2DT4A

Crystal structure of pyrococcus horikoshii a plant- and prokaryote-conserved (ppc) protein at 1.60 resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
143
structure length
143
Chain Sequence
MVTGMFSLGRTYLFRVPEGEELLTYIKNFCKKEGIETAIINGIGTLKNPKIGYFLEEKKEYKVIPLKGSYELISLIGNVSLKDGEPFVHAHVSLGNEEGIVFGGHLVEGEVFVAEIFLQELKGEKIERKPTKYGLALWEELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0802
publication title Crystal structure of Pyrococcus horikoshii PPC protein at 1.60 A resolution
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 27
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2dt4A00
4BT5A 4BT2A 3HTNA 2DT4A 2P6YA 4BT6A 1XV2A 4BT4A 2HX0A 4BT7A 4BT3A 2H6LA 3HWUA 2NMUA
chains in the Genus database with same CATH superfamily
5JH7A 4O4LB 5LP6A 3MBMA 2CHTA 3CC2F 1CN7A 1JD1A 4ZHQA 4BW0B 2Z1EA 4C82A 3CCSF 3I7TA 1NMUB 1QU9A 2R6R1 4G4ZA 3CPWF 3UT5B 4BVTA 2F9ZC 3ZP4A 3RYCB 2H8EA 2L26A 2RB9A 1RA4A 4ZK7A 1YITF 3K12A 1VQ9F 4HNAB 1YGYA 3CC4F 4PWTA 1JFFA 2V9YA 4C8GA 1KNKA 3TD4A 2GVIA 4F6RB 5CB4A 3G71F 3KIZA 2VAWA 3CCJF 5HXUA 4HNAA 2HS0A 1W55A 2BTOA 1NJIH 4KWEA 1W59A 1GO1A 1K8AH 4LCKA 2UYPA 4I55B 2K1SA 5HY1A 3WXMB 1JJ2F 1XBIA 4B5CA 3P4EA 4O2BB 2AIZP 5JVDB 3HAXD 3I56F 2H6LA 3VIUA 1W40A 3O85A 3HJWC 1VQ5F 5LA6A 2HRUA 4O4IA 1Q8RA 5HY0A 2LBXA 4O2BA 4WBNA 2KG4A 1TVKB 1W5AA 3QHDA 4ZHYB 1YIJF 3PAFA 4G88A 4TV9B 5JQGA 3S02A 3V7QA 1VK3A 5IJ9B 3N2GB 4IHJB 2VAPA 3JAWA 5EIBC 2UZHA 4EI8A 3CYPB 2RHHA 3R0PA 1NQ3A 3IKEA 4B62A 5J2TB 4TV9A 2LBTA 5IJ9A 5BMVA 3G6EF 4YJ2B 2HX0A 5J2TA 1U40A 2HP0A 4U3JA 3RYIB 3N4YA 4I4TA 3WJRA 5ITZB 2HP3A 4BT2A 3V7EA 3VOBA 1YI2F 4C81A 2VGMA 3RE3A 3M1XA 3JARA 3M4SA 3ZO8A 2IG8A 1FFXA 3CCQF 3S0HA 3RYIA 1TUBB 2H8CA 4C8IA 2JNBA 3CCMF 3N4ZA 3I55F 5EO3A 1ONIA 3CCUF 4U39A 4NQ3A 5EB1B 4BT4A 5CA0A 1VH8A 3IR9A 