1Q7YH

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q7yH00
2OHWA 1IPAA 1K8AH 3NK7A 3CCRF 3CG6A 3CC2F 3LWVC 1X7PA 3CXCF 1W2BF 1GO0A 3CMAF 1ZWZA 3WXMB 1X52A 3J7AR 1YHQF 1KQSF 1YITF 2JNBA 2WALA 1S72F 4BW0B 1JJ2F 1VQ5F 1NMUB 2KTUA 5GIPC 3OBYA 2QEXF 3ON1A 3PAFA 1H7MA 1W40A 3CCEF 1N8RH 1GO1A 1VQ6F 1YI2F 1CN7A 3NVIB 3LWOC 1YJNF 3RA6A 5EO3A 5GIOC 1GZ0A 1YJWF 3VI6A 2KTVA 1X7OA 3CCQF 3G71F 1VQPF 3CCUF 1VQ7F 1E7KA 2QA4F 3CCSF 3CC4F 3LWRC 5EWRA 3CC7F 3SIVA 1CK2A 3CCLF 1DT9A 3CCMF 3NVKE 3AGKA 3E1YA 3CPQA 1VQMF 4X3MA 3LFOA 3I55F 3RA5A 2HVYD 4BY9D 3V7EA 2I6DA 3NMUC 1PXWA 5G4VC 5GINC 2OZBA 1VQ9F 1T0KB 3NK6A 3V7QA 1KD1H 3CCVF 2VGMA 3G6EF 5A2QM 2LBXA 2CZWA 5IT9M 1K9MH 1Q81H 3CPWF 3CCJF 1M90H 2ALEA 2VGNA 2KG4A 1K73H 1Q7YH 3GYQA 3JAMM 3CD6F 3SIUA 3VMFB 1W3EX 5FJ4C 3CMEF 1W42A 3LWPC 3PLAC 1VQ8F 1QVFF 3J81M 1Q86H 5GANK 4TZZA 3J80M 3I56F 1VQLF 2BO1A 2AIFA 3JCMM 3N4ZA 3HAXD 2OTJF 4X3LA 1Q82H 3MCAB 4LCKA 1YIJF 2FC3A 5DCVA 1QVGF 1RLGA 3FFMA 3G4SF 1SDSA 5GAPK 1KC8H 1VQ4F 5FLXM 1NJIH 3E20B 1W41A 3OW2F 1YJ9F 4C4WC 2LBWA 5G4UC 3HJWC 1M1KH 3LWQC 1VQKF 1VQOF 4NUTA 2QI2A 3N4YA 1RA4A 3OBWA 1XBIA 3O85A 1VQNF 3IR9A 2OTLF
chains in the Genus database with same CATH superfamily
1W5EA 3NK7A 2N48A 3S0HA 3HKCA 1U43A 1VQVA 3HWUA 1X7PA 2B33A 4RHAA 2ZODA 2IG8A 3RYHB 2Q1YA 3JAKB 4U39A 3IEWA 3JASB 3WXMB 3J7AR 3CB2A 2YXZA 3FD6A 1Z5WA 1KQSF 3HKDB 5HY2A 2WALA 3JATA 3DC2A 1S72F 4BT2A 4BT4A 2CVLA 5JH7A 3HKBA 4IIJB 4ZHVA 2VAPA 5GIPC 2OTMA 1W40A 3JVHA 4O4JB 2HQSC 2I6RA 4RQOA 5BMVB 5ITZA 3WPXA 3HKBB 4NWOB 4TV9B 1GZ0A 3OONA 3N2GA 1IV1A 3RYIA 1X7OA 2VXYA 5LA6A 3FPIA 3P4EA 3KJJA 3CCUF 1E7KA 1T0AA 5LP6B 4I55A 4I4TB 5EWRA 5HXUA 2CHTA 2GLZA 3MDOA 3JARB 1DT9A 3N2GB 3R0PA 2ZAUA 1VQMF 3V7EA 4G88A 3RA5A 3P0ZA 4C8GA 1PXWA 1FSZA 4DRXA 2OZBA 2BTOA 1VK3A 3NK6A 1TUBB 1KD1H 2UYKA 1IV2A 2H6LA 5EYPB 5EIBC 2CSLA 3N2KA 1FNKA 2FGYA 3RYFA 2HS0A 2ZVYA 2VGNA 4X1KA 2KG4A 3D01A 4DRXB 1K73H 3MQWA 1Q7YH 4C8IA 3LWPC 1VQ8F 2RHLA 3Q8HA 3J81M 1XV2A 4TZZA 2BO1A 4X1KB 3JCMM 3N4ZA 5J2UA 2CHSA 1Q82H 1W57A 