1VQ4F

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq4F00
3NK6A 3OW2F 2WALA 1YITF 2ALEA 1VQKF 3NVIB 3CC7F 1Q81H 1JJ2F 3CCMF 1VQLF 3CG6A 1VQMF 3AGKA 2LBXA 4LCKA 1Q82H 3LWRC 3J80M 1RLGA 1IPAA 1XBIA 3N4YA 3CCVF 3V7QA 5EWRA 3J81M 5GINC 1KC8H 1PXWA 3CMEF 1X7OA 2LBWA 5FJ4C 5GAPK 3CCSF 2QA4F 2OTJF 3LWPC 1RA4A 1YIJF 3VI6A 3PLAC 3CXCF 5G4VC 3HAXD 3N4ZA 5A2QM 3JCMM 1M1KH 1S72F 3IR9A 3CCJF 2OHWA 3LWQC 1VQNF 4X3MA 4BY9D 3WXMB 2BO1A 5EO3A 1Q7YH 1W40A 3JAMM 3CCLF 3CCUF 4TZZA 3OBYA 1YJWF 3LWOC 1K73H 3CCQF 1W42A 2VGNA 3G6EF 1VQ4F 2I6DA 1CK2A 1GO1A 3LWVC 1VQ7F 1YI2F 1W2BF 4BW0B 3LFOA 3G4SF 1KD1H 3CCRF 5GIPC 3NVKE 1M90H 2QEXF 2KTVA 3NMUC 4NUTA 3RA6A 3E20B 1NJIH 1GZ0A 3VMFB 1K8AH 3CC2F 1VQ6F 5FLXM 2JNBA 2HVYD 1CN7A 2QI2A 3MCAB 3FFMA 1SDSA 2OTLF 5IT9M 1Q86H 3HJWC 1DT9A 4C4WC 2FC3A 3G71F 1GO0A 1N8RH 3GYQA 2VGMA 3E1YA 1T0KB 3V7EA 1K9MH 3SIVA 3CPWF 1NMUB 1W3EX 3CPQA 1H7MA 3RA5A 4X3LA 3NK7A 1W41A 3O85A 3OBWA 1VQ9F 2KTUA 5GANK 3PAFA 3CC4F 1YHQF 2KG4A 3CD6F 2OZBA 3I55F 1YJNF 1X52A 3I56F 1VQPF 1QVGF 1VQ8F 3SIUA 3ON1A 1KQSF 1VQ5F 5DCVA 5GIOC 3J7AR 1YJ9F 1VQOF 1ZWZA 2AIFA 3CMAF 5G4UC 1E7KA 2CZWA 1X7PA 1QVFF 3CCEF
chains in the Genus database with same CATH superfamily
4IIJB 2VXYA 5LP6B 2WALA 5CB4B 3IKFA 1PF5A 3MCQA 4TV9A 1Q81H 4RHAA 5JQGB 1JJ2F 4YJ3A 3WJRA 5B8FA 1VQLF 2VAPA 3AGKA 1CLIA 1GX1A 2LBXA 3KIZA 1Q82H 2BTOA 2GZLA 5EYPA 3FBAA 3TD5A 1FNJA 3J80M 1IPAA 4O2BB 3HKCB 2UZHA 3WGNA 4BT7A 5FNVB 1ODEA 4C8IA 3T80A 5GAPK 4G4XA 3CCSF 2QA4F 5HY0A 3JASB 5IJ9A 5HWEA 3JCMM 4I50A 5ITZA 3LWQC 5EIBC 4BY9D 3WXMB 3RE3A 2BO1A 1Q7YH 3N2KA 3HKEB 2IQQA 3CCUF 4TZZA 3DC2A 3OBYA 2ZF8A 5J2TB 3LWOC 2VGNA 4X1IA 3G6EF 1GO1A 3GTZA 3C8LA 2PHNA 4RQOA 3LFOA 1KD1H 4C8GA 2P6YA 5GIPC 4BVSA 1M90H 4ZHVA 1W55A 3WPWA 3E20B 3VMFB 1IV1A 3IMPA 1CN7A 3RYHB 5EIBD 3LYBA 3L7QA 5HXZA 2OTLF 4O2AB 1DBFA 2UYNB 4R40B 2H8CA 3GYQA 3P0ZA 1U43A 3JATB 5LP6C 2G9IA 1W3EX 5LP6A 2ZVYA 1H7MA 3RA5A 3WGMA 2NMUA 3WGLA 5CB4A 1IV2A 2MQEA 3ZP4A 1W41A 5JQGA 5HP7A 5MN6A 5GANK 3CC4F 3VTIC 2KG4A 3CD6F 4G4VA 3ESJA 