1Q7YH

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q7yH00
2FC3A 5IT9M 1CN7A 4BW0B 5G4UC 3I56F 3G6EF 2I6DA 3LFOA 1QVGF 1T0KB 2OZBA 3CC4F 1XBIA 3JCMM 3RA6A 3AGKA 4BY9D 1VQNF 1X7PA 5GAPK 3ON1A 3IR9A 3RA5A 3I55F 1VQLF 1H7MA 3NVIB 1X52A 1VQ7F 3N4ZA 3LWOC 3JAMM 2OTLF 3SIUA 3MCAB 3NVKE 1Q7YH 5GANK 1VQPF 3PAFA 2HVYD 3OBWA 5A2QM 2KTVA 3CCLF 4X3MA 3J7AR 1QVFF 2OTJF 1W2BF 1JJ2F 3SIVA 1RA4A 1Q81H 1VQKF 3V7QA 1Q86H 1K73H 1NMUB 5FJ4C 1W3EX 3NK6A 3WXMB 5FLXM 1YI2F 3CCSF 1N8RH 2LBXA 3CCMF 3J81M 4X3LA 3G71F 3HJWC 3CCVF 1YITF 1VQ6F 5EWRA 1GO1A 1YJ9F 1YHQF 5EO3A 3LWPC 4TZZA 3G4SF 1S72F 3GYQA 3OBYA 3E20B 3CMAF 1YIJF 5DCVA 3O85A 3VMFB 1KC8H 3OW2F 1CK2A 3VI6A 3E1YA 3CCJF 1KQSF 2QI2A 1DT9A 1YJNF 1NJIH 3CG6A 1GO0A 3NK7A 2VGNA 3LWRC 3CD6F 3CC2F 3N4YA 3HAXD 3CMEF 2LBWA 1VQ4F 1VQ8F 3CC7F 1GZ0A 1K9MH 1VQOF 3LWQC 1IPAA 1VQ9F 2VGMA 3V7EA 4C4WC 3J80M 1M90H 4LCKA 1ZWZA 1W41A 2CZWA 3CCUF 2WALA 3PLAC 2ALEA 2BO1A 3CCEF 3LWVC 3CXCF 3FFMA 1YJWF 1X7OA 1M1KH 5G4VC 4NUTA 3CCQF 1PXWA 1Q82H 5GIPC 1W40A 2KTUA 1VQ5F 1RLGA 1W42A 3CPWF 5GIOC 2QEXF 3CCRF 1SDSA 2AIFA 2KG4A 1KD1H 2OHWA 3CPQA 1E7KA 1VQMF 2JNBA 3NMUC 1K8AH 5GINC 2QA4F
chains in the Genus database with same CATH superfamily
4LNUB 2FC3A 1CN7A 3CYQA 1SA0B 2Q1YA 3ESJA 5KX5A 1QVGF 1T0KB 5JH7B 2Z1UA 1W581 2PMPA 3JCMM 3RA6A 5LA6B 3ERNA 4DRXA 1X7PA 3OONA 3F0EA 1IV4A 5LOVA 5GAPK 3I55F 5LP6A 3Q8HA 3NVIB 3UT5B 4O4LB 4TV8B 4X1YB 1U3LA 3N4ZA 2L26A 1TVKB 2ZVYA 3K14A 3HKBA 1QD9A 1YGYA 4E6EA 2IAFA 1Q7YH 3IKEA 5GANK 4C82A 1JD1A 3PAFA 3MBMA 4U3JB 4X1KA 1VQPF 4C8EA 2HS0A 4F6RB 3LMEA 3J7AR 4YJ3A 2CW4A 2UYNA 3ZO8A 4I4TA 5BMVB 2H6LA 3D00A 1NMUB 1W55A 4EI7A 2HRUA 1COMA 3NK6A 1JN1A 1Z5WA 2NMUA 1YI2F 4X3LA 1XV2A 5EWRA 1GO1A 3RYIB 4WBNB 3HKEA 5IYZB 1OAPA 3GTZA 5JCOA 3GYQA 2BTOA 3E20B 3HKDB 4ZOLB 2ZF8A 4BVTA 5J2TB 5DCVA 3O85A 3VYTC 3VTIC 3HTNA 3IMPA 2BTUA 3F0DA 4ERHA 2QI2A 3S0WA 1UI9A 5IJ9B 3S02A 2VGNA 3WGNA 5LXTA 4O4JB 3S0YA 3LWRC 4BVRA 2Z1FA 1PF5A 3C9UA 3N4YA 2CSLA 3E22B 3TD3A 5CA0B 2LBWA 3CMEF 4PWTA 4HNAA 4ZK7A 2H8CA 2GZLA 