5DCVA 3KHNA 3HKEA 1SDSA 3QHDA 1KC8H 1U3PA 3WPWA 3E20B 5KMGA 3IKEA 4C4WC 5G4UC 5LOVB 1M1KH 3LWQC 3FBAA 3HKEB 1QAHA 3KIZA 1RA4A 1XBIA 2V9YA 3O85A 4C81A 4O2BA 3M4SA 1R1MA 3CG6A 3ELCA 3LWVC 1CLIA 2VAMA 3F0FA 3RE3A 4LNUA 4O2BB 4G4YA 5AVMA 4O4HA 2MQEA 1FFXA 3L7QA 1PF5A 4BVSA 5MN5A 1YHQF 2RHOA 1JFFB 2CW4A 5CA0A 1YITF 2JNBA 2UYJA 3S02A 1JJ2F 4BT7A 3WJQA 4B45A 2Z1EA 1IV3A 1W581 2PMPA 2QEXF 3PAFA 1N8RH 4ZI7B 5CA0B 1CN7A 3K14A 5IJ9A 1YJNF 3D54A 3GTZA 5KX5A 5GIOC 4EB6A 3VI6A 2KTVA 3IMPA 2ZF8A 3F0EA 3K0TA 5CA1B 3EORA 5C8YA 3CCQF 5IJ0A 3F6MA 2GVIA 2QA4F 3I3FA 3WGJA 5LYJA 2LBTA 3CYQA 3HKCB 3C9RA 4HNAA 5FNVA 3ZP7A 4EB6B 3VOBA 4B62A 2NMUA 1H47A 2P6YA 3CPQA 4X3MA 5C8YB 3I55F 4ZHQA 5CB4A 4ZOLA 1XRGA 2I6DA 3D00A 4G4ZA 3ZP4A 2VAWA 4PWTA 3JATB 5JH7B 1GX1A 3CCVF 2VGMA 5A2QM 2IAFA 2CZWA 2AIZP 5EIBD 4ZHQB 5CB4B 4ZOLB 4BVTA 4YJ2A 3CCJF 3V4DA 2K1SA 3GHZA 1Z5VA 3B6NA 3CD6F 1U3LA 5ITZB 1QD9A 5FJ4C 4BT6A 5JQGA 2EWCA 1W42A 2Z1TA 1QVFF 4FFBA 3I56F 3RYIB 3J80M 5LA6B 2HP3A 1W55A 5EZYA 3UT5A 4O2AA 4X3LA 3WGKA 3MCAB 4G4WA 5GONA 2FC3A 4I55B 5JQGB 1QVGF 3ZO8A 4ZHYB 3ERNA 1JY8A 5GAPK 5HXZA 3RYCA 4FFBB 4O4LA 3JAWA 2LCAA 4O4IA 5FLXM 1J7HA 4BT3A 2RHJA 5HWEA 2Z1UA 3OW2F 3WGLA 2HS3A 1XHOA 2L26A 1W5FA 4BVRA 2HX0A 3S0YA 4IHJA 3VO8A 1VQOF 2QI2A 3JAWB 3N4YA 4BT5A 2Z1FA 3P10A 2GZLA 4O4IB 4WBNA 3F0DA 3N2KB 3OBWA 2HRYA 3RYFB 1IPAA 3VOAA 3KJKA 5JCOC 3MCQA 3F0GA 2UYNA 3TD5A 3CC2F 1JD1A 1W2BF 1UI9A 4M8IA 3QTYA 3CMAF 3M84A 5LXTA 5J2UB 4X1IA 1KNKA 3T80A 2UYNB 4BW0B 4YJ3A 1VH8A 2HS4A 2KGWA 1UFYA 2KTUA 3E22A 3KE1A 3OBYA 1H7MA 3CCEF 4B46A 1VQ6F 5LXTB 5KMGB 2F9ZC 4X1YA 2R751 3M1XA 3I7TA 4TUYA 4BVQA 3RA6A 5J2TA 2ZOVA 1VHAA 4DXDA 1YJWF 3S03A 2R6R1 1SZQA 4EI9A 1RLUA 2H8CA 5MN4A 3G71F 3CCSF 1YGYA 1FNJA 3CC4F 3LWRC 2H8EA 3CC7F 1KNJA 3SIVA 1CK2A 1NQ3A 3CCLF 3S06A 5MN6A 1RQ2A 2HP0A 4LNUB 3AGKA 3E1YA 5IYZA 2HVYD 3JALA 3NMUC 4O4HB 3WGNA 4TV8A 1FFXB 2BTUA 1W5BA 3U0OA 4B5CA 1T0KB 1SA0A 2Z01A 2HP0B 1K9MH 3VYUC 5HY4A 2CWJA 3GYQA 3JAMM 3VMFB 5IJ9B 3BYQA 5KX5B 3PLAC 1Q86H 5GANK 1JN1A 3JAKA 3JASA 5IJ0B 