1TUBB 3D00A 3HKDB 5EZYA 4BT2A 3E22B 3WGKA 2ZODA 1TVKB 3I7TA 5HY1A 3I55F 4O2BA 3HKCA 3I56F 5FNVA 5CA0B 1NQ3A 5LYJA 3Q8HA 3JASA 1E7KA 4NWOB 1U3LA 1QVFF 3CCEF 4O4IB 4U39A 2ALEA 3KHNA 5BMVB 3CCMF 1VK3A 2DT4A 3HKEA 4EI7A 1VQMF 1JY8A 5J2TA 3LWRC 4HNAB 4ZOLB 4O4JB 3V3TA 1FFXB 3CCVF 4O4LB 1U3PA 3V7QA 1KC8H 3CMEF 2RB9A 4B62A 1W59A 4C81A 3LWPC 3VI6A 3U0OA 3CXCF 3FPIA 5G4VC 2CSLA 3HAXD 3N4ZA 5A2QM 5HY4A 4U3JA 2HP3A 5C8YA 3IR9A 4X3MA 5JCOC 3RYHA 5J2UB 1QU9A 3QHDA 5JCOA 3K0TA 4EB6A 4WBNA 4O2AA 5EZYB 2UYNA 1JFFB 1YJWF 2F9ZC 2CVLA 3CCQF 3JATA 2AMTA 4BT6A 4ERHA 1CK2A 1VQVA 5MN4A 2GVIA 1VQ7F 1W2BF 1YGYA 3C9SA 3D01A 5LYJB 2Z01A 3CB2A 3CYPB 3QUWA 3EORA 1KNJA 2N48A 3S03A 3C9TA 3RA6A 3HKDA 1TUBA 1GZ0A 2K1SA 3E22A 1TVKA 2JNBA 2HP0B 3MCAB 1Q8RA 3FFMA 3K2XA 5CA0A 2B33A 5IT9M 1DT9A 4C4WC 3WJQA 4LNUB 3V7EA 1K9MH 3SIVA 3VO8A 4O4IA 1NMUB 3CPQA 1SZQA 4ZHWA 1OAPA 4I4TB 4B46A 5BMVA 3TD4A 3OBWA 4X1KA 2HX0A 3LDTA 2ZOVA 3PAFA 4U3JB 5JVDB 4HNAA 3VIUA 5C8YB 2RHHA 5AVMA 4ZOLA 4O4HA 4O4JA 1FFXA 5HP8A 3TD3A 2UYKA 3N2GB 4O4LA 4C82A 1VQPF 3SIUA 3MDOA 3IEWA 2IG8A 3GHZA 4EB6B 5DCVA 2Q1XA 4WBNB 4DRXA 4DXDA 1W5AA 5GIOC 5LA6B 1RQ7A 1VQOF 2AIFA 5KMGA 1VHAA 3S06A 3RYIA 2CHSA 2Z1EA 1YITF 2CWJA 1FSZA 3M1XA 3OONA 5J2UA 3ERNA 2V9YA 3S0WA 3JALB 3CG6A 1R1MA 1JFFA 3BYQA 2YXZA 3S0HA 1RLGA 1OFUA 1XBIA 3F0FA 1X25A 3HKBB 3N4YA 5EWRA 3J81M 5GINC 1PXWA 3C9RA 1W5EA 1X7OA 2R6R1 3F0EA 2LBTA 2LBWA 3CYQA 2OTMA 3MBMA 4BT3A 1M1KH 4IHJB 5MN5A 2RHLA 2OHWA 3CCJF 3RYCB 3C9UA 2HP0A 3JAKB 4X1KB 3HTNA 1W40A 3CCLF 2VAMA 2Z1UA 5CA1B 4LNUA 5LXTB 4M8IA 5HY2A 4O4HB 3WJPA 3FD6A 2I6DA 3JAWB 3LWVC 3DDNA 4TUYA 4I4TA 3VCZA 4DRXB 4BW0B 4BT4A 4C8EA 2IAFA 2RHOA 5KMGB 2QEXF 2KTVA 3IKEA 3NMUC 3R0PA 3RYIB 2CHTA 4I55B 5JVDA 1T0AA 1UFYA 1K8AH 3CC2F 1VQ6F 3V4DA 5FLXM 2HVYD 3IEQA 2QI2A 3N2GA 2HS3A 4ZHQB 5HXUA 1SDSA 3F0DA 4F6RB 2CW4A 1Q86H 3RYFB 2QTPA 2RHJA 5JH7B 5LA6A 1GO0A 5EB0A 1N8RH 2VGMA 1H47A 3E1YA 4X1YA 1T0KB 3CPWF 1W581 4X3LA 3NK7A 5IYZB 4XCQA 4BVTA 3D54A 1U40A 3O85A 3JALA 4G88A 1VQ9F 3I3FA 4G4ZA 1QD9A 2UYJA 1YHQF 