3J81M 1Z5VA 3I3FA 3D01A 1TUBA 3HKDB 4X1YA 5FNVB 5C8YB 5LOVB 3VYSC 3IKFA 4ZHWA 3CG6A 1PF5A 1UFYA 2Z01A 1Q86H 2YYEA 3JCMM 4BT6A 4EB6A 3CCEF 1W5BA 3HKCA 5EYPB 4RQOA 5LOVA 3JATB 3KHNA 2Z1FA 2NMUA 4X20A 3OONA 1K9MH 4O2AB 1RLUA 2CWJA 1W42A 3IEQA 2I6RA 2ALEA 3OBYA 3JALB 4IIJA 3VCZA 3KE1A 1X25A 4O4JA 1W57A 5G4VC 1VQLF 3WGLA 5JCOC 1VQMF 2AIFA 2Q1YA 3HKBB 5EAZA 1XRGA 3E22B 3KJJA 3ELCA 4BT3A 5IYZA 2OTLF 4O4LA 1CK2A 2GLZA 1SDSA 3LWQC 3F0GA 2QEXF 1KNJA 2OHWA 3SIVA 5MN6A 4XCQA 3HKBA 3CPQA 2GZLA 3E22A 4TZZA 2QI2A 5LP6C 5A2QM 3UT5A 3HWUA 3RYCA 1X52A 3K0TA 4TUYB 2UYKA 5B8FA 1X7OA 2BO1A 2FGYA 5DCVA 1OFUA 1RQ7A 3JASB 3QUWA 4O4HB 3P0ZA 2WALA 3ZOPA 1H47A 4FFBB 4NUTA 5KX5B 4F6RA 4TUYA 2UYNB 4G4VA 5KMGB 3LFOA 2HQSC 3LWOC 4X1KB 4YJ3B 1IV1A 3MCQA 4ZI7B 3VYTC 3CC7F 3LWRC 4I55A 4ZHVA 2I6DA 2ZVZA 3K2XA 4G4XA 1VQ7F 1CLIA 3D54A 1Q82H 3TD3A 3VO8A 3MCAB 5JVDA 4YJ3A 5HXZA 2ZVYA 2OTMA 5AVMA 2R751 5GIPC 1N8RH 3GYQA 4B46A 1U43A 3RA6A 4G4WA 3K14A 3ESJA 1H7MA 3EORA 3T80A 3C9RA 3WGKA 1FNKA 1X7PA 3MDOA 3VMFB 3RYHB 2PHNA 5CA1B 1QD9A 3FBAA 2QA4F 1TVKA 4DRXB 1GX1A 2DYYA 5HY4A 1KQSF 2KTUA 4ERHA 4TV8B 3TD5A 2CW4A 3D00A 3CXCF 3N2GA 4IHJA 5MN4A 1VQ4F 1VQKF 3VI6A 4DRXA 2Z1TA 1YJNF 3C9UA 1YJWF 1SA0B 1RQ2A 5LYJB 4YJ2A 3CCRF 1FNJA 2LBWA 3OBWA 1ODEA 3CMEF 2FC3A 3NK6A 3N2KB 1IV3A 3C9SA 4BT7A 3C8LA 3JAKB 5ITZA 1OAPA 1U3LA 5IJ0B 1H48A 1UI9A 1QVFF 4RHAA 3E20B 3VOAA 4BVQA 1IV2A 1E7KA 2EWCA 2OTJF 3NMUC 3ON1A 2ZF8A 5IT9M 2HS3A 1QAHA 3HTNA 5GONB 5LXTB 1VQ8F 2HS4A 3FD6A 4LNUB 3WGJA 2CHSA 1S72F 5C8YA 3VYUC 3HKDA 5FNVA 5EZYB 3KJKA 4X1IB 3RYFB 3FFMA 1PXWA 4I50B 1K73H 1VQPF 2Q1XA 1Z5WA 2HVYD 5EYPA 1GO0A 3JATA 3S0WA 3J7AR 5J2UB 1YHQF 1IV4A 4DXDA 4O2AA 2CSLA 3CMAF 5GIOC 3IMPA 1GZ0A 5JH7B 4NWOB 3V4DA 5EWRA 5LP6B 2ZODA 1T0KB 1ZWZA 3JALA 4ZOLB 3ZP7A 3VTIC 1VQOF 4ZHQB 2IAFA 2CVLA 5G4UC 