1Q7YH

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q7yH00
4TZZA 2QEXF 1VQLF 1W40A 3CCLF 1GO0A 3JAMM 3OBYA 3CC4F 1IPAA 2VGNA 3PAFA 3CMEF 1VQ9F 3CCEF 3CCVF 3LWOC 1VQ4F 1X7OA 2QI2A 3OW2F 1K73H 1T0KB 3NVKE 3VMFB 3MCAB 1QVGF 3NVIB 1GZ0A 1SDSA 1K9MH 1NMUB 3LWPC 2QA4F 1M1KH 3CCSF 3GYQA 2BO1A 1X7PA 3RA5A 1W41A 1VQOF 1VQPF 1Q86H 4BY9D 1CK2A 3G6EF 3CXCF 1W3EX 5A2QM 1VQ7F 1YJWF 1X52A 3V7QA 3CC2F 3SIUA 3CD6F 1RLGA 3LWVC 3OBWA 1YJNF 1Q7YH 1E7KA 1VQKF 3CCMF 3RA6A 4X3LA 3CC7F 2LBWA 1KC8H 3CCQF 1VQ8F 5IT9M 3E20B 1YIJF 3AGKA 5EO3A 1DT9A 4X3MA 3LWQC 3J7AR 2OTLF 3CG6A 3N4YA 3NK7A 5GANK 1VQNF 3G71F 3J81M 2OHWA 3NMUC 1KD1H 5G4VC 1GO1A 5GIOC 3HAXD 3N4ZA 1KQSF 3CCRF 2LBXA 3CMAF 1NJIH 3J80M 3V7EA 4C4WC 1W42A 3I55F 1YHQF 2VGMA 2AIFA 3HJWC 1RA4A 3LFOA 3I56F 5GIPC 2CZWA 5EWRA 1CN7A 2KG4A 1Q82H 3PLAC 1VQ5F 2WALA 1N8RH 1ZWZA 1Q81H 4BW0B 1QVFF 5G4UC 1VQ6F 2KTVA 3E1YA 1YJ9F 3FFMA 5FJ4C 3CPQA 2OZBA 3O85A 1M90H 1JJ2F 3G4SF 3IR9A 5FLXM 1K8AH 1PXWA 1H7MA 1VQMF 2ALEA 3NK6A 5DCVA 2JNBA 3CCUF 2OTJF 3ON1A 1W2BF 5GAPK 2FC3A 3CPWF 4NUTA 3WXMB 5GINC 3CCJF 1S72F 3LWRC 1YITF 2KTUA 3VI6A 2HVYD 3JCMM 1YI2F 4LCKA 3SIVA 2I6DA 1XBIA
chains in the Genus database with same CATH superfamily
5LP6C 4TZZA 3JALA 2QEXF 5C8YA 3CCLF 3JAMM 2UYNB 3PAFA 3WGNA 3CCEF 2L26A 4LNUB 3LWOC 3ZOPA 5EZYA 1X7OA 1X25A 3NVKE 4I50B 5JVDA 1JD1A 4EI9A 1K9MH 3M1XA 1NMUB 5MN6A 3RYHB 3GYQA 1X7PA 5LXTB 3C9SA 2ZF8A 1VQVA 3JAKB 1W41A 3JASB 3RYIB 3F0GA 1Q86H 4IHJB 3CXCF 2Z1FA 4TV8A 5KMGA 3Q8HA 3F0FA 2CVLA 1T0AA 2DT4A 2HRUA 3ESJA 1U43A 4TV9B 1Q7YH 3WGMA 4X20B 5HXZA 3RA6A 4X3LA 3UT5B 4ERHA 5JCOA 3CCQF 3HKBB 1VQ8F 3E20B 3AGKA 4XCQA 4X3MA 2HX0A 3QTYA 4ZOLB 4X1KA 5MN5A 2OTLF 2VAPA 1VK3A 5LA6A 3J81M 2OHWA 2NMUA 3NMUC 3S06A 1KD1H 1GO1A 3HAXD 4F6RB 3VCZA 4C8EA 3M84A 3N4ZA 2HP0A 5CA0A 4TUYA 1QAHA 3J80M 1XV2A 5J2UB 3ZP4A 3JAWB 4X1YA 2I6RA 1UI9A 4C81A 2YYEA 5JCOC 5HY2A 1JN1A 2KG4A 2WALA 1YQNA 3IEQA 1ZWZA 3FD6A 1Q81H 4O4HA 1QVFF 2RHOA 2KTVA 4HNAA 1VQ6F 3E1YA 1U3LA 3FFMA 2YXZA 2HRYA 1XHOA 1M90H 3JARB 3JATB 4O2AA 