  3JCM M;  3CC7 F;  1VQP F;  4LCK A;  1X52 A;  3N4Z A;  3CPQ A;  3HJW C;  2QA4 F;  5FLX M;  4BY9 D;  3MCA B;  4C4W C;  2QEX F;  3G6E F;  3LWQ C;  1K8A H;  1T0K B;  1Q82 H;  5G4U C;  1YHQ F;  2AIF A;  1N8R H;  3LWV C;  2WAL A;  1X7P A;  5EO3 A;  3VI6 A;  3CCU F;  2OTJ F;  5A2Q M;  3PAF A;  3WXM B;  1VQ9 F;  1VQK F;  2I6D A;  3CC2 F;  3LWR C;  4TZZ A;  3CPW F;  3CCQ F;  1YJW F;  2LBW A;  3G71 F;  1VQ4 F;  1YJN F;  1VQ6 F;  2JNB A;  3CCR F;  1XBI A;  2OZB A;  3GYQ A;  1VQL F;  3VMF B;  1W3E X;  2VGN A;  1VQ5 F;  3HAX D;  1DT9 A;  1JJ2 F;  3CCS F;  2CZW A;  1S72 F;  3CC4 F;  1H7M A;  3OW2 F;  3CCL F;  3CCV F;  1K73 H;  2QI2 A;  1W2B F;  1PXW A;  1M90 H;  2KTU A;  5GAN K;  1SDS A;  3NVI B;  2OHW A;  3SIV A;  2KG4 A;  1YIJ F;  1QVF F;  3SIU A;  3FFM A;  5EWR A;  1YI2 F;  1YJ9 F;  1VQO F;  5DCV A;  2FC3 A;  1KD1 H;  3V7E A;  5GIO C;  1VQ8 F;  1GO1 A;  3RA5 A;  3CCM F;  1QVG F;  3AGK A;  3CME F;  3CMA F;  1ZWZ A;  1W41 A;  3NK6 A;  3LWP C;  1CK2 A;  5GIN C;  3E20 B;  2ALE A;  2OTL F;  3CXC F;  3OBY A;  3PLA C;  3NK7 A;  1RA4 A;  1VQN F;  3LWO C;  3IR9 A;  1NJI H;  5FJ4 C;  3I55 F;  2KTV A;  1KQS F;  3J80 M;  1RLG A;  2BO1 A;  3CG6 A;  1X7O A;  5GAP K;  3JAM M;  4BW0 B;  1Q86 H;  2VGM A;  4NUT A;  5GIP C;  2HVY D;  1CN7 A;  3G4S F;  5G4V C;  1W40 A;  3O85 A;  3E1Y A;  3J81 M;  1KC8 H;  1E7K A;  1IPA A;  1NMU B;  1YIT F;  1VQ7 F;  3ON1 A;  3NMU C;  4X3M A;  3CCJ F;  3N4Y A; 
#chains in the Genus database with same CATH topology
 2CSL A;  3KJK A;  1VH8 A;  3M1X A;  4C8I A;  3J7A R;  2K1S A;  5EAZ A;  1TVK B;  2V9Y A;  1TVK A;  2GZL A;  5EB0 A;  3CCE F;  3NVK E;  2Z01 A;  4XCQ A;  4ZOL B;  3I3F A;  5J2T A;  3JAL A;  1JY8 A;  2G9I A;  3MCQ A;  3HKE A;  3MBM A;  1VQP F;  3RYH A;  1X52 A;  3CPQ A;  3F0E A;  4O2A B;  4TV9 B;  2BTU A;  3D54 A;  3KJJ A;  2N48 A;  5FLX M;  1IV2 A;  5MN6 A;  5JH7 A;  1JD1 A;  4BT6 A;  1FNJ A;  3ELC A;  3OON A;  4B5C A;  2R6R 1;  2AIF A;  4U3J B;  4WBN B;  3HKC A;  5EO3 A;  3LWV C;  1COM A;  2UYK A;  5LA6 B;  4U39 A;  5LA6 A;  4BT7 A;  2UZH A;  1YJW F;  4YJ3 B;  2VGN A;  5HY1 A;  1VQ5 F;  2HP0 A;  1W55 A;  4EI9 A;  1JJ2 F;  3CCS F;  4NQ3 A;  2BTQ B;  1S72 F;  4NWO B;  3OW2 F;  4BT2 A;  3CCL F;  4G4Y A;  4I55 A;  3C9R A;  3JAK B;  1W5B A;  4O4L A;  4B62 A;  1PXW A;  4FFB B;  1M90 H;  5GAN K;  1SDS A;  3NVI B;  5C8Y A;  1YIJ F;  1QU9 A;  