2AMTA 3HKDA 5LYJB 4LCKA 1YIJF 2RB9A 4HNAB 5FNVB 1DBFA 1X25A 2QTPA 4IIJA 5JCOA 1W41A 1YJ9F 4O4JA 3C9SA 3HJWC 5BMVA 1VQKF 4TV9A 1OFUA 2RHHA 4NUTA 3VCZA 2UYPA 3LMEA 1TVKA 3WJPA 4YJ2B 3VYTC 3IEQA 3IR9A 3WJRA 2OHWA 1ODEA 5B8FA 5LP6A 1Q8RA 4I4TA 3CCRF 1K8AH 4F6RA 2G9IA 3ESJA 3JARA 3CXCF 5HY0A 2W8BC 1GO0A 1TVKB 1ZWZA 5EZYB 2DYYA 3UT5B 1X52A 4O2AB 4X20A 5GONB 3VTIC 4F6RB 1TUBA 1VQ5F 1NMUB 5EYPA 3RYCB 4O4LB 3ON1A 4I50A 1GO1A 3QUWA 1YI2F 1U40A 4X20B 3NVIB 4EI8A 2PHNA 3LWOC 2BTQB 3TD4A 5EO3A 4IHJB 4WBNB 4I50B 3MBMA 3V3TA 4C8EA 3VIUA 1VQPF 5HP8A 1VQ7F 3C9TA 3C8LA 4G4VA 3IKFA 4U3JA 4ERHA 3CCMF 3NVKE 3C9UA 5LP6C 3LFOA 4BY9D 1OAPA 1W5AA 3WGMA 1QU9A 5G4VC 5JVDA 4X1IB 5EB1B 5LOVA 5GINC 1VQ9F 4KWEA 3V7QA 4ZHWA 4U3JB 2ZVZA 4YJ3B 3G6EF 3ZOPA 2LBXA 5IT9M 3E22B 1Q81H 3CPWF 3LDTA 1M90H 2ALEA 5EB0A 5JVDB 4X1YB 1W59A 4E6EA 3SIUA 4TUYB 1W3EX 5J2TB 3CMEF 1COMA 4NQ3A 4EI7A 1H48A 1VQLF 2AIFA 2Q1XA 2YYEA 3HAXD 2OTJF 1IV4A 1JFFA 4C82A 5EAZA 3HTNA 5HY1A 3CYPB 1ONIA 3FFMA 4XCQA 3G4SF 1RLGA 3TD3A 3VYSC 1VQ4F 2IQQA 5HP7A 5IYZB 1NJIH 3JALB 4ZI7A 2LBWA 2HRUA 1YQNA 4TV8B 3K2XA 4ZK7A 4G4XA 3K12A 2DT4A 1SA0B 3DDNA 3FD5A 3LYBA 2UZHA 4R40B 5CA1A 3RYHA 1RQ7A 1VQNF 2OTLF 3S0WA
chains in the Genus database with same CATH topology
2OHWA 1IPAA 1K8AH 3NK7A 3CCRF 3CG6A 3CC2F 3LWVC 1X7PA 3CXCF 1W2BF 5HY0A 1GO0A 3CMAF 1ZWZA 3WXMB 1X52A 3J7AR 4BVSA 1YHQF 1KQSF 1YITF 5HY2A 2JNBA 2WALA 1S72F 4BW0B 1JJ2F 1VQ5F 1NMUB 2KTUA 5GIPC 3OBYA 2QEXF 3ON1A 3PAFA 1H7MA 1W40A 3CCEF 1N8RH 1GO1A 1VQ6F 1YI2F 2F9ZC 1CN7A 3NVIB 4EI8A 3LWOC 1YJNF 4BVQA 3RA6A 5EO3A 5GIOC 1GZ0A 1YJWF 3VI6A 2KTVA 4EI9A 1X7OA 3V3TA 3CCQF 3G71F 1VQPF 3CCUF 1VQ7F 1E7KA 2QA4F 3CCSF 3CC4F 3LWRC 5EWRA 3CC7F 5HXUA 3SIVA 1CK2A 2GLZA 3CCLF 1DT9A 3CCMF 3NVKE 3AGKA 3E1YA 3CPQA 1VQMF 4X3MA 3LFOA 3I55F 3RA5A 2HVYD 4BY9D 3V7EA 2I6DA 3D00A 1PXWA 3NMUC 5G4VC 5GINC 2OZBA 1VQ9F 1T0KB 3NK6A 3V7QA 1KD1H 3CCVF 2VGMA 3G6EF 5A2QM 2LBXA 2CZWA 5IT9M 1K9MH 1Q81H 3CPWF 5HY4A 2FGYA 3CCJF 4BVTA 1M90H 2ALEA 2VGNA 2KG4A 1K73H 1Q7YH 3GYQA 3JAMM 3CD6F 