1Z5WA 5GONB 5IJ0A 3HWUA 4TV8B 2PMPA 4YJ2B 1VH8A 4ZI7B 1YJNF 2UYPA 3HKBA 1RLUA 1QVGF 3ON1A 1KQSF 3K12A 2W8BC 3P4EA 3VYTC 5LOVB 1ZWZA 1W57A 1SA0B 1FNKA 5KX5B 3NK6A 2HS4A 4TUYB 3S0YA 3OW2F 4FFBB 4IHJA 1VQKF 3UT5B 3NVIB 3CC7F 3RYCA 3JAKA 4X20B 5CA1A 3LMEA 4LCKA 5LXTA 2L26A 2YYEA 2HS0A 3JAWA 3JARB 1J7HA 4B45A 4BVRA 1XRGA 4BT5A 4NQ3A 5FJ4C 2OTJF 4X1YB 1RA4A 2FGYA 1ONIA 3MQWA 1YIJF 2HRYA 3PLAC 3VOAA 2VAWA 4I55A 1S72F 2LCAA 3ELCA 2R751 1VQNF 4G4YA 1JN1A 4ZK7A 1UI9A 2ZVZA 4TV9B 4ZHQA 5EO3A 4YJ3B 4F6RA 3JAMM 3RYFA 5IJ0B 5JH7A 1IV3A 1KNKA 4KWEA 2HQSC 3WGJA 1K73H 1IV4A 1Z5VA 1W42A 5EYPB 5EAZA 3ZP7A 1VQ4F 3P10A 1RQ2A 4IIJA 3WPXA 3ZOPA 1W5FA 2GLZA 1YI2F 2HRUA 3G4SF 5IYZA 3CCRF 3KJKA 3NVKE 2Z1TA 1XHOA 3VYSC 5IJ9B 4NUTA 5GONA 1JD1A 1NJIH 4TV8A 4I50B 4YJ2A 4ZHYB 4G4WA 3KE1A 4EI9A 4ZI7A 5ITZB 3JVHA 3M4SA 3K14A 2DYYA 3N2KB 1W5BA 3HJWC 3FD5A 4EI8A 1YQNA 2FC3A 3G71F 2H6LA 5LOVA 3QTYA 4PWTA 1SA0A 3F6MA 3KJJA 4X1IB 2H8EA 5KX5A 3S02A 1XV2A 2ZAUA 3F0GA 4FFBA 1H48A 1COMA 2BTUA 3UT5A 2Z1FA 4B5CA 3B6NA 5EB1B 4X20A 4E6EA 2KTUA 3M84A 2Q1YA 1QAHA 4BVQA 2OZBA 1X52A 3JARA 3VOBA 1VQ8F 1VQ5F 2EWCA 3J7AR 1YJ9F 3VYUC 3ZO8A 5G4UC 2I6RA 3CMAF 2AIZP 2KGWA 2BTQB 1X7PA 2CZWA
chains in the Genus database with same CATH topology
3NK6A 3OW2F 2WALA 1YITF 2ALEA 1VQKF 3NVIB 3CC7F 1Q81H 1JJ2F 3CCMF 1VQLF 3CG6A 4EI7A 1VQMF 3AGKA 2LBXA 4LCKA 1Q82H 3LWRC 3J80M 1RLGA 3V3TA 1IPAA 1XBIA 3N4YA 3CCVF 3V7QA 5EWRA 3J81M 5GINC 1KC8H 1PXWA 3CMEF 4BVRA 1X7OA 2LBWA 4NQ3A 5FJ4C 5GAPK 3CCSF 2QA4F 2OTJF 3LWPC 5HY0A 2FGYA 1RA4A 1YIJF 3VI6A 3PLAC 3CXCF 5G4VC 5HWEA 3HAXD 3N4ZA 5A2QM 3JCMM 5HY4A 1M1KH 1S72F 3IR9A 3CCJF 2OHWA 3LWQC 1VQNF 4X3MA 4BY9D 3WXMB 2BO1A 5EO3A 1Q7YH 1W40A 3JAMM 3CCLF 3CCUF 4TZZA 3OBYA 1YJWF 2F9ZC 3LWOC 5HY2A 1K73H 3CCQF 1W42A 2VGNA 3G6EF 1VQ4F 2I6DA 1CK2A 1GO1A 3LWVC 2GLZA 1VQ7F 1YI2F 1W2BF 4BW0B 3LFOA 3G4SF 1KD1H 3CCRF 5GIPC 3NVKE 4BVSA 1M90H 2QEXF 2KTVA 3NMUC 4NUTA 3RA6A 3E20B 1NJIH 1GZ0A 3VMFB 1K8AH 3CC2F 1VQ6F 4EI9A 5FLXM 2JNBA 2HVYD 1CN7A 2QI2A 3MCAB 3FFMA 5HXUA 1SDSA 