3HTN A;  4BVQ A;  5CA1 A;  1YJ9 F;  5DCV A;  1RQ7 A;  3C9U A;  3GTZ A;  5IJ0 A;  1NQ3 A;  3D01 A;  4KWE A;  5ITZ B;  1VQ8 F;  3F6M A;  2LBT A;  4F6R B;  4I50 A;  3CME F;  1X25 A;  3CMA F;  3LWP C;  2ALE A;  2OTL F;  4I4T A;  3Q8H A;  4EB6 B;  1FFX B;  3PLA C;  2RHH A;  3WGN A;  3V4D A;  2ZOD A;  3ERN A;  5B8F A;  3VYT C;  2GVI A;  4TUY B;  5FJ4 C;  3I55 F;  5JVD B;  5MN5 A;  3F0G A;  3CG6 A;  4C8G A;  5JQG A;  3JAM M;  3RYF A;  4NUT A;  5GIP C;  2HVY D;  4BVR A;  1W40 A;  4O4H A;  1OFU A;  1IPA A;  4X1I A;  4BT3 A;  1YIT F;  3ON1 A;  2VXY A;  3DC2 A;  2GLZ A;  5EIB C;  5EB1 B;  3RA6 A;  4O4H B;  3RYC B;  2IG8 A;  3N2K B;  1M1K H;  3OBW A;  4B45 A;  3P4E A;  4EI7 A;  3JAW A;  1FSZ A;  3LFO A;  2IAF A;  5J2T B;  4X1K B;  1Q81 H;  3JAS A;  2LCA A;  3B6N A;  3QTY A;  3VOA A;  4HNA B;  4LCK A;  1PF5 A;  3C8L A;  4TUY A;  3ZOP A;  4ZHW A;  3WJP A;  4BY9 D;  1Z5W A;  1T0K B;  1Q82 H;  3IMP A;  5KX5 B;  5BMV B;  1YHQ F;  3HWU A;  3VCZ A;  3KHN A;  5JVD A;  4ZHQ A;  1N8R H;  4DRX A;  1X7P A;  3RYI B;  5KX5 A;  2DT4 A;  3WJR A;  2HQS C;  2UYP A;  4R40 B;  3WGJ A;  2HRU A;  3T80 A;  3CPW F;  3CCQ F;  3HKB B;  2HS3 A;  2HX0 A;  3TD5 A;  1VQ4 F;  5C8Y B;  3IEQ A;  3N2K A;  3JAR B;  2JNB A;  5HXZ A;  3CCR F;  1FNK A;  5EZY A;  1XBI A;  4HNA A;  3GYQ A;  2KGW A;  4I55 B;  2W8B C;  2CW4 A;  3LDT A;  2IQQ A;  1XV2 A;  4C82 A;  2F9Z C;  2CZW A;  4X1I B;  5LP6 B;  4G4V A;  2VAP A;  2VAW A;  1K73 H;  4U3J A;  5LYJ A;  1W5F A;  2PHN A;  2OHW A;  3WPX A;  5LXT A;  2H8C A;  5EIB D;  2FGY A;  2HS4 A;  4ZI7 A;  1IV3 A;  5LYJ B;  2HRY A;  3V7E A;  3VYU C;  3M4S A;  3CCM F;  4BT5 A;  1QVG F;  2QTP A;  1W41 A;  1CK2 A;  3L7Q A;  1XRG A;  2DYY A;  2CWJ A;  4G4Z A;  3S02 A;  3NK7 A;  5JH7 B;  3S0Y A;  2YXZ A;  1RA4 A;  4O2A A;  3IR9 A;  3FPI A;  4TV9 A;  1NJI H;  1SA0 A;  2KTV A;  3J80 M;  4WBN A;  3CB2 A;  4EB6 A;  3UT5 B;  5LOV B;  3RYI A;  4TV8 A;  4BW0 B;  1Q86 H;  2MQE A;  1CN7 A;  1YQN A;  3JAK A;  5HWE A;  3JAT A;  1TUB B;  3O85 A;  5HP7 A;  3E1Y A;  5FNV A;  5LP6 A;  2Z1E A;  3HKE B;  3NMU C;  2RHO A;  2Q1X A;  4X3M A;  5CA1 B;  3RYF B;  1U43 A;  3K2X A;  1UFY A;  3V3T A;  5JCO C;  2LBX A;  3V7Q A;  3WGM A;  1W42 A;  3IEW A;  5EZY B;  3ZP4 A;  3I56 F;  3N2G B;  3CD6 F;  3HKB A;  3S06 A;  1GZ0 A;  5IT9 M;  1QD9 A;  3JCM M;  3MDO A;  3CC7 F;  1W57 A;  1IV1 A;  4I50 B;  1U3L