4O4IA 3HKCA 1DBFA 1VQ9F 1IPAA 4G4YA 3JARB 5HP7A 2PHNA 2IQQA 2DYYA 4EB6B 1ZWZA 3P10A 3V3TA 4FFBA 3ELCA 4BT5A 2ALEA 1RQ2A 5GONA 3FD5A 3I7TA 4NUTA 3CCQF 1PXWA 4EI9A 1W40A 5HY1A 3JAKA 3FBAA 2LBTA 2FGYA 3CYPB 5EYPA 2CVLA 2KG4A 5HY0A 2JNBA 3VIUA 3C9SA 3BYQA 3VYUC 1W5BA 5G4UC 1VK3A 1JY8A 5HY2A 3C8LA 3LFOA 3D01A 4B5CA 2OZBA 3JATA 1JFFB 4U39A 1XBIA 3FPIA 4O4HA 3CC4F 4BY9D 3AGKA 5J2UA 3IEWA 1H48A 4ZI7B 3N2KB 3ON1A 2GVIA 5IJ0B 2HP3A 3DC2A 4G4WA 3VOAA 3RYCB 2HQSC 2V9YA 1KNKA 3MCAB 5EIBD 2ZODA 3F0GA 3K0TA 2ZAUA 2HVYD 3KE1A 1RQ7A 3CCLF 4X3MA 3ZOPA 5JVDB 1W2BF 3K12A 3QTYA 3V7QA 3WGKA 3V4DA 4G4ZA 4BT7A 5MN4A 3MDOA 1W3EX 2ZVZA 3N2GB 4I55A 1TUBA 1VH8A 5FNVA 1W57A 2LBXA 4ZHYB 3ZP4A 3G71F 5EZYB 5CB4B 3VYSC 1YHQF 4TV9A 4ZHWA 4C8IA 4TZZA 3JAWA 4YJ2A 1S72F 3OBYA 3CMAF 2UYKA 1YIJF 2B33A 5JQGA 4XCQA 3LYBA 5HY4A 1KC8H 1Z5VA 3E1YA 3CCJF 1KQSF 2HP0B 2Q1XA 1XRGA 5CA1B 4G4XA 1YJNF 3RYFA 3CG6A 2ZOVA 4FFBB 3HAXD 5C8YB 1VQ4F 1K9MH 3JALA 4IHJA 5KMGA 3M1XA 5ITZB 2KGWA 4X20B 3V7EA 2Z1EA 1X25A 4TUYA 2HX0A 2AMTA 3CCUF 1FFXB 1W5EA 2RHJA 1QAHA 3WGJA 1FNJA 3LWVC 1VHAA 3FFMA 4I50A 4O2BB 5MN5A 4IIJB 1GX1A 4LNUA 5G4VC 2R6R1 2KTUA 1RLGA 3WJQA 1SA0A 1ODEA 3RYHB 5JH7A 3NMUC 2MQEA 5LYJB 2QA4F 4BW0B 3D54A 5EIBC 5EB0A 3I56F 4G4VA 3C9RA 3L7QA 3F6MA 3WPXA 2I6DA 3UT5A 3G6EF 4O4LA 4TV8A 4X1YA 1RLUA 3DDNA 2H8EA 1KNJA 2HS3A 1TVKA 2CHTA 3P0ZA 4U3JA 3IR9A 1H7MA 4F6RA 5KX5B 1VQ7F 3P4EA 3K2XA 2CHSA 4BT4A 4KWEA 3JAMM 3LWOC 2OTLF 5BMVA 1U40A 3SIUA 1H47A 2VXYA 4DRXB 1YQNA 5LOVB 1FSZA 3OBWA 5A2QM 5LP6B 2KTVA 1U43A 1QVFF 2OTJF 1JJ2F 2YXZA 3FD6A 3TD4A 1Q81H 2EWCA 4B46A 4ZHVA 3HKBB 2UYPA 1K73H 3RYIA 4DXDA 4WBNA 1IV1A 2IG8A 4X1KB 3QUWA 5IYZA 3ZP7A 1CLIA 4YJ3B 3WXMB 4B62A 2UYNB 5FLXM 3HKDA 4ZOLA 5J2TA 3CCSF 1N8RH 2Z01A 2Z1TA 4I4TB 3J81M 4B45A 3CCVF 1YITF 1VQ6F 1YJ9F 4C81A 1FNKA 5EO3A 2AIZP 3B6NA 4NWOB 3G4SF 3E22A 1VQVA 3KIZA 5CA0A 1T0AA 3VMFB 2W8BC 4O2AA 3JARA 3JASA 1DT9A 4BVSA 2R751 3HKEB 1Q8RA 3I3FA 4EB6A 4BT6A 3C9TA 3CB2A 4I50B 4EI8A 3MQWA 3CC7F 3S03A 1VQOF 3LWQC 5HWEA 3F0FA 4ZHQA 2QTPA 1SZQA 