5HXZA 2OTLF 5IT9M 1Q86H 3HJWC 1DT9A 4C4WC 4EI8A 2FC3A 3G71F 1GO0A 1N8RH 3GYQA 2VGMA 3E1YA 1T0KB 3V7EA 1K9MH 3SIVA 3CPWF 1NMUB 1W3EX 3CPQA 1H7MA 3RA5A 4X3LA 3NK7A 1W41A 4XCQA 4BVTA 3O85A 3OBWA 1VQ9F 2KTUA 5GANK 3PAFA 3CC4F 1YHQF 2KG4A 3CD6F 3D00A 4BVQA 2OZBA 5HY1A 3I55F 1YJNF 1X52A 3I56F 1VQPF 1QVGF 1VQ8F 3SIUA 3ON1A 1KQSF 1VQ5F 5DCVA 5GIOC 3J7AR 1YJ9F 1VQOF 1ZWZA 2AIFA 3CMAF 5G4UC 1E7KA 2CZWA 1X7PA 1QVFF 3CCEF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK6 A;  3OW2 F;  2WAL A;  1YIT F;  2ALE A;  1VQK F;  3NVI B;  3CC7 F;  1Q81 H;  1JJ2 F;  3CCM F;  1VQL F;  3CG6 A;  1VQM F;  3AGK A;  2LBX A;  4LCK A;  1Q82 H;  3LWR C;  3J80 M;  1RLG A;  1IPA A;  1XBI A;  3N4Y A;  3CCV F;  3V7Q A;  5EWR A;  3J81 M;  5GIN C;  1KC8 H;  1PXW A;  3CME F;  1X7O A;  2LBW A;  5FJ4 C;  5GAP K;  3CCS F;  2QA4 F;  2OTJ F;  3LWP C;  1RA4 A;  1YIJ F;  3VI6 A;  3PLA C;  3CXC F;  5G4V C;  3HAX D;  3N4Z A;  5A2Q M;  3JCM M;  1M1K H;  1S72 F;  3IR9 A;  3CCJ F;  2OHW A;  3LWQ C;  1VQN F;  4X3M A;  4BY9 D;  3WXM B;  2BO1 A;  5EO3 A;  1Q7Y H;  1W40 A;  3JAM M;  3CCL F;  3CCU F;  4TZZ A;  3OBY A;  1YJW F;  3LWO C;  1K73 H;  3CCQ F;  1W42 A;  2VGN A;  3G6E F;  1VQ4 F;  2I6D A;  1CK2 A;  1GO1 A;  3LWV C;  1VQ7 F;  1YI2 F;  1W2B F;  4BW0 B;  3LFO A;  3G4S F;  1KD1 H;  3CCR F;  5GIP C;  3NVK E;  1M90 H;  2QEX F;  2KTV A;  3NMU C;  4NUT A;  3RA6 A;  3E20 B;  1NJI H;  1GZ0 A;  3VMF B;  1K8A H;  3CC2 F;  1VQ6 F;  5FLX M;  2JNB A;  2HVY D;  1CN7 A;  2QI2 A;  3MCA B;  3FFM A;  1SDS A;  2OTL F;  5IT9 M;  1Q86 H;  3HJW C;  1DT9 A;  4C4W C;  2FC3 A;  3G71 F;  1GO0 A;  1N8R H;  3GYQ A;  2VGM A;  3E1Y A;  1T0K B;  3V7E A;  1K9M H;  3SIV A;  3CPW F;  1NMU B;  1W3E X;  3CPQ A;  1H7M A;  3RA5 A;  4X3L A;  3NK7 A;  1W41 A;  3O85 A;  3OBW A;  1VQ9 F;  2KTU A;  5GAN K;  3PAF A;  3CC4 F;  1YHQ F;  2KG4 A;  3CD6 F;  2OZB A;  3I55 F;  1YJN F;  1X52 A;  3I56 F;  1VQP F;  1QVG F;  1VQ8 F;  3SIU A;  3ON1 A;  1KQS F;  1VQ5 F;  5DCV A;  5GIO C;  3J7A R;  1YJ9 F;  1VQO F;  1ZWZ A;  2AIF A;  3CMA F;  5G4U C;  1E7K A;  2CZW A;  1X7P A;  1QVF F;  3CCE F; 