A;  3RE3 A;  3HJW C;  2VAM A;  2YYE A;  3QUW A;  3WPW A;  2I6R A;  3E22 B;  4O4L B;  4DRX B;  4EI8 A;  4ZHQ B;  2ZVZ A;  2QEX F;  3JAS B;  4ERH A;  3LWQ C;  2L26 A;  4X1K A;  1K8A H;  5LOV A;  4BVS A;  5HP8 A;  3IKE A;  1U40 A;  3K14 A;  2HP0 B;  1SA0 B;  2ZAU A;  5HY2 A;  3CCU F;  3LWR C;  2Z1T A;  4TZZ A;  1YJN F;  4ZHV A;  4M8I A;  2H8E A;  2OZB A;  3S0H A;  3C9T A;  4BT4 A;  1W3E X;  3VMF B;  3VIU A;  4BVT A;  4DXD A;  2EWC A;  3HAX D;  3JAL B;  1IV4 A;  1SZQ A;  5JCO A;  5JQG B;  5LXT B;  1T0A A;  5IJ9 B;  4X1Y B;  5GON B;  5CB4 B;  3P10 A;  3CC4 F;  2P6Y A;  3JVH A;  4E6E A;  2QI2 A;  1W2B F;  1J7H A;  5IJ0 B;  3IKF A;  1CLI A;  5MN4 A;  3F0F A;  1VQV A;  3WGK A;  1U3P A;  1XHO A;  1QVF F;  3FFM A;  5EWR A;  1YI2 F;  5HY0 A;  1Q8R A;  2Z1F A;  3N2G A;  1VQO F;  4RQO A;  2NMU A;  1Z5V A;  2FC3 A;  4G88 A;  3S03 A;  1KD1 H;  4X20 B;  5GIO C;  4ZHY B;  5ITZ A;  1VK3 A;  3RA5 A;  5HXU A;  4IIJ B;  5BMV A;  3ESJ A;  1ZWZ A;  3NK6 A;  4I4T B;  3E20 B;  5GIN C;  5CA0 B;  3UT5 A;  3OBY A;  4LNU A;  4RHA A;  2H6L A;  1VQN F;  3K12 A;  3FD5 A;  4ZK7 A;  1KQS F;  3QHD A;  3M84 A;  3ZP7 A;  5EYP A;  5IYZ B;  1RLG A;  2BO1 A;  1X7O A;  3VOB A;  1JFF B;  4O4I B;  5GAP K;  3LYB A;  2AMT A;  5J2U B;  4YJ3 A;  3VTI C;  4IHJ B;  3G4S F;  4FFB A;  1YGY A;  3VO8 A;  2HS0 A;  3TD3 A;  1RLU A;  1KC8 H;  1VQ7 F;  2Q1Y A;  3N4Y A;  2RHL A;  2BTO A;  1GX1 A;  5EYP B;  3TD4 A;  3R0P A;  5IYZ A;  1KNJ A;  2UYN B;  2OTM A;  1JN1 A;  1Q7Y H;  1QAH A;  3VYS C;  1W5E A;  4ZI7 B;  5J2U A;  1K9M H;  1GO0 A;  1VQM F;  4X3L A;  3C9S A;  3LME A;  4ZOL A;  5AVM A;  4YJ2 A;  3WGL A;  2RHJ A;  4IIJ A;  1RQ2 A;  3N4Z A;  2HP3 A;  5LP6 C;  3S0W A;  2QA4 F;  3E22 A;  3HKC B;  2RB9 A;  3MCA B;  1FFX A;  4C4W C;  2ZF8 A;  3G6E F;  1W58 1;  3EOR A;  2B33 A;  4LNU B;  5G4U C;  4F6R A;  1DBF A;  4PWT A;  2WAL A;  3VI6 A;  2OTJ F;  5A2Q M;  3PAF A;  3WXM B;  5CB4 A;  1VQ9 F;  1VQK F;  2I6D A;  3CYP B;  4O2B A;  3CC2 F;  3HKD B;  2LBW A;  3WJQ A;  3G71 F;  1ODE A;  5KMG A;  1VQ6 F;  4C81 A;  3ZO8 A;  3KE1 A;  1OAP A;  2ZOV A;  5FNV B;  3F0D A;  3U0O A;  1VQL F;  1H48 A;  1DT9 A;  2CHS A;  4O4J A;  3KIZ A;  1W59 A;  4YJ2 B;  2UYJ A;  3MQW A;  1H7M A;  4O2B B;  3JAW B;  3CCV F;  1UI9 A;  3K0T A;  2KTU A;  2UYN A;  3SIV A;  2KG4 A;  1VHA A;  4X1Y A;  5GON A;  3SIU A;  3GHZ A;  2CHT A;  1ONI A;  