5LXTB 2RB9A 4C4WC 1NQ3A 3JVHA 4LCKA 1W5AA 4HNAB 3CCEF 4O4IB 3HKCB 1X7OA 3GHZA 1M1KH 1VQ5F 2HS4A 2VAPA 5GIPC 1Q82H 3IEQA 4C8GA 3WJPA 5LP6C 4BT3A 4M8IA 3CPWF 2QEXF 1SDSA 3T80A 1KD1H 2OHWA 1E7KA 1JFFA 5GONB 3VO8A 4BT2A 5IT9M 3JAKB 3HWUA 4ZI7A 3N2KA 3TD5A 5EYPB 5IJ0A 3KJJA 3QHDA 3RYCA 2RHOA 2UZHA 4X1IA 1VQNF 3M84A 3RA5A 1VQLF 1ONIA 1X52A 2RHLA 5AVMA 2VAMA 4BVQA 5JVDA 3KHNA 3JATB 4O4HB 3LDTA 1R1MA 1OFUA 5J2UB 3U0OA 3R0PA 3NVKE 3S0HA 2VAWA 5LA6A 5JCOC 2P6YA 3N2GA 4RHAA 3SIVA 1RA4A 1IV3A 1VQKF 2YYEA 5EZYA 1Q86H 5CB4A 5FJ4C 2F9ZC 3M4SA 2BTQB 2N48A 4G88A 4RQOA 4O2AB 3CCMF 3VCZA 2DT4A 2RHHA 3MCQA 2K1SA 5EB1B 3JASB 3HJWC 5EAZA 2HRYA 2HP0A 1U3PA 5CA1A 3LWPC 4I55B 1TUBB 5FNVB 5C8YA 1UFYA 1IV2A 4NQ3A 3WPWA 3OW2F 1CK2A 3VI6A 1J7HA 4ZHQB 1QU9A 3WJRA 2UYJA 4TV9B 5ITZA 4X20A 1NJIH 1GO0A 3NK7A 3CD6F 3CC2F 3JAWB 2GLZA 4YJ2B 3KJKA 1FFXA 5HP8A 5B8FA 5JQGB 1VQ8F 2I6RA 4R40B 4O2BA 1GZ0A 4IIJA 3EORA 5MN6A 1W5FA 2CWJA 3WGLA 3RYFB 2VGMA 5IJ9A 3J80M 1M90H 1W41A 2CZWA 4O4JA 3RYHA 3RE3A 2WALA 3PLAC 2BO1A 2OTMA 3CXCF 3VOBA 1W59A 1YJWF 3IKFA 3JALB 5LYJA 4IHJB 5HXUA 1XHOA 5KMGB 3WGMA 1W42A 2G9IA 2LCAA 4TUYB 5HXZA 5GIOC 3CCRF 2AIFA 3CPQA 1VQMF 4X1IB 1K8AH 5GINC 3S06A
chains in the Genus database with same CATH topology
2FC3A 5IT9M 1CN7A 4BW0B 5G4UC 3I56F 5HY2A 3G6EF 2I6DA 3LFOA 1QVGF 1T0KB 2OZBA 3CC4F 1XBIA 3JCMM 3RA6A 3AGKA 4BY9D 1VQNF 1X7PA 5GAPK 3ON1A 3IR9A 3RA5A 3I55F 1VQLF 1H7MA 3NVIB 1X52A 4BVQA 1VQ7F 3N4ZA 3LWOC 3JAMM 2OTLF 3SIUA 3MCAB 3NVKE 1Q7YH 5GANK 1VQPF 3PAFA 2HVYD 3OBWA 5A2QM 2KTVA 3CCLF 4X3MA 3J7AR 1QVFF 2OTJF 1W2BF 1JJ2F 3SIVA 1RA4A 1Q81H 1VQKF 3V7QA 1Q86H 1K73H 3D00A 1NMUB 4EI7A 5FJ4C 1W3EX 3NK6A 2F9ZC 3WXMB 5FLXM 1YI2F 3CCSF 1N8RH 2LBXA 3CCMF 3J81M 4X3LA 3G71F 3HJWC 3CCVF 1YITF 1VQ6F 5EWRA 1GO1A 1YJ9F 1YHQF 5EO3A 3LWPC 4TZZA 3G4SF 1S72F 3GYQA 3OBYA 3E20B 3CMAF 1YIJF 5DCVA 4BVTA 4XCQA 3O85A 4NQ3A 5HY4A 3VMFB 1KC8H 3OW2F 1CK2A 3VI6A 3E1YA 3CCJF 1KQSF 2QI2A 1DT9A 4BVSA 1YJNF 1NJIH 3CG6A 1GO0A 3NK7A 2VGNA 3LWRC 3CD6F 3CC2F 2GLZA 4BVRA 3N4YA 3HAXD 