#chains in the Genus database with same CATH topology
 4IIJ B;  2VXY A;  5LP6 B;  2WAL A;  5CB4 B;  3IKF A;  1PF5 A;  3MCQ A;  4TV9 A;  1Q81 H;  4RHA A;  5JQG B;  1JJ2 F;  4YJ3 A;  3WJR A;  5B8F A;  1VQL F;  2VAP A;  3AGK A;  1CLI A;  1GX1 A;  2LBX A;  3KIZ A;  1Q82 H;  2BTO A;  2GZL A;  5EYP A;  3FBA A;  3TD5 A;  1FNJ A;  3J80 M;  1IPA A;  4O2B B;  3HKC B;  2UZH A;  3WGN A;  4BT7 A;  5FNV B;  1ODE A;  4C8I A;  3T80 A;  5GAP K;  4G4X A;  3CCS F;  2QA4 F;  5HY0 A;  3JAS B;  5IJ9 A;  5HWE A;  3JCM M;  4I50 A;  5ITZ A;  3LWQ C;  5EIB C;  4BY9 D;  3WXM B;  3RE3 A;  2BO1 A;  1Q7Y H;  3N2K A;  3HKE B;  2IQQ A;  3CCU F;  4TZZ A;  3DC2 A;  3OBY A;  2ZF8 A;  5J2T B;  3LWO C;  2VGN A;  4X1I A;  3G6E F;  1GO1 A;  3GTZ A;  3C8L A;  2PHN A;  4RQO A;  3LFO A;  1KD1 H;  4C8G A;  2P6Y A;  5GIP C;  4BVS A;  1M90 H;  4ZHV A;  1W55 A;  3WPW A;  3E20 B;  3VMF B;  1IV1 A;  3IMP A;  1CN7 A;  3RYH B;  5EIB D;  3LYB A;  3L7Q A;  5HXZ A;  2OTL F;  4O2A B;  1DBF A;  2UYN B;  4R40 B;  2H8C A;  3GYQ A;  3P0Z A;  1U43 A;  3JAT B;  5LP6 C;  2G9I A;  1W3E X;  5LP6 A;  2ZVY A;  1H7M A;  3RA5 A;  3WGM A;  2NMU A;  3WGL A;  5CB4 A;  1IV2 A;  2MQE A;  3ZP4 A;  1W41 A;  5JQG A;  5HP7 A;  5MN6 A;  5GAN K;  3CC4 F;  3VTI C;  2KG4 A;  3CD6 F;  4G4V A;  3ESJ A;  1TUB B;  3D00 A;  3HKD B;  5EZY A;  4BT2 A;  3E22 B;  3WGK A;  2ZOD A;  1TVK B;  3I7T A;  5HY1 A;  3I55 F;  4O2B A;  3HKC A;  3I56 F;  5FNV A;  5CA0 B;  1NQ3 A;  5LYJ A;  3Q8H A;  3JAS A;  1E7K A;  4NWO B;  1U3L A;  1QVF F;  3CCE F;  4O4I B;  4U39 A;  2ALE A;  3KHN A;  5BMV B;  3CCM F;  1VK3 A;  2DT4 A;  3HKE A;  4EI7 A;  1VQM F;  1JY8 A;  5J2T A;  3LWR C;  4HNA B;  4ZOL B;  4O4J B;  3V3T A;  1FFX B;  3CCV F;  4O4L B;  1U3P A;  3V7Q A;  1KC8 H;  3CME F;  2RB9 A;  4B62 A;  1W59 A;  4C81 A;  3LWP C;  3VI6 A;  3U0O A;  3CXC F;  3FPI A;  5G4V C;  2CSL A;  3HAX D;  3N4Z A;  5A2Q M;  5HY4 A;  4U3J A;  2HP3 A;  5C8Y A;  3IR9 A;  4X3M A;  5JCO C;  3RYH