3SIUA 3VMFB 1W3EX 5FJ4C 3CMEF 1W42A 3LWPC 3PLAC 1VQ8F 1QVFF 3J81M 1Q86H 5GANK 4NQ3A 4EI7A 3J80M 4TZZA 3I56F 1VQLF 2BO1A 2AIFA 3JCMM 3N4ZA 3HAXD 2OTJF 4X3LA 1Q82H 3MCAB 4LCKA 1YIJF 2FC3A 5DCVA 1QVGF 5HY1A 1RLGA 3FFMA 4XCQA 3G4SF 1SDSA 5GAPK 5HXZA 1KC8H 1VQ4F 5FLXM 1NJIH 3E20B 1W41A 5HWEA 3OW2F 1YJ9F 2LBWA 4C4WC 5G4UC 3HJWC 1M1KH 3LWQC 1VQKF 4BVRA 1VQOF 4NUTA 2QI2A 3N4YA 1RA4A 3OBWA 1XBIA 3O85A 1VQNF 3IR9A 2OTLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHW A;  1IPA A;  1K8A H;  3NK7 A;  3CCR F;  3CG6 A;  3CC2 F;  3LWV C;  1X7P A;  3CXC F;  1W2B F;  1GO0 A;  3CMA F;  1ZWZ A;  3WXM B;  1X52 A;  3J7A R;  1YHQ F;  1KQS F;  1YIT F;  2JNB A;  2WAL A;  1S72 F;  4BW0 B;  1JJ2 F;  1VQ5 F;  1NMU B;  2KTU A;  5GIP C;  3OBY A;  2QEX F;  3ON1 A;  3PAF A;  1H7M A;  1W40 A;  3CCE F;  1N8R H;  1GO1 A;  1VQ6 F;  1YI2 F;  1CN7 A;  3NVI B;  3LWO C;  1YJN F;  3RA6 A;  5EO3 A;  5GIO C;  1GZ0 A;  1YJW F;  3VI6 A;  2KTV A;  1X7O A;  3CCQ F;  3G71 F;  1VQP F;  3CCU F;  1VQ7 F;  1E7K A;  2QA4 F;  3CCS F;  3CC4 F;  3LWR C;  5EWR A;  3CC7 F;  3SIV A;  1CK2 A;  3CCL F;  1DT9 A;  3CCM F;  3NVK E;  3AGK A;  3E1Y A;  3CPQ A;  1VQM F;  4X3M A;  3LFO A;  3I55 F;  3RA5 A;  2HVY D;  4BY9 D;  3V7E A;  2I6D A;  3NMU C;  1PXW A;  5G4V C;  5GIN C;  2OZB A;  1VQ9 F;  1T0K B;  3NK6 A;  3V7Q A;  1KD1 H;  3CCV F;  2VGM A;  3G6E F;  5A2Q M;  2LBX A;  2CZW A;  5IT9 M;  1K9M H;  1Q81 H;  3CPW F;  3CCJ F;  1M90 H;  2ALE A;  2VGN A;  2KG4 A;  1K73 H;  1Q7Y H;  3GYQ A;  3JAM M;  3CD6 F;  3SIU A;  3VMF B;  1W3E X;  5FJ4 C;  3CME F;  1W42 A;  3LWP C;  3PLA C;  1VQ8 F;  1QVF F;  3J81 M;  1Q86 H;  5GAN K;  4TZZ A;  3J80 M;  3I56 F;  1VQL F;  2BO1 A;  2AIF A;  3JCM M;  3N4Z A;  3HAX D;  2OTJ F;  4X3L A;  1Q82 H;  3MCA B;  4LCK A;  1YIJ F;  2FC3 A;  5DCV A;  1QVG F;  1RLG A;  3FFM A;  3G4S F;  1SDS A;  5GAP K;  1KC8 H;  1VQ4 F;  5FLX M;  1NJI H;  3E20 B;  1W41 A;  3OW2 F;  1YJ9 F;  4C4W C;  2LBW A;  5G4U C;  3HJW C;  1M1K H;  3LWQ C;  1VQK F;  1VQO F;  4NUT A;  2QI2 A;  3N4Y A;  1RA4 A;  3OBW A;  1XBI A;  3O85 A;  1VQN F;  3IR9 A;  2OTL F; 