3CMEF 2LBWA 1VQ4F 4EI8A 1VQ8F 3CC7F 1GZ0A 1K9MH 1VQOF 3LWQC 1IPAA 5HWEA 1VQ9F 2VGMA 3V7EA 4C4WC 3J80M 1M90H 4LCKA 1ZWZA 1W41A 2CZWA 3CCUF 3V3TA 2WALA 3PLAC 2ALEA 2BO1A 3CCEF 3LWVC 3CXCF 3FFMA 1YJWF 1X7OA 1M1KH 4NUTA 5HXUA 5G4VC 1PXWA 3CCQF 4EI9A 1W40A 2KTUA 5HY1A 5GIPC 1Q82H 1RLGA 1W42A 2FGYA 3CPWF 5HXZA 5GIOC 2QEXF 3CCRF 1SDSA 2AIFA 2KG4A 1KD1H 2OHWA 3CPQA 1E7KA 1VQMF 5HY0A 1VQ5F 2JNBA 3NMUC 1K8AH 5GINC 2QA4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FC3 A;  5IT9 M;  1CN7 A;  4BW0 B;  5G4U C;  3I56 F;  3G6E F;  2I6D A;  3LFO A;  1QVG F;  1T0K B;  2OZB A;  3CC4 F;  1XBI A;  3JCM M;  3RA6 A;  3AGK A;  4BY9 D;  1VQN F;  1X7P A;  5GAP K;  3ON1 A;  3IR9 A;  3RA5 A;  3I55 F;  1VQL F;  1H7M A;  3NVI B;  1X52 A;  1VQ7 F;  3N4Z A;  3LWO C;  3JAM M;  2OTL F;  3SIU A;  3MCA B;  3NVK E;  1Q7Y H;  5GAN K;  1VQP F;  3PAF A;  2HVY D;  3OBW A;  5A2Q M;  2KTV A;  3CCL F;  4X3M A;  3J7A R;  1QVF F;  2OTJ F;  1W2B F;  1JJ2 F;  3SIV A;  1RA4 A;  1Q81 H;  1VQK F;  3V7Q A;  1Q86 H;  1K73 H;  1NMU B;  5FJ4 C;  1W3E X;  3NK6 A;  3WXM B;  5FLX M;  1YI2 F;  3CCS F;  1N8R H;  2LBX A;  3CCM F;  3J81 M;  4X3L A;  3G71 F;  3HJW C;  3CCV F;  1YIT F;  1VQ6 F;  5EWR A;  1GO1 A;  1YJ9 F;  1YHQ F;  5EO3 A;  3LWP C;  4TZZ A;  3G4S F;  1S72 F;  3GYQ A;  3OBY A;  3E20 B;  3CMA F;  1YIJ F;  5DCV A;  3O85 A;  3VMF B;  1KC8 H;  3OW2 F;  1CK2 A;  3VI6 A;  3E1Y A;  3CCJ F;  1KQS F;  2QI2 A;  1DT9 A;  1YJN F;  1NJI H;  3CG6 A;  1GO0 A;  3NK7 A;  2VGN A;  3LWR C;  3CD6 F;  3CC2 F;  3N4Y A;  3HAX D;  3CME F;  2LBW A;  1VQ4 F;  1VQ8 F;  3CC7 F;  1GZ0 A;  1K9M H;  1VQO F;  3LWQ C;  1IPA A;  1VQ9 F;  2VGM A;  3V7E A;  4C4W C;  3J80 M;  1M90 H;  4LCK A;  1ZWZ A;  1W41 A;  2CZW A;  3CCU F;  2WAL A;  3PLA C;  2ALE A;  2BO1 A;  3CCE F;  3LWV C;  3CXC F;  3FFM A;  1YJW F;  1X7O A;  1M1K H;  5G4V C;  4NUT A;  3CCQ F;  1PXW A;  1Q82 H;  5GIP C;  1W40 A;  2KTU A;  1VQ5 F;  1RLG A;  1W42 A;  3CPW F;  5GIO C;  2QEX F;  3CCR F;  1SDS A;  2AIF A;  2KG4 A;  1KD1 H;  2OHW A;  3CPQ A;  1E7K A;  1VQM F;  2JNB A;  3NMU C;  1K8A H;  5GIN C;  2QA4 F; 