3P4EA 3IKEA 3IR9A 3K2XA 2P6YA 4B46A 4ZHQA 3KJJA 3QUWA 4EB6B 4G4WA 5DCVA 2JNBA 4ZHYB 5LYJA 1JY8A 1W2BF 5GAPK 5EIBC 4O4JA 3WXMB 5GINC 3CCJF 1S72F 2KTUA 2ZAUA 1RQ2A 5FNVA 4YJ2A 3SIVA 4IIJA 3WJRA 1XBIA 3VOAA 3VTIC 4C8IA 3RYCB 3N2KB 1TVKA 2VGNA 3MDOA 3GTZA 3JVHA 5CB4A 3S02A 4EI7A 1H48A 3MCAB 1GZ0A 3TD4A 5HWEA 5KX5B 1SDSA 3LWPC 1M1KH 3RYFA 3KIZA 3ERNA 2H8CA 4B45A 1VHAA 1OFUA 3RA5A 1VQOF 1TUBA 5EB0A 3DDNA 1COMA 1VQPF 4BY9D 1QU9A 4O2BA 3IKFA 3S0YA 4FFBB 1X52A 5EYPA 2UYNA 1SZQA 5LP6B 4I55B 4ZI7A 1JFFB 1RLGA 3K14A 1CLIA 2IAFA 5IJ9B 1IV4A 5GONA 3MQWA 5J2TB 1YJNF 2CWJA 3HKDA 1GX1A 3RYHA 3CCMF 4RHAA 3S0HA 5IJ0A 2Z01A 4EI8A 4BT6A 3CC7F 3JAKA 5JH7B 2LBWA 4U3JA 5IT9M 5CA1A 4DRXA 3VIUA 3N4YA 3C9RA 3NK7A 5GANK 3HKEA 2UZHA 3LMEA 4B62A 5C8YB 3WJPA 3S03A 4I4TA 2HP3A 3CMAF 2N48A 3L7QA 2MQEA 3N2GA 2VXYA 1KNKA 5EZYB 5AVMA 1OAPA 4YJ3A 1SA0A 3V7EA 2LBTA 4C4WC 3I55F 2VGMA 4X20A 5JVDB 2AIFA 2Z1EA 4G88A 3HJWC 3LFOA 3I56F 2RB9A 2CZWA 1FSZA 1Q8RA 5EWRA 2UYJA 4PWTA 4BW0B 5G4UC 4G4ZA 3MCQA 2Z1UA 2CSLA 5FJ4C 1W5AA 3KE1A 3ELCA 1KNJA 3GHZA 4G4VA 5KMGB 5IYZA 1JJ2F 1FNKA 3WPXA 2B33A 3VYSC 3KJKA 3JAWA 4BT5A 4O4IA 1Z5WA 2ALEA 5LOVA 2IQQA 3NK6A 3ON1A 3D01A 2CW4A 1FFXA 1W55A 3FD5A 2HS0A 2HVYD 1YGYA 1IV1A 1YI2F 4X1KB 2I6DA 3CYPB 1VH8A 3CB2A 2LCAA 4BT4A 5LA6B 1W40A 4O4LA 3JARA 4BVRA 1IPAA 3CMEF 1DBFA 5CA0B 3LYBA 2QI2A 3V3TA 4TUYB 3OW2F 4EB6A 1T0KB 3VMFB 4X1YB 4WBNA 5B8FA 2AIZP 2GZLA 2PHNA 3FBAA 2HS4A 4HNAB 4KWEA 1W3EX 3VYUC 1VQ7F 3HKCB 3SIUA 3CC2F 2HQSC 2IG8A 3WGLA 3E22A 5JQGA 4X1IA 5MN4A 4ZHQB 3K0TA 3HTNA 3P10A 3LDTA 4R40B 5LYJB 5ITZA 1U3PA 3D00A 4O4JB 1U40A 5EAZA 3VYTC 4E6EA 2VAMA 5BMVA 1YIJF 5EO3A 5FNVB 4C8GA 3CG6A 3QHDA 2QTPA 1VQNF 1IV2A 1W59A 2Q1YA 3WPWA 5G4VC 1FNJA 1PF5A 1JFFA 4M8IA 1NQ3A 1TVKB 3T80A 3ZP7A 3BYQA 4LNUA 1NJIH 1W42A 4I50A 1YHQF 1J7HA 5JH7A 3RYFB 5LXTA 1Q82H 3PLAC 2KGWA 3JASA 4ZK7A 3RYIA 1TUBB 1N8RH 4B5CA 4O2BB 2GLZA 4IHJA 3FPIA 5EYPB 3DC2A 3JALB 2OZBA 3O85A 2Z1TA 2ZVZA 4ZI7B 3C8LA 3U0OA 5HP7A 1RLUA 1ODEA 2UYKA 5GONB 1PXWA 1H7MA 2RHLA 4TV9A 1VQMF 2R751 