A;  5J2U B;  1QU9 A;  3QHD A;  5JCO A;  3K0T A;  4EB6 A;  4WBN A;  4O2A A;  5EZY B;  2UYN A;  1JFF B;  1YJW F;  2F9Z C;  2CVL A;  3CCQ F;  3JAT A;  2AMT A;  4BT6 A;  4ERH A;  1CK2 A;  1VQV A;  5MN4 A;  2GVI A;  1VQ7 F;  1W2B F;  1YGY A;  3C9S A;  3D01 A;  5LYJ B;  2Z01 A;  3CB2 A;  3CYP B;  3QUW A;  3EOR A;  1KNJ A;  2N48 A;  3S03 A;  3C9T A;  3RA6 A;  3HKD A;  1TUB A;  1GZ0 A;  2K1S A;  3E22 A;  1TVK A;  2JNB A;  2HP0 B;  3MCA B;  1Q8R A;  3FFM A;  3K2X A;  5CA0 A;  2B33 A;  5IT9 M;  1DT9 A;  4C4W C;  3WJQ A;  4LNU B;  3V7E A;  1K9M H;  3SIV A;  3VO8 A;  4O4I A;  1NMU B;  3CPQ A;  1SZQ A;  4ZHW A;  1OAP A;  4I4T B;  4B46 A;  5BMV A;  3TD4 A;  3OBW A;  4X1K A;  2HX0 A;  3LDT A;  2ZOV A;  3PAF A;  4U3J B;  5JVD B;  4HNA A;  3VIU A;  5C8Y B;  2RHH A;  5AVM A;  4ZOL A;  4O4H A;  4O4J A;  1FFX A;  5HP8 A;  3TD3 A;  2UYK A;  3N2G B;  4O4L A;  4C82 A;  1VQP F;  3SIU A;  3MDO A;  3IEW A;  2IG8 A;  3GHZ A;  4EB6 B;  5DCV A;  2Q1X A;  4WBN B;  4DRX A;  4DXD A;  1W5A A;  5GIO C;  5LA6 B;  1RQ7 A;  1VQO F;  2AIF A;  5KMG A;  1VHA A;  3S06 A;  3RYI A;  2CHS A;  2Z1E A;  1YIT F;  2CWJ A;  1FSZ A;  3M1X A;  3OON A;  5J2U A;  3ERN A;  2V9Y A;  3S0W A;  3JAL B;  3CG6 A;  1R1M A;  1JFF A;  3BYQ A;  2YXZ A;  3S0H A;  1RLG A;  1OFU A;  1XBI A;  3F0F A;  1X25 A;  3HKB B;  3N4Y A;  5EWR A;  3J81 M;  5GIN C;  1PXW A;  3C9R A;  1W5E A;  1X7O A;  2R6R 1;  3F0E A;  2LBT A;  2LBW A;  3CYQ A;  2OTM A;  3MBM A;  4BT3 A;  1M1K H;  4IHJ B;  5MN5 A;  2RHL A;  2OHW A;  3CCJ F;  3RYC B;  3C9U A;  2HP0 A;  3JAK B;  4X1K B;  3HTN A;  1W40 A;  3CCL F;  2VAM A;  2Z1U A;  5CA1 B;  4LNU A;  5LXT B;  4M8I A;  5HY2 A;  4O4H B;  3WJP A;  3FD6 A;  2I6D A;  3JAW B;  3LWV C;  3DDN A;  4TUY A;  4I4T A;  3VCZ A;  4DRX B;  4BW0 B;  4BT4 A;  4C8E A;  2IAF A;  2RHO A;  5KMG B;  2QEX F;  2KTV A;  3IKE A;  3NMU C;  3R0P A;  3RYI B;  2CHT A;  4I55 B;  5JVD A;  1T0A A;  1UFY A;  1K8A H;  3CC2 F;  1VQ6 F;  3V4D A;  5FLX M;  2HVY D;  3IEQ A;  2QI2 A;  3N2G A;  2HS3 A;  4ZHQ B;  