#chains in the Genus database with same CATH topology
 4LNU B;  2FC3 A;  1CN7 A;  3CYQ A;  1SA0 B;  2Q1Y A;  3ESJ A;  5KX5 A;  1QVG F;  1T0K B;  5JH7 B;  2Z1U A;  1W58 1;  2PMP A;  3JCM M;  3RA6 A;  5LA6 B;  3ERN A;  4DRX A;  1X7P A;  3OON A;  3F0E A;  1IV4 A;  5LOV A;  5GAP K;  3I55 F;  5LP6 A;  3Q8H A;  3NVI B;  3UT5 B;  4O4L B;  4TV8 B;  4X1Y B;  1U3L A;  3N4Z A;  2L26 A;  1TVK B;  2ZVY A;  3K14 A;  3HKB A;  1QD9 A;  1YGY A;  4E6E A;  2IAF A;  1Q7Y H;  3IKE A;  5GAN K;  4C82 A;  1JD1 A;  3PAF A;  3MBM A;  4U3J B;  4X1K A;  1VQP F;  4C8E A;  2HS0 A;  4F6R B;  3LME A;  3J7A R;  4YJ3 A;  2CW4 A;  2UYN A;  3ZO8 A;  4I4T A;  5BMV B;  2H6L A;  3D00 A;  1NMU B;  1W55 A;  4EI7 A;  2HRU A;  1COM A;  3NK6 A;  1JN1 A;  1Z5W A;  2NMU A;  1YI2 F;  4X3L A;  1XV2 A;  5EWR A;  1GO1 A;  3RYI B;  4WBN B;  3HKE A;  5IYZ B;  1OAP A;  3GTZ A;  5JCO A;  3GYQ A;  2BTO A;  3E20 B;  3HKD B;  4ZOL B;  2ZF8 A;  4BVT A;  5J2T B;  5DCV A;  3O85 A;  3VYT C;  3VTI C;  3HTN A;  3IMP A;  2BTU A;  3F0D A;  4ERH A;  2QI2 A;  3S0W A;  1UI9 A;  5IJ9 B;  3S02 A;  2VGN A;  3WGN A;  5LXT A;  4O4J B;  3S0Y A;  3LWR C;  4BVR A;  2Z1F A;  1PF5 A;  3C9U A;  3N4Y A;  2CSL A;  3E22 B;  3TD3 A;  5CA0 B;  2LBW A;  3CME F;  4PWT A;  4HNA A;  4ZK7 A;  2H8C A;  2GZL A;  4O4I A;  3HKC A;  1DBF A;  1VQ9 F;  1IPA A;  4G4Y A;  3JAR B;  5HP7 A;  2PHN A;  2IQQ A;  2DYY A;  4EB6 B;  1ZWZ A;  3P10 A;  3V3T A;  4FFB A;  3ELC A;  4BT5 A;  2ALE A;  1RQ2 A;  5GON A;  3FD5 A;  3I7T A;  4NUT A;  3CCQ F;  1PXW A;  4EI9 A;  1W40 A;  5HY1 A;  3JAK A;  3FBA A;  2LBT A;  2FGY A;  3CYP B;  5EYP A;  2CVL A;  2KG4 A;  5HY0 A;  2JNB A;  3VIU A;  3C9S A;  3BYQ A;  3VYU C;  1W5B A;  5G4U C;  1VK3 A;  1JY8 A;  5HY2 A;  3C8L A;  3LFO A;  3D01 A;  4B5C A;  2OZB A;  3JAT A;  1JFF B;  4U39 A;  1XBI A;  3FPI A;  4O4H A;  3CC4 F;  4BY9 D;  3AGK A;  5J2U A;  3IEW A;  1H48 A;  4ZI7 B;  3N2K B;  3ON1 A;  2GVI A;  5IJ0 B;  2HP3 A;  3DC2 A;  