3RE3A 3HKDB 1W5BA 2OTJF 5IJ0B 3UT5A 2VAWA 4NUTA 3HKBA 4U3JB 1H47A 2RHJA 3LWRC 1RQ7A 1YITF 3P0ZA 3V4DA 3VI6A 4BT7A 4ZOLA 3JCMM 4DRXB 5CA1B 2V9YA 4LCKA 4BVTA 3HKEB 4G4XA 2OTMA 1VQLF 3F0DA 4TV8B 4F6RA 1GO0A 1IV3A 3OBYA 3CC4F 1VQ9F 4I4TB 3CCVF 3D54A 5HP8A 3K12A 1VQ4F 3N2GB 3F0EA 5J2UA 3R0PA 4YJ3B 1SA0B 1K73H 1W5FA 5HXUA 1QVGF 3NVIB 2AMTA 2F9ZC 4BVQA 3KHNA 4NQ3A 1W581 3B6NA 2QA4F 3CCSF 2BO1A 2BTOA 3CYQA 1CK2A 3EORA 2ZOVA 3G6EF 4ZHWA 2RHHA 3I7TA 1Z5VA 5A2QM 1YJWF 3V7QA 2FGYA 4C82A 3WJQA 3CD6F 5IYZB 3JATA 3LWVC 2HP0B 3OBWA 1W57A 2ZODA 4O4IB 3F6MA 5LOVB 1E7KA 1VQKF 1QD9A 3C9UA 3OONA 4ZHVA 4U39A 2CHSA 3ZO8A 1KC8H 3WGKA 4RQOA 1FFXB 2K1SA 1DT9A 3LWQC 5EIBD 3J7AR 1XRGA 5EB1B 4O4HB 3HKCA 3G71F 4BT2A 2HS3A 5GIOC 4O4LB 3TD3A 1ONIA 3RYCA 3N2KA 1KQSF 3CCRF 1R1MA 2LBXA 5HY0A 4O2AB 2CHTA 3C9TA 2ZVYA 3MBMA 2R6R1 1W5EA 2BTQB 4WBNB 5KX5A 1RA4A 4BVSA 3IMPA 5GIPC 1UFYA 3M4SA 1CN7A 3S0WA 1VQ5F 3VO8A 2UYPA 3IEWA 2DYYA 4FFBA 4YJ2B 1YJ9F 2W8BC 4IIJB 3HWUA 3CPQA 4BT3A 5LP6A 4I55A 3WGJA 3I3FA 3G4SF 5FLXM 5IJ9A 3E22B 5JQGB 5CB4B 1K8AH 5J2TA 4X1IB 2H8EA 4DXDA 2Q1XA 2EWCA 3CCUF 4G4YA 3TD5A 5ITZB 2GVIA 2FC3A 3VOBA 3CPWF 5BMVB 2G9IA 5HY1A 2PMPA 5HY4A 2BTUA 2H6LA 4NWOB
chains in the Genus database with same CATH topology
4TZZA 2QEXF 1VQLF 1W40A 3CCLF 1GO0A 3JAMM 3OBYA 4BVRA 3CC4F 1IPAA 2VGNA 3PAFA 3CMEF 1VQ9F 3CCEF 3CCVF 3LWOC 1VQ4F 1X7OA 2QI2A 3V3TA 4EI7A 3OW2F 1K73H 1T0KB 3NVKE 3VMFB 3MCAB 5HXUA 1QVGF 3NVIB 4BVQA 2F9ZC 1GZ0A 4NQ3A 4EI9A 5HWEA 1NMUB 1K9MH 1SDSA 3LWPC 2QA4F 1M1KH 3CCSF 3GYQA 2BO1A 1X7PA 3RA5A 1W41A 1VQOF 1VQPF 1Q86H 4BY9D 1CK2A 3G6EF 3CXCF 1W3EX 5A2QM 1VQ7F 1YJWF 1X52A 3V7QA 3CC2F 3SIUA 2FGYA 3CD6F 1RLGA 3LWVC 3OBWA 1YJNF 1Q7YH 1E7KA 1VQKF 3CCMF 5HXZA 3RA6A 4X3LA 4EI8A 3CC7F 3D00A 2LBWA 1KC8H 3CCQF 1VQ8F 5IT9M 3E20B 1YIJF 3AGKA 4XCQA 1DT9A 4X3MA 5EO3A 3LWQC 3J7AR 2OTLF 3CG6A 3N4YA 3NK7A 5GANK 1VQNF 3G71F 3J81M 2OHWA 3NMUC 1KD1H 5G4VC 1GO1A 5GIOC 3HAXD 3N4ZA 1KQSF 3CCRF 2LBXA 5HY0A 3CMAF 1NJIH 3J80M 3V7EA 4C4WC 1W42A 3I55F 1YHQF 2VGMA 2AIFA 3HJWC 