#chains in the Genus database with same CATH topology
 1W5E A;  3NK7 A;  2N48 A;  3S0H A;  3HKC A;  1U43 A;  1VQV A;  3HWU A;  1X7P A;  2B33 A;  4RHA A;  2ZOD A;  2IG8 A;  3RYH B;  2Q1Y A;  3JAK B;  4U39 A;  3IEW A;  3JAS B;  3WXM B;  3J7A R;  3CB2 A;  2YXZ A;  3FD6 A;  1Z5W A;  1KQS F;  3HKD B;  5HY2 A;  2WAL A;  3JAT A;  3DC2 A;  1S72 F;  4BT2 A;  4BT4 A;  2CVL A;  5JH7 A;  3HKB A;  4IIJ B;  4ZHV A;  2VAP A;  5GIP C;  2OTM A;  1W40 A;  3JVH A;  4O4J B;  2HQS C;  2I6R A;  4RQO A;  5BMV B;  5ITZ A;  3WPX A;  3HKB B;  4NWO B;  4TV9 B;  1GZ0 A;  3OON A;  3N2G A;  1IV1 A;  3RYI A;  1X7O A;  2VXY A;  5LA6 A;  3FPI A;  3P4E A;  3KJJ A;  3CCU F;  1E7K A;  1T0A A;  5LP6 B;  4I55 A;  4I4T B;  5EWR A;  5HXU A;  2CHT A;  2GLZ A;  3MDO A;  3JAR B;  1DT9 A;  3N2G B;  3R0P A;  2ZAU A;  1VQM F;  3V7E A;  4G88 A;  3RA5 A;  3P0Z A;  4C8G A;  1PXW A;  1FSZ A;  4DRX A;  2OZB A;  2BTO A;  1VK3 A;  3NK6 A;  1TUB B;  1KD1 H;  2UYK A;  1IV2 A;  2H6L A;  5EYP B;  5EIB C;  2CSL A;  3N2K A;  1FNK A;  2FGY A;  3RYF A;  2HS0 A;  2ZVY A;  2VGN A;  4X1K A;  2KG4 A;  3D01 A;  4DRX B;  1K73 H;  3MQW A;  1Q7Y H;  4C8I A;  3LWP C;  1VQ8 F;  2RHL A;  3Q8H A;  3J81 M;  1XV2 A;  4TZZ A;  2BO1 A;  4X1K B;  3JCM M;  3N4Z A;  5J2U A;  2CHS A;  1Q82 H;  1W57 A;  5DCV A;  3KHN A;  3HKE A;  1SDS A;  3QHD A;  1KC8 H;  1U3P A;  3WPW A;  3E20 B;  5KMG A;  3IKE A;  4C4W C;  5G4U C;  5LOV B;  1M1K H;  3LWQ C;  3FBA A;  3HKE B;  1QAH A;  3KIZ A;  1RA4 A;  1XBI A;  2V9Y A;  3O85 A;  4C81 A;  4O2B A;  3M4S A;  1R1M A;  3CG6 A;  3ELC A;  3LWV C;  1CLI A;  2VAM A;  3F0F A;  3RE3 A;  4LNU A;  4O2B B;  4G4Y A;  5AVM A;  4O4H A;  2MQE A;  1FFX A;  3L7Q A;  1PF5 A;  4BVS A;  5MN5 A;  1YHQ F;  2RHO A;  1JFF B;  2CW4 A;  5CA0 A;  1YIT F;  2JNB A;  2UYJ A;  3S02 A;  1JJ2 F;  4BT7 A;  3WJQ A;  4B45 A;  2Z1E A;  1IV3 A;  1W58 1;  2PMP A;  2QEX F;  3PAF A;  1N8R H;  4ZI7 B;  5CA0 B;  1CN7 A;  3K14 A;  5IJ9 A;  1YJN F;  