5HXU A;  1SDS A;  3F0D A;  4F6R B;  2CW4 A;  1Q86 H;  3RYF B;  2QTP A;  2RHJ A;  5JH7 B;  5LA6 A;  1GO0 A;  5EB0 A;  1N8R H;  2VGM A;  1H47 A;  3E1Y A;  4X1Y A;  1T0K B;  3CPW F;  1W58 1;  4X3L A;  3NK7 A;  5IYZ B;  4XCQ A;  4BVT A;  3D54 A;  1U40 A;  3O85 A;  3JAL A;  4G88 A;  1VQ9 F;  3I3F A;  4G4Z A;  1QD9 A;  2UYJ A;  1YHQ F;  1Z5W A;  5GON B;  5IJ0 A;  3HWU A;  4TV8 B;  2PMP A;  4YJ2 B;  1VH8 A;  4ZI7 B;  1YJN F;  2UYP A;  3HKB A;  1RLU A;  1QVG F;  3ON1 A;  1KQS F;  3K12 A;  2W8B C;  3P4E A;  3VYT C;  5LOV B;  1ZWZ A;  1W57 A;  1SA0 B;  1FNK A;  5KX5 B;  3NK6 A;  2HS4 A;  4TUY B;  3S0Y A;  3OW2 F;  4FFB B;  4IHJ A;  1VQK F;  3UT5 B;  3NVI B;  3CC7 F;  3RYC A;  3JAK A;  4X20 B;  5CA1 A;  3LME A;  4LCK A;  5LXT A;  2L26 A;  2YYE A;  2HS0 A;  3JAW A;  3JAR B;  1J7H A;  4B45 A;  4BVR A;  1XRG A;  4BT5 A;  4NQ3 A;  5FJ4 C;  2OTJ F;  4X1Y B;  1RA4 A;  2FGY A;  1ONI A;  3MQW A;  1YIJ F;  2HRY A;  3PLA C;  3VOA A;  2VAW A;  4I55 A;  1S72 F;  2LCA A;  3ELC A;  2R75 1;  1VQN F;  4G4Y A;  1JN1 A;  4ZK7 A;  1UI9 A;  2ZVZ A;  4TV9 B;  4ZHQ A;  5EO3 A;  4YJ3 B;  4F6R A;  3JAM M;  3RYF A;  5IJ0 B;  5JH7 A;  1IV3 A;  1KNK A;  4KWE A;  2HQS C;  3WGJ A;  1K73 H;  1IV4 A;  1Z5V A;  1W42 A;  5EYP B;  5EAZ A;  3ZP7 A;  1VQ4 F;  3P10 A;  1RQ2 A;  4IIJ A;  3WPX A;  3ZOP A;  1W5F A;  2GLZ A;  1YI2 F;  2HRU A;  3G4S F;  5IYZ A;  3CCR F;  3KJK A;  3NVK E;  2Z1T A;  1XHO A;  3VYS C;  5IJ9 B;  4NUT A;  5GON A;  1JD1 A;  1NJI H;  4TV8 A;  4I50 B;  4YJ2 A;  4ZHY B;  4G4W A;  3KE1 A;  4EI9 A;  4ZI7 A;  5ITZ B;  3JVH A;  3M4S A;  3K14 A;  2DYY A;  3N2K B;  1W5B A;  3HJW C;  3FD5 A;  4EI8 A;  1YQN A;  2FC3 A;  3G71 F;  2H6L A;  5LOV A;  3QTY A;  4PWT A;  1SA0 A;  3F6M A;  3KJJ A;  4X1I B;  2H8E A;  5KX5 A;  3S02 A;  1XV2 A;  2ZAU A;  3F0G A;  4FFB A;  1H48 A;  1COM A;  2BTU A;  3UT5 A;  2Z1F A;  4B5C A;  3B6N A;  5EB1 B;  4X20 A;  4E6E A;  2KTU A;  3M84 A;  2Q1Y A;  1QAH A;  4BVQ A;  2OZB A;  1X52 A;  3JAR A;  3VOB A;  1VQ8 F;  1VQ5 F;  2EWC A;  3J7A R;  1YJ9 F;  3VYU C;  3ZO8 A;  5G4U C;  2I6R A;  3CMA F;  2AIZ P;  2KGW A;  2BTQ B;  1X7P A;  2CZW A; 