4G4W A;  3VOA A;  3RYC B;  2HQS C;  2V9Y A;  1KNK A;  3MCA B;  5EIB D;  2ZOD A;  3F0G A;  3K0T A;  2ZAU A;  2HVY D;  3KE1 A;  1RQ7 A;  3CCL F;  4X3M A;  3ZOP A;  5JVD B;  1W2B F;  3K12 A;  3QTY A;  3V7Q A;  3WGK A;  3V4D A;  4G4Z A;  4BT7 A;  5MN4 A;  3MDO A;  1W3E X;  2ZVZ A;  3N2G B;  4I55 A;  1TUB A;  1VH8 A;  5FNV A;  1W57 A;  2LBX A;  4ZHY B;  3ZP4 A;  3G71 F;  5EZY B;  5CB4 B;  3VYS C;  1YHQ F;  4TV9 A;  4ZHW A;  4C8I A;  4TZZ A;  3JAW A;  4YJ2 A;  1S72 F;  3OBY A;  3CMA F;  2UYK A;  1YIJ F;  2B33 A;  5JQG A;  4XCQ A;  3LYB A;  5HY4 A;  1KC8 H;  1Z5V A;  3E1Y A;  3CCJ F;  1KQS F;  2HP0 B;  2Q1X A;  1XRG A;  5CA1 B;  4G4X A;  1YJN F;  3RYF A;  3CG6 A;  2ZOV A;  4FFB B;  3HAX D;  5C8Y B;  1VQ4 F;  1K9M H;  3JAL A;  4IHJ A;  5KMG A;  3M1X A;  5ITZ B;  2KGW A;  4X20 B;  3V7E A;  2Z1E A;  1X25 A;  4TUY A;  2HX0 A;  2AMT A;  3CCU F;  1FFX B;  1W5E A;  2RHJ A;  1QAH A;  3WGJ A;  1FNJ A;  3LWV C;  1VHA A;  3FFM A;  4I50 A;  4O2B B;  5MN5 A;  4IIJ B;  1GX1 A;  4LNU A;  5G4V C;  2R6R 1;  2KTU A;  1RLG A;  3WJQ A;  1SA0 A;  1ODE A;  3RYH B;  5JH7 A;  3NMU C;  2MQE A;  5LYJ B;  2QA4 F;  4BW0 B;  3D54 A;  5EIB C;  5EB0 A;  3I56 F;  4G4V A;  3C9R A;  3L7Q A;  3F6M A;  3WPX A;  2I6D A;  3UT5 A;  3G6E F;  4O4L A;  4TV8 A;  4X1Y A;  1RLU A;  3DDN A;  2H8E A;  1KNJ A;  2HS3 A;  1TVK A;  2CHT A;  3P0Z A;  4U3J A;  3IR9 A;  1H7M A;  4F6R A;  5KX5 B;  1VQ7 F;  3P4E A;  3K2X A;  2CHS A;  4BT4 A;  4KWE A;  3JAM M;  3LWO C;  2OTL F;  5BMV A;  1U40 A;  3SIU A;  1H47 A;  2VXY A;  4DRX B;  1YQN A;  5LOV B;  1FSZ A;  3OBW A;  5A2Q M;  5LP6 B;  2KTV A;  1U43 A;  1QVF F;  2OTJ F;  1JJ2 F;  2YXZ A;  3FD6 A;  3TD4 A;  1Q81 H;  2EWC A;  4B46 A;  4ZHV A;  3HKB B;  2UYP A;  1K73 H;  3RYI A;  4DXD A;  4WBN A;  1IV1 A;  2IG8 A;  4X1K B;  3QUW A;  5IYZ A;  3ZP7 A;  1CLI A;  4YJ3 B;  3WXM B;  4B62 A;  2UYN B;  5FLX M;  3HKD A;  4ZOL A;  5J2T A;  3CCS F;  1N8R H;  2Z01 A;  2Z1T A;  4I4T B;  3J81 M;  4B45 A;  3CCV F;  1YIT F;  1VQ6 F;  1YJ9 F;  4C81 A;  1FNK A;  