3D54 A;  3GTZ A;  5KX5 A;  5GIO C;  4EB6 A;  3VI6 A;  2KTV A;  3IMP A;  2ZF8 A;  3F0E A;  3K0T A;  5CA1 B;  3EOR A;  5C8Y A;  3CCQ F;  5IJ0 A;  3F6M A;  2GVI A;  2QA4 F;  3I3F A;  3WGJ A;  5LYJ A;  2LBT A;  3CYQ A;  3HKC B;  3C9R A;  4HNA A;  5FNV A;  3ZP7 A;  4EB6 B;  3VOB A;  4B62 A;  2NMU A;  1H47 A;  2P6Y A;  3CPQ A;  4X3M A;  5C8Y B;  3I55 F;  4ZHQ A;  5CB4 A;  4ZOL A;  1XRG A;  2I6D A;  3D00 A;  4G4Z A;  3ZP4 A;  2VAW A;  4PWT A;  3JAT B;  5JH7 B;  1GX1 A;  3CCV F;  2VGM A;  5A2Q M;  2IAF A;  2CZW A;  2AIZ P;  5EIB D;  4ZHQ B;  5CB4 B;  4ZOL B;  4BVT A;  4YJ2 A;  3CCJ F;  3V4D A;  2K1S A;  3GHZ A;  1Z5V A;  3B6N A;  3CD6 F;  1U3L A;  5ITZ B;  1QD9 A;  5FJ4 C;  4BT6 A;  5JQG A;  2EWC A;  1W42 A;  2Z1T A;  1QVF F;  4FFB A;  3I56 F;  3RYI B;  3J80 M;  5LA6 B;  2HP3 A;  1W55 A;  5EZY A;  3UT5 A;  4O2A A;  4X3L A;  3WGK A;  3MCA B;  4G4W A;  5GON A;  2FC3 A;  4I55 B;  5JQG B;  1QVG F;  3ZO8 A;  4ZHY B;  3ERN A;  1JY8 A;  5GAP K;  5HXZ A;  3RYC A;  4FFB B;  4O4L A;  3JAW A;  2LCA A;  4O4I A;  5FLX M;  1J7H A;  4BT3 A;  2RHJ A;  5HWE A;  2Z1U A;  3OW2 F;  3WGL A;  2HS3 A;  1XHO A;  2L26 A;  1W5F A;  4BVR A;  2HX0 A;  3S0Y A;  4IHJ A;  3VO8 A;  1VQO F;  2QI2 A;  3JAW B;  3N4Y A;  4BT5 A;  2Z1F A;  3P10 A;  2GZL A;  4O4I B;  4WBN A;  3F0D A;  3N2K B;  3OBW A;  2HRY A;  3RYF B;  1IPA A;  3VOA A;  3KJK A;  5JCO C;  3MCQ A;  3F0G A;  2UYN A;  3TD5 A;  3CC2 F;  1JD1 A;  1W2B F;  1UI9 A;  4M8I A;  3QTY A;  3CMA F;  3M84 A;  5LXT A;  5J2U B;  4X1I A;  1KNK A;  3T80 A;  2UYN B;  4BW0 B;  4YJ3 A;  1VH8 A;  2HS4 A;  2KGW A;  1UFY A;  2KTU A;  3E22 A;  3KE1 A;  3OBY A;  1H7M A;  3CCE F;  4B46 A;  1VQ6 F;  5LXT B;  5KMG B;  2F9Z C;  4X1Y A;  2R75 1;  3M1X A;  3I7T A;  4TUY A;  4BVQ A;  3RA6 A;  5J2T A;  2ZOV A;  1VHA A;  4DXD A;  1YJW F;  3S03 A;  2R6R 1;  1SZQ A;  4EI9 A;  1RLU A;  2H8C A;  5MN4 A;  3G71 F;  3CCS F;  1YGY A;  1FNJ A;  3CC4 F;  3LWR C;  2H8E A;  3CC7 F;  1KNJ A;  3SIV A;  1CK2 A;  1NQ3 A;  3CCL F;  3S06 A;  5MN6 A;  1RQ2 A;  