1RA4A 4BVSA 3LFOA 3I56F 5HY2A 5GIPC 2CZWA 5EWRA 1CN7A 2KG4A 1Q82H 3PLAC 1VQ5F 2WALA 1N8RH 1ZWZA 1Q81H 4BW0B 1QVFF 5G4UC 1VQ6F 2GLZA 2KTVA 3E1YA 1YJ9F 3FFMA 5FJ4C 3CPQA 2OZBA 3O85A 1M90H 1JJ2F 3G4SF 3IR9A 5FLXM 1K8AH 1PXWA 1H7MA 1VQMF 2ALEA 3NK6A 5DCVA 2JNBA 3CCUF 2OTJF 3ON1A 1W2BF 5GAPK 2FC3A 3CPWF 4NUTA 3WXMB 5GINC 3CCJF 1S72F 3LWRC 5HY1A 1YITF 2KTUA 5HY4A 3VI6A 2HVYD 3JCMM 1YI2F 4LCKA 4BVTA 3SIVA 2I6DA 1XBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZZ A;  2QEX F;  1VQL F;  1W40 A;  3CCL F;  1GO0 A;  3JAM M;  3OBY A;  3CC4 F;  1IPA A;  2VGN A;  3PAF A;  3CME F;  1VQ9 F;  3CCE F;  3CCV F;  3LWO C;  1VQ4 F;  1X7O A;  2QI2 A;  3OW2 F;  1K73 H;  1T0K B;  3NVK E;  3VMF B;  3MCA B;  1QVG F;  3NVI B;  1GZ0 A;  1SDS A;  1K9M H;  1NMU B;  3LWP C;  2QA4 F;  1M1K H;  3CCS F;  3GYQ A;  2BO1 A;  1X7P A;  3RA5 A;  1W41 A;  1VQO F;  1VQP F;  1Q86 H;  4BY9 D;  1CK2 A;  3G6E F;  3CXC F;  1W3E X;  5A2Q M;  1VQ7 F;  1YJW F;  1X52 A;  3V7Q A;  3CC2 F;  3SIU A;  3CD6 F;  1RLG A;  3LWV C;  3OBW A;  1YJN F;  1Q7Y H;  1E7K A;  1VQK F;  3CCM F;  3RA6 A;  4X3L A;  3CC7 F;  2LBW A;  1KC8 H;  3CCQ F;  1VQ8 F;  5IT9 M;  3E20 B;  1YIJ F;  3AGK A;  5EO3 A;  1DT9 A;  4X3M A;  3LWQ C;  3J7A R;  2OTL F;  3CG6 A;  3N4Y A;  3NK7 A;  5GAN K;  1VQN F;  3G71 F;  3J81 M;  2OHW A;  3NMU C;  1KD1 H;  5G4V C;  1GO1 A;  5GIO C;  3HAX D;  3N4Z A;  1KQS F;  3CCR F;  2LBX A;  3CMA F;  1NJI H;  3J80 M;  3V7E A;  4C4W C;  1W42 A;  3I55 F;  1YHQ F;  2VGM A;  2AIF A;  3HJW C;  1RA4 A;  3LFO A;  3I56 F;  5GIP C;  2CZW A;  5EWR A;  1CN7 A;  2KG4 A;  1Q82 H;  3PLA C;  1VQ5 F;  2WAL A;  1N8R H;  1ZWZ A;  1Q81 H;  4BW0 B;  1QVF F;  5G4U C;  1VQ6 F;  2KTV A;  3E1Y A;  1YJ9 F;  3FFM A;  5FJ4 C;  3CPQ A;  2OZB A;  3O85 A;  1M90 H;  1JJ2 F;  3G4S F;  3IR9 A;  5FLX M;  1K8A H;  1PXW A;  1H7M A;  1VQM F;  2ALE A;  3NK6 A;  5DCV A;  2JNB A;  3CCU F;  2OTJ F;  3ON1 A;  1W2B F;  5GAP K;  2FC3 A;  3CPW F;  4NUT A;  3WXM B;  5GIN C;  3CCJ F;  1S72 F;  3LWR C;  1YIT F;  2KTU A;  3VI6 A;  2HVY D;  3JCM M;  1YI2 F;  4LCK A;  3SIV A;  2I6D A;  1XBI A; 