#chains in the Genus database with same CATH homology
 3NK6 A;  3OW2 F;  2WAL A;  1YIT F;  2ALE A;  1VQK F;  3NVI B;  3CC7 F;  1Q81 H;  1JJ2 F;  3CCM F;  1VQL F;  3CG6 A;  4EI7 A;  1VQM F;  3AGK A;  2LBX A;  4LCK A;  1Q82 H;  3LWR C;  3J80 M;  1RLG A;  3V3T A;  1IPA A;  1XBI A;  3N4Y A;  3CCV F;  3V7Q A;  5EWR A;  3J81 M;  5GIN C;  1KC8 H;  1PXW A;  3CME F;  4BVR A;  1X7O A;  2LBW A;  4NQ3 A;  5FJ4 C;  5GAP K;  3CCS F;  2QA4 F;  2OTJ F;  3LWP C;  5HY0 A;  2FGY A;  1RA4 A;  1YIJ F;  3VI6 A;  3PLA C;  3CXC F;  5G4V C;  5HWE A;  3HAX D;  3N4Z A;  5A2Q M;  3JCM M;  5HY4 A;  1M1K H;  1S72 F;  3IR9 A;  3CCJ F;  2OHW A;  3LWQ C;  1VQN F;  4X3M A;  4BY9 D;  3WXM B;  2BO1 A;  5EO3 A;  1Q7Y H;  1W40 A;  3JAM M;  3CCL F;  3CCU F;  4TZZ A;  3OBY A;  1YJW F;  2F9Z C;  3LWO C;  5HY2 A;  1K73 H;  3CCQ F;  1W42 A;  2VGN A;  3G6E F;  1VQ4 F;  2I6D A;  1CK2 A;  1GO1 A;  3LWV C;  2GLZ A;  1VQ7 F;  1YI2 F;  1W2B F;  4BW0 B;  3LFO A;  3G4S F;  1KD1 H;  3CCR F;  5GIP C;  3NVK E;  4BVS A;  1M90 H;  2QEX F;  2KTV A;  3NMU C;  4NUT A;  3RA6 A;  3E20 B;  1NJI H;  1GZ0 A;  3VMF B;  1K8A H;  3CC2 F;  1VQ6 F;  4EI9 A;  5FLX M;  2JNB A;  2HVY D;  1CN7 A;  2QI2 A;  3MCA B;  3FFM A;  5HXU A;  1SDS A;  5HXZ A;  2OTL F;  5IT9 M;  1Q86 H;  3HJW C;  1DT9 A;  4C4W C;  4EI8 A;  2FC3 A;  3G71 F;  1GO0 A;  1N8R H;  3GYQ A;  2VGM A;  3E1Y A;  1T0K B;  3V7E A;  1K9M H;  3SIV A;  3CPW F;  1NMU B;  1W3E X;  3CPQ A;  1H7M A;  3RA5 A;  4X3L A;  3NK7 A;  1W41 A;  4XCQ A;  4BVT A;  3O85 A;  3OBW A;  1VQ9 F;  2KTU A;  5GAN K;  3PAF A;  3CC4 F;  1YHQ F;  2KG4 A;  3CD6 F;  3D00 A;  4BVQ A;  2OZB A;  5HY1 A;  3I55 F;  1YJN F;  1X52 A;  3I56 F;  1VQP F;  1QVG F;  1VQ8 F;  3SIU A;  3ON1 A;  1KQS F;  1VQ5 F;  5DCV A;  5GIO C;  3J7A R;  1YJ9 F;  1VQO F;  1ZWZ A;  2AIF A;  3CMA F;  5G4U C;  1E7K A;  2CZW A;  1X7P A;  1QVF F;  3CCE F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...