2HP0 A;  4LNU B;  3AGK A;  3E1Y A;  5IYZ A;  2HVY D;  3JAL A;  3NMU C;  4O4H B;  3WGN A;  4TV8 A;  1FFX B;  2BTU A;  1W5B A;  3U0O A;  4B5C A;  1T0K B;  1SA0 A;  2Z01 A;  2HP0 B;  1K9M H;  3VYU C;  5HY4 A;  2CWJ A;  3GYQ A;  3JAM M;  3VMF B;  5IJ9 B;  3BYQ A;  5KX5 B;  3PLA C;  1Q86 H;  5GAN K;  1JN1 A;  3JAK A;  3JAS A;  5IJ0 B;  2AMT A;  3HKD A;  5LYJ B;  4LCK A;  1YIJ F;  2RB9 A;  4HNA B;  5FNV B;  1DBF A;  1X25 A;  2QTP A;  4IIJ A;  5JCO A;  1W41 A;  1YJ9 F;  4O4J A;  3C9S A;  3HJW C;  5BMV A;  1VQK F;  4TV9 A;  1OFU A;  2RHH A;  4NUT A;  3VCZ A;  2UYP A;  3LME A;  1TVK A;  3WJP A;  4YJ2 B;  3VYT C;  3IEQ A;  3IR9 A;  3WJR A;  2OHW A;  1ODE A;  5B8F A;  5LP6 A;  1Q8R A;  4I4T A;  3CCR F;  1K8A H;  4F6R A;  2G9I A;  3ESJ A;  3JAR A;  3CXC F;  5HY0 A;  2W8B C;  1GO0 A;  1TVK B;  1ZWZ A;  5EZY B;  2DYY A;  3UT5 B;  1X52 A;  4O2A B;  4X20 A;  5GON B;  3VTI C;  4F6R B;  1TUB A;  1VQ5 F;  1NMU B;  5EYP A;  3RYC B;  4O4L B;  3ON1 A;  4I50 A;  1GO1 A;  3QUW A;  1YI2 F;  1U40 A;  4X20 B;  3NVI B;  4EI8 A;  2PHN A;  3LWO C;  2BTQ B;  3TD4 A;  5EO3 A;  4IHJ B;  4WBN B;  4I50 B;  3MBM A;  3V3T A;  4C8E A;  3VIU A;  1VQP F;  5HP8 A;  1VQ7 F;  3C9T A;  3C8L A;  4G4V A;  3IKF A;  4U3J A;  4ERH A;  3CCM F;  3NVK E;  3C9U A;  5LP6 C;  3LFO A;  4BY9 D;  1OAP A;  1W5A A;  3WGM A;  1QU9 A;  5G4V C;  5JVD A;  4X1I B;  5EB1 B;  5LOV A;  5GIN C;  1VQ9 F;  4KWE A;  3V7Q A;  4ZHW A;  4U3J B;  2ZVZ A;  4YJ3 B;  3G6E F;  3ZOP A;  2LBX A;  5IT9 M;  3E22 B;  1Q81 H;  3CPW F;  3LDT A;  1M90 H;  2ALE A;  5EB0 A;  5JVD B;  4X1Y B;  1W59 A;  4E6E A;  3SIU A;  4TUY B;  1W3E X;  5J2T B;  3CME F;  1COM A;  4NQ3 A;  4EI7 A;  1H48 A;  1VQL F;  2AIF A;  2Q1X A;  2YYE A;  3HAX D;  2OTJ F;  1IV4 A;  1JFF A;  4C82 A;  5EAZ A;  3HTN A;  5HY1 A;  3CYP B;  1ONI A;  3FFM A;  4XCQ A;  3G4S F;  1RLG A;  3TD3 A;  3VYS C;  1VQ4 F;  2IQQ A;  5HP7 A;  5IYZ B;  1NJI H;  3JAL B;  4ZI7 A;  2LBW A;  2HRU A;  1YQN A;  4TV8 B;  3K2X A;  4ZK7 A;  4G4X A;  3K12 A;  2DT4 A;  1SA0 B;  3DDN A;  3FD5 A;  3LYB A;  2UZH A;  4R40 B;  5CA1 A;  3RYH A;  1RQ7 A;  1VQN F;  2OTL F;  3S0W A; 