#chains in the Genus database with same CATH topology
 5LP6 C;  4TZZ A;  3JAL A;  2QEX F;  5C8Y A;  3CCL F;  3JAM M;  2UYN B;  3PAF A;  3WGN A;  3CCE F;  2L26 A;  4LNU B;  3LWO C;  3ZOP A;  5EZY A;  1X7O A;  1X25 A;  3NVK E;  4I50 B;  5JVD A;  1JD1 A;  4EI9 A;  1K9M H;  3M1X A;  1NMU B;  5MN6 A;  3RYH B;  3GYQ A;  1X7P A;  5LXT B;  3C9S A;  2ZF8 A;  1VQV A;  3JAK B;  1W41 A;  3JAS B;  3RYI B;  3F0G A;  1Q86 H;  4IHJ B;  3CXC F;  2Z1F A;  4TV8 A;  5KMG A;  3Q8H A;  3F0F A;  2CVL A;  1T0A A;  2DT4 A;  2HRU A;  3ESJ A;  1U43 A;  4TV9 B;  1Q7Y H;  3WGM A;  4X20 B;  5HXZ A;  3RA6 A;  4X3L A;  3UT5 B;  4ERH A;  5JCO A;  3CCQ F;  3HKB B;  1VQ8 F;  3E20 B;  3AGK A;  4XCQ A;  4X3M A;  2HX0 A;  3QTY A;  4ZOL B;  4X1K A;  5MN5 A;  2OTL F;  2VAP A;  1VK3 A;  5LA6 A;  3J81 M;  2OHW A;  2NMU A;  3NMU C;  3S06 A;  1KD1 H;  1GO1 A;  3HAX D;  4F6R B;  3VCZ A;  4C8E A;  3M84 A;  3N4Z A;  2HP0 A;  5CA0 A;  4TUY A;  1QAH A;  3J80 M;  1XV2 A;  5J2U B;  3ZP4 A;  3JAW B;  4X1Y A;  2I6R A;  1UI9 A;  4C81 A;  2YYE A;  5JCO C;  5HY2 A;  1JN1 A;  2KG4 A;  2WAL A;  1YQN A;  3IEQ A;  1ZWZ A;  3FD6 A;  1Q81 H;  4O4H A;  1QVF F;  2RHO A;  2KTV A;  4HNA A;  1VQ6 F;  3E1Y A;  1U3L A;  3FFM A;  2YXZ A;  2HRY A;  1XHO A;  1M90 H;  3JAR B;  3JAT B;  4O2A A;  3P4E A;  3IKE A;  3IR9 A;  3K2X A;  2P6Y A;  4B46 A;  4ZHQ A;  3KJJ A;  3QUW A;  4EB6 B;  4G4W A;  5DCV A;  2JNB A;  4ZHY B;  5LYJ A;  1JY8 A;  1W2B F;  5GAP K;  5EIB C;  4O4J A;  3WXM B;  5GIN C;  3CCJ F;  1S72 F;  2KTU A;  2ZAU A;  1RQ2 A;  5FNV A;  4YJ2 A;  3SIV A;  4IIJ A;  3WJR A;  1XBI A;  3VOA A;  3VTI C;  4C8I A;  3RYC B;  3N2K B;  1TVK A;  2VGN A;  3MDO A;  3GTZ A;  3JVH A;  5CB4 A;  3S02 A;  4EI7 A;  1H48 A;  3MCA B;  1GZ0 A;  3TD4 A;  5HWE A;  5KX5 B;  1SDS A;  3LWP C;  1M1K H;  3RYF A;  3KIZ A;  3ERN A;  2H8C A;  4B45 A;  1VHA A;  1OFU A;  3RA5 A;  1VQO F;  1TUB A;  5EB0 A;  3DDN A;  1COM A;  1VQP F;  4BY9 D;  1QU9 A;  4O2B A;  