5EO3 A;  2AIZ P;  3B6N A;  4NWO B;  3G4S F;  3E22 A;  1VQV A;  3KIZ A;  5CA0 A;  1T0A A;  3VMF B;  2W8B C;  4O2A A;  3JAR A;  3JAS A;  1DT9 A;  4BVS A;  2R75 1;  3HKE B;  1Q8R A;  3I3F A;  4EB6 A;  4BT6 A;  3C9T A;  3CB2 A;  4I50 B;  4EI8 A;  3MQW A;  3CC7 F;  3S03 A;  1VQO F;  3LWQ C;  5HWE A;  3F0F A;  4ZHQ A;  2QTP A;  1SZQ A;  5LXT B;  2RB9 A;  4C4W C;  1NQ3 A;  3JVH A;  4LCK A;  1W5A A;  4HNA B;  3CCE F;  4O4I B;  3HKC B;  1X7O A;  3GHZ A;  1M1K H;  1VQ5 F;  2HS4 A;  2VAP A;  5GIP C;  1Q82 H;  3IEQ A;  4C8G A;  3WJP A;  5LP6 C;  4BT3 A;  4M8I A;  3CPW F;  2QEX F;  1SDS A;  3T80 A;  1KD1 H;  2OHW A;  1E7K A;  1JFF A;  5GON B;  3VO8 A;  4BT2 A;  5IT9 M;  3JAK B;  3HWU A;  4ZI7 A;  3N2K A;  3TD5 A;  5EYP B;  5IJ0 A;  3KJJ A;  3QHD A;  3RYC A;  2RHO A;  2UZH A;  4X1I A;  1VQN F;  3M84 A;  3RA5 A;  1VQL F;  1ONI A;  1X52 A;  2RHL A;  5AVM A;  2VAM A;  4BVQ A;  5JVD A;  3KHN A;  3JAT B;  4O4H B;  3LDT A;  1R1M A;  1OFU A;  5J2U B;  3U0O A;  3R0P A;  3NVK E;  3S0H A;  2VAW A;  5LA6 A;  5JCO C;  2P6Y A;  3N2G A;  4RHA A;  3SIV A;  1RA4 A;  1IV3 A;  1VQK F;  2YYE A;  5EZY A;  1Q86 H;  5CB4 A;  5FJ4 C;  2F9Z C;  3M4S A;  2BTQ B;  2N48 A;  4G88 A;  4RQO A;  4O2A B;  3CCM F;  3VCZ A;  2DT4 A;  2RHH A;  3MCQ A;  2K1S A;  5EB1 B;  3JAS B;  3HJW C;  5EAZ A;  2HRY A;  2HP0 A;  1U3P A;  5CA1 A;  3LWP C;  4I55 B;  1TUB B;  5FNV B;  5C8Y A;  1UFY A;  1IV2 A;  4NQ3 A;  3WPW A;  3OW2 F;  1CK2 A;  3VI6 A;  1J7H A;  4ZHQ B;  1QU9 A;  3WJR A;  2UYJ A;  4TV9 B;  5ITZ A;  4X20 A;  1NJI H;  1GO0 A;  3NK7 A;  3CD6 F;  3CC2 F;  3JAW B;  2GLZ A;  4YJ2 B;  3KJK A;  1FFX A;  5HP8 A;  5B8F A;  5JQG B;  1VQ8 F;  2I6R A;  4R40 B;  4O2B A;  1GZ0 A;  4IIJ A;  3EOR A;  5MN6 A;  1W5F A;  2CWJ A;  3WGL A;  3RYF B;  2VGM A;  5IJ9 A;  3J80 M;  1M90 H;  1W41 A;  2CZW A;  4O4J A;  3RYH A;  3RE3 A;  2WAL A;  3PLA C;  2BO1 A;  2OTM A;  3CXC F;  3VOB A;  1W59 A;  1YJW F;  3IKF A;  3JAL B;  5LYJ A;  4IHJ B;  5HXU A;  1XHO A;  5KMG B;  3WGM A;  1W42 A;  2G9I A;  2LCA A;  4TUY B;  5HXZ A;  5GIO C;  3CCR F;  2AIF A;  3CPQ A;  1VQM F;  4X1I B;  1K8A H;  5GIN C;  3S06 A; 