#chains in the Genus database with same CATH homology
 2OHW A;  1IPA A;  1K8A H;  3NK7 A;  3CCR F;  3CG6 A;  3CC2 F;  3LWV C;  1X7P A;  3CXC F;  1W2B F;  5HY0 A;  1GO0 A;  3CMA F;  1ZWZ A;  3WXM B;  1X52 A;  3J7A R;  4BVS A;  1YHQ F;  1KQS F;  1YIT F;  5HY2 A;  2JNB A;  2WAL A;  1S72 F;  4BW0 B;  1JJ2 F;  1VQ5 F;  1NMU B;  2KTU A;  5GIP C;  3OBY A;  2QEX F;  3ON1 A;  3PAF A;  1H7M A;  1W40 A;  3CCE F;  1N8R H;  1GO1 A;  1VQ6 F;  1YI2 F;  2F9Z C;  1CN7 A;  3NVI B;  4EI8 A;  3LWO C;  1YJN F;  4BVQ A;  3RA6 A;  5EO3 A;  5GIO C;  1GZ0 A;  1YJW F;  3VI6 A;  2KTV A;  4EI9 A;  1X7O A;  3V3T A;  3CCQ F;  3G71 F;  1VQP F;  3CCU F;  1VQ7 F;  1E7K A;  2QA4 F;  3CCS F;  3CC4 F;  3LWR C;  5EWR A;  3CC7 F;  5HXU A;  3SIV A;  1CK2 A;  2GLZ A;  3CCL F;  1DT9 A;  3CCM F;  3NVK E;  3AGK A;  3E1Y A;  3CPQ A;  1VQM F;  4X3M A;  3LFO A;  3I55 F;  3RA5 A;  2HVY D;  4BY9 D;  3V7E A;  2I6D A;  3D00 A;  1PXW A;  3NMU C;  5G4V C;  5GIN C;  2OZB A;  1VQ9 F;  1T0K B;  3NK6 A;  3V7Q A;  1KD1 H;  3CCV F;  2VGM A;  3G6E F;  5A2Q M;  2LBX A;  2CZW A;  5IT9 M;  1K9M H;  1Q81 H;  3CPW F;  5HY4 A;  2FGY A;  3CCJ F;  4BVT A;  1M90 H;  2ALE A;  2VGN A;  2KG4 A;  1K73 H;  1Q7Y H;  3GYQ A;  3JAM M;  3CD6 F;  3SIU A;  3VMF B;  1W3E X;  5FJ4 C;  3CME F;  1W42 A;  3LWP C;  3PLA C;  1VQ8 F;  1QVF F;  3J81 M;  1Q86 H;  5GAN K;  4NQ3 A;  4EI7 A;  3J80 M;  4TZZ A;  3I56 F;  1VQL F;  2BO1 A;  2AIF A;  3JCM M;  3N4Z A;  3HAX D;  2OTJ F;  4X3L A;  1Q82 H;  3MCA B;  4LCK A;  1YIJ F;  2FC3 A;  5DCV A;  1QVG F;  5HY1 A;  1RLG A;  3FFM A;  4XCQ A;  3G4S F;  1SDS A;  5GAP K;  5HXZ A;  1KC8 H;  1VQ4 F;  5FLX M;  1NJI H;  3E20 B;  1W41 A;  5HWE A;  3OW2 F;  1YJ9 F;  2LBW A;  4C4W C;  5G4U C;  3HJW C;  1M1K H;  3LWQ C;  1VQK F;  4BVR A;  1VQO F;  4NUT A;  2QI2 A;  3N4Y A;  1RA4 A;  3OBW A;  1XBI A;  3O85 A;  1VQN F;  3IR9 A;  2OTL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...