3IKF A;  3S0Y A;  4FFB B;  1X52 A;  5EYP A;  2UYN A;  1SZQ A;  5LP6 B;  4I55 B;  4ZI7 A;  1JFF B;  1RLG A;  3K14 A;  1CLI A;  2IAF A;  5IJ9 B;  1IV4 A;  5GON A;  3MQW A;  5J2T B;  1YJN F;  2CWJ A;  3HKD A;  1GX1 A;  3RYH A;  3CCM F;  4RHA A;  3S0H A;  5IJ0 A;  2Z01 A;  4EI8 A;  4BT6 A;  3CC7 F;  3JAK A;  5JH7 B;  2LBW A;  4U3J A;  5IT9 M;  5CA1 A;  4DRX A;  3VIU A;  3N4Y A;  3C9R A;  3NK7 A;  5GAN K;  3HKE A;  2UZH A;  3LME A;  4B62 A;  5C8Y B;  3WJP A;  3S03 A;  4I4T A;  2HP3 A;  3CMA F;  2N48 A;  3L7Q A;  2MQE A;  3N2G A;  2VXY A;  1KNK A;  5EZY B;  5AVM A;  1OAP A;  4YJ3 A;  1SA0 A;  3V7E A;  2LBT A;  4C4W C;  3I55 F;  2VGM A;  4X20 A;  5JVD B;  2AIF A;  2Z1E A;  4G88 A;  3HJW C;  3LFO A;  3I56 F;  2RB9 A;  2CZW A;  1FSZ A;  1Q8R A;  5EWR A;  2UYJ A;  4PWT A;  4BW0 B;  5G4U C;  4G4Z A;  3MCQ A;  2Z1U A;  2CSL A;  5FJ4 C;  1W5A A;  3KE1 A;  3ELC A;  1KNJ A;  3GHZ A;  4G4V A;  5KMG B;  5IYZ A;  1JJ2 F;  1FNK A;  3WPX A;  2B33 A;  3VYS C;  3KJK A;  3JAW A;  4BT5 A;  4O4I A;  1Z5W A;  2ALE A;  5LOV A;  2IQQ A;  3NK6 A;  3ON1 A;  3D01 A;  2CW4 A;  1FFX A;  1W55 A;  3FD5 A;  2HS0 A;  2HVY D;  1YGY A;  1IV1 A;  1YI2 F;  4X1K B;  2I6D A;  3CYP B;  1VH8 A;  3CB2 A;  2LCA A;  4BT4 A;  5LA6 B;  1W40 A;  4O4L A;  3JAR A;  4BVR A;  1IPA A;  3CME F;  1DBF A;  5CA0 B;  3LYB A;  2QI2 A;  3V3T A;  4TUY B;  3OW2 F;  4EB6 A;  1T0K B;  3VMF B;  4X1Y B;  4WBN A;  5B8F A;  2AIZ P;  2GZL A;  2PHN A;  3FBA A;  2HS4 A;  4HNA B;  4KWE A;  1W3E X;  3VYU C;  1VQ7 F;  3HKC B;  3SIU A;  3CC2 F;  2HQS C;  2IG8 A;  3WGL A;  3E22 A;  5JQG A;  4X1I A;  5MN4 A;  4ZHQ B;  3K0T A;  3HTN A;  3P10 A;  3LDT A;  4R40 B;  5LYJ B;  5ITZ A;  1U3P A;  3D00 A;  4O4J B;  1U40 A;  5EAZ A;  3VYT C;  4E6E A;  2VAM A;  5BMV A;  1YIJ F;  5EO3 A;  5FNV B;  4C8G A;  3CG6 A;  3QHD A;  2QTP A;  1VQN F;  1IV2 A;  1W59 A;  2Q1Y A;  3WPW A;  5G4V C;  1FNJ A;  1PF5 A;  1JFF A;  4M8I A;  1NQ3 A;  1TVK B;  3T80 A;  3ZP7 A;  3BYQ A;  4LNU A;  1NJI H;  1W42 A;  4I50 A;  1YHQ F;  1J7H A;  