#chains in the Genus database with same CATH homology
 2FC3 A;  5IT9 M;  1CN7 A;  4BW0 B;  5G4U C;  3I56 F;  5HY2 A;  3G6E F;  2I6D A;  3LFO A;  1QVG F;  1T0K B;  2OZB A;  3CC4 F;  1XBI A;  3JCM M;  3RA6 A;  3AGK A;  4BY9 D;  1VQN F;  1X7P A;  5GAP K;  3ON1 A;  3IR9 A;  3RA5 A;  3I55 F;  1VQL F;  1H7M A;  3NVI B;  1X52 A;  4BVQ A;  1VQ7 F;  3N4Z A;  3LWO C;  3JAM M;  2OTL F;  3SIU A;  3MCA B;  3NVK E;  1Q7Y H;  5GAN K;  1VQP F;  3PAF A;  2HVY D;  3OBW A;  5A2Q M;  2KTV A;  3CCL F;  4X3M A;  3J7A R;  1QVF F;  2OTJ F;  1W2B F;  1JJ2 F;  3SIV A;  1RA4 A;  1Q81 H;  1VQK F;  3V7Q A;  1Q86 H;  1K73 H;  3D00 A;  1NMU B;  4EI7 A;  5FJ4 C;  1W3E X;  3NK6 A;  2F9Z C;  3WXM B;  5FLX M;  1YI2 F;  3CCS F;  1N8R H;  2LBX A;  3CCM F;  3J81 M;  4X3L A;  3G71 F;  3HJW C;  3CCV F;  1YIT F;  1VQ6 F;  5EWR A;  1GO1 A;  1YJ9 F;  1YHQ F;  5EO3 A;  3LWP C;  4TZZ A;  3G4S F;  1S72 F;  3GYQ A;  3OBY A;  3E20 B;  3CMA F;  1YIJ F;  5DCV A;  4BVT A;  4XCQ A;  3O85 A;  4NQ3 A;  5HY4 A;  3VMF B;  1KC8 H;  3OW2 F;  1CK2 A;  3VI6 A;  3E1Y A;  3CCJ F;  1KQS F;  2QI2 A;  1DT9 A;  4BVS A;  1YJN F;  1NJI H;  3CG6 A;  1GO0 A;  3NK7 A;  2VGN A;  3LWR C;  3CD6 F;  3CC2 F;  2GLZ A;  4BVR A;  3N4Y A;  3HAX D;  3CME F;  2LBW A;  1VQ4 F;  4EI8 A;  1VQ8 F;  3CC7 F;  1GZ0 A;  1K9M H;  1VQO F;  3LWQ C;  1IPA A;  5HWE A;  1VQ9 F;  2VGM A;  3V7E A;  4C4W C;  3J80 M;  1M90 H;  4LCK A;  1ZWZ A;  1W41 A;  2CZW A;  3CCU F;  3V3T A;  2WAL A;  3PLA C;  2ALE A;  2BO1 A;  3CCE F;  3LWV C;  3CXC F;  3FFM A;  1YJW F;  1X7O A;  1M1K H;  4NUT A;  5HXU A;  5G4V C;  1PXW A;  3CCQ F;  4EI9 A;  1W40 A;  2KTU A;  5HY1 A;  5GIP C;  1Q82 H;  1RLG A;  1W42 A;  2FGY A;  3CPW F;  5HXZ A;  5GIO C;  2QEX F;  3CCR F;  1SDS A;  2AIF A;  2KG4 A;  1KD1 H;  2OHW A;  3CPQ A;  1E7K A;  1VQM F;  5HY0 A;  1VQ5 F;  2JNB A;  3NMU C;  1K8A H;  5GIN C;  2QA4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...