1H47 A;  3BYQ A;  4C8E A;  3RYC A;  3FBA A;  1GO1 A;  3AGK A;  2R75 1;  4O4J B;  2AIZ P;  3CXC F;  1KNK A;  4B46 A;  5HY4 A;  3RYH B;  3LWO C;  3DDN A;  2CVL A;  3FD6 A;  4IHJ A;  3HKD A;  5CA0 A;  4G4X A;  1W5A A;  1JFF A;  4G4W A;  4O4I A;  1R1M A;  2VGM A;  3I7T A;  1TUB A;  3JAT B;  5G4V C;  3CYQ A;  2ZVY A;  4X20 A;  2Z1U A;  3P0Z A;  5KMG B;  3J81 M;  3JAR A;  2PMP A;  5IJ9 A;  1E7K A;  1NMU B;  4TV8 B;  3CCJ F;  3D00 A; 
#chains in the Genus database with same CATH homology
 2GLZ A;  3RA6 A;  3V3T A;  2LBX A;  3J7A R;  1Q7Y H;  1M1K H;  3OBW A;  3V7Q A;  1W42 A;  3I56 F;  3CCE F;  3NVK E;  4XCQ A;  4EI7 A;  1K9M H;  1GO0 A;  1VQM F;  4X3L A;  3CD6 F;  3LFO A;  1GZ0 A;  5IT9 M;  1Q81 H;  3JCM M;  3CC7 F;  1VQP F;  4LCK A;  1X52 A;  3N4Z A;  3CPQ A;  3HJW C;  2QA4 F;  5FLX M;  4EI8 A;  4BY9 D;  3MCA B;  4C4W C;  2QEX F;  3G6E F;  3LWQ C;  1K8A H;  1T0K B;  4BVS A;  1Q82 H;  5G4U C;  1YHQ F;  2AIF A;  1N8R H;  5HY2 A;  3LWV C;  2WAL A;  1X7P A;  5EO3 A;  3VI6 A;  3CCU F;  2OTJ F;  5A2Q M;  3PAF A;  3WXM B;  1VQ9 F;  1VQK F;  2I6D A;  3CC2 F;  3LWR C;  4TZZ A;  3CPW F;  3CCQ F;  1YJW F;  2LBW A;  3G71 F;  1VQ4 F;  1YJN F;  1VQ6 F;  2JNB A;  5HXZ A;  3CCR F;  1XBI A;  2OZB A;  3GYQ A;  1VQL F;  4BVT A;  3VMF B;  1W3E X;  2VGN A;  5HY1 A;  1VQ5 F;  4EI9 A;  3HAX D;  1DT9 A;  1JJ2 F;  2F9Z C;  3CCS F;  4NQ3 A;  2CZW A;  1S72 F;  3CC4 F;  1H7M A;  3OW2 F;  3CCL F;  3CCV F;  1K73 H;  2QI2 A;  1W2B F;  1PXW A;  1M90 H;  2KTU A;  5GAN K;  1SDS A;  3NVI B;  2OHW A;  3SIV A;  2KG4 A;  1YIJ F;  1QVF F;  3SIU A;  4BVQ A;  3FFM A;  2FGY A;  5EWR A;  5HY0 A;  1VQO F;  1YJ9 F;  1YI2 F;  5DCV A;  2FC3 A;  1KD1 H;  3V7E A;  5GIO C;  1VQ8 F;  1GO1 A;  3RA5 A;  5HXU A;  3CCM F;  1QVG F;  3AGK A;  3CME F;  3CMA F;  1ZWZ A;  1W41 A;  3NK6 A;  3LWP C;  1CK2 A;  3E20 B;  2ALE A;  5GIN C;  2OTL F;  3CXC F;  3OBY A;  3PLA C;  3NK7 A;  5HY4 A;  1RA4 A;  1VQN F;  3LWO C;  3IR9 A;  1NJI H;  5FJ4 C;  3I55 F;  2KTV A;  1KQS F;  3J80 M;  1RLG A;  2BO1 A;  3CG6 A;  1X7O A;  5GAP K;  3JAM M;  4BW0 B;  1Q86 H;  2VGM A;  4NUT A;  5GIP C;  2HVY D;  1CN7 A;  4BVR A;  5HWE A;  3G4S F;  5G4V C;  1W40 A;  3O85 A;  3E1Y A;  3J81 M;  1KC8 H;  1E7K A;  1IPA A;  1NMU B;  1YIT F;  1VQ7 F;  3ON1 A;  3NMU C;  4X3M A;  3CCJ F;  3D00 A;  3N4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...