5JH7 A;  3RYF B;  5LXT A;  1Q82 H;  3PLA C;  2KGW A;  3JAS A;  4ZK7 A;  3RYI A;  1TUB B;  1N8R H;  4B5C A;  4O2B B;  2GLZ A;  4IHJ A;  3FPI A;  5EYP B;  3DC2 A;  3JAL B;  2OZB A;  3O85 A;  2Z1T A;  2ZVZ A;  4ZI7 B;  3C8L A;  3U0O A;  5HP7 A;  1RLU A;  1ODE A;  2UYK A;  5GON B;  1PXW A;  1H7M A;  2RHL A;  4TV9 A;  1VQM F;  2R75 1;  3RE3 A;  3HKD B;  1W5B A;  2OTJ F;  5IJ0 B;  3UT5 A;  2VAW A;  4NUT A;  3HKB A;  4U3J B;  1H47 A;  2RHJ A;  3LWR C;  1RQ7 A;  1YIT F;  3P0Z A;  3V4D A;  3VI6 A;  4BT7 A;  4ZOL A;  3JCM M;  4DRX B;  5CA1 B;  2V9Y A;  4LCK A;  4BVT A;  3HKE B;  4G4X A;  2OTM A;  1VQL F;  3F0D A;  4TV8 B;  4F6R A;  1GO0 A;  1IV3 A;  3OBY A;  3CC4 F;  1VQ9 F;  4I4T B;  3CCV F;  3D54 A;  5HP8 A;  3K12 A;  1VQ4 F;  3N2G B;  3F0E A;  5J2U A;  3R0P A;  4YJ3 B;  1SA0 B;  1K73 H;  1W5F A;  5HXU A;  1QVG F;  3NVI B;  2AMT A;  2F9Z C;  4BVQ A;  3KHN A;  4NQ3 A;  1W58 1;  3B6N A;  2QA4 F;  3CCS F;  2BO1 A;  2BTO A;  3CYQ A;  1CK2 A;  3EOR A;  2ZOV A;  3G6E F;  4ZHW A;  2RHH A;  3I7T A;  1Z5V A;  5A2Q M;  1YJW F;  3V7Q A;  2FGY A;  4C82 A;  3WJQ A;  3CD6 F;  5IYZ B;  3JAT A;  3LWV C;  2HP0 B;  3OBW A;  1W57 A;  2ZOD A;  4O4I B;  3F6M A;  5LOV B;  1E7K A;  1VQK F;  1QD9 A;  3C9U A;  3OON A;  4ZHV A;  4U39 A;  2CHS A;  3ZO8 A;  1KC8 H;  3WGK A;  4RQO A;  1FFX B;  2K1S A;  1DT9 A;  3LWQ C;  5EIB D;  3J7A R;  1XRG A;  5EB1 B;  4O4H B;  3HKC A;  3G71 F;  4BT2 A;  2HS3 A;  5GIO C;  4O4L B;  3TD3 A;  1ONI A;  3RYC A;  3N2K A;  1KQS F;  3CCR F;  1R1M A;  2LBX A;  5HY0 A;  4O2A B;  2CHT A;  3C9T A;  2ZVY A;  3MBM A;  2R6R 1;  1W5E A;  2BTQ B;  4WBN B;  5KX5 A;  1RA4 A;  4BVS A;  3IMP A;  5GIP C;  1UFY A;  3M4S A;  1CN7 A;  3S0W A;  1VQ5 F;  3VO8 A;  2UYP A;  3IEW A;  2DYY A;  4FFB A;  4YJ2 B;  1YJ9 F;  2W8B C;  4IIJ B;  3HWU A;  3CPQ A;  4BT3 A;  5LP6 A;  4I55 A;  3WGJ A;  3I3F A;  3G4S F;  5FLX M;  5IJ9 A;  3E22 B;  5JQG B;  5CB4 B;  1K8A H;  5J2T A;  4X1I B;  2H8E A;  4DXD A;  2Q1X A;  2EWC A;  3CCU F;  4G4Y A;  3TD5 A;  5ITZ B;  2GVI A;  2FC3 A;  3VOB A;  3CPW F;  5BMV B;  2G9I A;  5HY1 A;  2PMP A;  5HY4 A;  2BTU A;  2H6L A;  4NWO B; 
#chains in the Genus database with same CATH homology
 4TZZ A;  2QEX F;  1VQL F;  1W40 A;  3CCL F;  1GO0 A;  3JAM M;  3OBY A;  4BVR A;  3CC4 F;  1IPA A;  2VGN A;  3PAF A;  3CME F;  1VQ9 F;  3CCE F;  3CCV F;  3LWO C;  1VQ4 F;  1X7O A;  2QI2 A;  3V3T A;  4EI7 A;  3OW2 F;  1K73 H;  1T0K B;  3NVK E;  3VMF B;  3MCA B;  5HXU A;  1QVG F;  3NVI B;  4BVQ A;  2F9Z C;  1GZ0 A;  4NQ3 A;  4EI9 A;  5HWE A;  1NMU B;  1K9M H;  1SDS A;  3LWP C;  2QA4 F;  1M1K H;  3CCS F;  3GYQ A;  2BO1 A;  1X7P A;  3RA5 A;  1W41 A;  1VQO F;  1VQP F;  1Q86 H;  4BY9 D;  1CK2 A;  3G6E F;  3CXC F;  1W3E X;  5A2Q M;  1VQ7 F;  1YJW F;  1X52 A;  3V7Q A;  3CC2 F;  3SIU A;  2FGY A;  3CD6 F;  1RLG A;  3LWV C;  3OBW A;  1YJN F;  1Q7Y H;  1E7K A;  1VQK F;  3CCM F;  5HXZ A;  3RA6 A;  4X3L A;  4EI8 A;  3CC7 F;  3D00 A;  2LBW A;  1KC8 H;  3CCQ F;  1VQ8 F;  5IT9 M;  3E20 B;  1YIJ F;  3AGK A;  4XCQ A;  1DT9 A;  4X3M A;  5EO3 A;  3LWQ C;  3J7A R;  2OTL F;  3CG6 A;  3N4Y A;  3NK7 A;  5GAN K;  1VQN F;  3G71 F;  3J81 M;  2OHW A;  3NMU C;  1KD1 H;  5G4V C;  1GO1 A;  5GIO C;  3HAX D;  3N4Z A;  1KQS F;  3CCR F;  2LBX A;  5HY0 A;  3CMA F;  1NJI H;  3J80 M;  3V7E A;  4C4W C;  1W42 A;  3I55 F;  1YHQ F;  2VGM A;  2AIF A;  3HJW C;  1RA4 A;  4BVS A;  3LFO A;  3I56 F;  5HY2 A;  5GIP C;  2CZW A;  5EWR A;  1CN7 A;  2KG4 A;  1Q82 H;  3PLA C;  1VQ5 F;  2WAL A;  1N8R H;  1ZWZ A;  1Q81 H;  4BW0 B;  1QVF F;  5G4U C;  1VQ6 F;  2GLZ A;  2KTV A;  3E1Y A;  1YJ9 F;  3FFM A;  5FJ4 C;  3CPQ A;  2OZB A;  3O85 A;  1M90 H;  1JJ2 F;  3G4S F;  3IR9 A;  5FLX M;  1K8A H;  1PXW A;  1H7M A;  1VQM F;  2ALE A;  3NK6 A;  5DCV A;  2JNB A;  3CCU F;  2OTJ F;  3ON1 A;  1W2B F;  5GAP K;  2FC3 A;  3CPW F;  4NUT A;  3WXM B;  5GIN C;  3CCJ F;  1S72 F;  3LWR C;  5HY1 A;  1YIT F;  2KTU A;  5HY4 A;  3VI6 A;  2HVY D;  3JCM M;  1YI2 F;  4LCK A;  4BVT A;  3SIV A;  2I6D A;  1XBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...