1W3EX 3WPWA 3MQWA 1Q7YH 2YXZA 2B33A 3E1YA 4ZOLA 3CD6F 2VAMA 3B6NA 5HP8A 3S06A 3F0EA 3RA5A 4EI9A 1JFFB 4BY9D 1VQVA 2CZWA 2W8BC 3C9TA 5MN5A 2ZOVA 2QTPA 4EI7A 3FD5A 2BTQB 5CB4B 3WPXA 1FSZA 1JN1A 3J80M 3NVKE 3WJPA 5FLXM 3WJQA 3LWVC 2ZAUA 2DT4A 3JASA 4O4HA 1DBFA 3V3TA 3DC2A 3DDNA 4M8IA 3Q8HA 4FFBA 1Q81H 5KX5A 2UYNA 5KMGA 1IPAA 3BYQA 3FPIA 4X1KA 3M84A 2BTUA 2N48A 2P6YA 4ZI7A 2G9IA 1VHAA 1XV2A 5HWEA 3F0DA 5LA6B 1COMA 4O4IB 3CCLF 4WBNB 1T0AA 4BT5A 4BVSA 1YQNA 1R1MA 5JQGB 2RHLA 3RYHA 2LCAA 5CA1A 3JAWB 1W5FA 3JAMM 2UYJA 2OZBA 5GANK 5FJ4C 1J7HA 1DT9A 5EB0A 2RHOA 3ERNA 3QTYA 4TV8A 5BMVB 1VQNF 5GINC 2HRYA 3F0FA 4R40B 3S03A 2HP0B 3LYBA 4U3JB 1SA0A 4I4TB 2RHJA 3CCVF 1W41A 2KGWA 5GAPK 5LYJA 3P10A 3NK7A 2MQEA 3S0YA 3LMEA 1XHOA 3JARB 3HKEB 3U0OA 1FFXB 3N2KA 3NVIB 3WGMA 3JAKA 4X3MA 5HY2A 1SZQA 4BVRA 3G4SF 1KC8H 4E6EA 1KD1H 1W581 2VGNA 3CB2A 1W5EA 5IJ0A 5CA0B 1QVGF 3OW2F 3HKEA 1M90H 2AMTA 3AGKA 2PMPA 3IEWA 4X1YB 4G4YA 3GTZA 3WGNA 1JY8A 5GONA 3JVHA 5LXTA 4EB6B 3HKCB 4LNUA 4X3LA 3F6MA 3PLAC 1W2BF 3SIUA 4X20B 3CYQA 5EZYA 1RLGA 4X1IA 3RYFA 5JCOA 4I50A 2VXYA 2KTVA 5EIBD 1VQ6F 3LWPC 3GHZA 2Z1UA 1U3PA 4IIJB 4C4WC 4O4JB 3LDTA 5HP7A 1YJ9F 5J2UA 4C8EA 1M1KH 4B45A 2IQQA 5IYZB 3L7QA
chains in the Genus database with same CATH topology
4BT5A 4BT2A 3HTNA 2DT4A 2P6YA 4BT6A 1XV2A 4BT4A 2HX0A 4BT7A 4BT3A 2H6LA 3HWUA 2NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT5 A;  4BT2 A;  3HTN A;  2DT4 A;  2P6Y A;  4BT6 A;  1XV2 A;  4BT4 A;  2HX0 A;  4BT7 A;  4BT3 A;  2H6L A;  3HWU A;  2NMU A; 
#chains in the Genus database with same CATH topology
 5JH7 A;  4O4L B;  5LP6 A;  3MBM A;  2CHT A;  3CC2 F;  1CN7 A;  1JD1 A;  4ZHQ A;  4BW0 B;  2Z1E A;  4C82 A;  3CCS F;  3I7T A;  1NMU B;  1QU9 A;  2R6R 1;  4G4Z A;  3CPW F;  3UT5 B;  4BVT A;  2F9Z C;  3ZP4 A;  3RYC B;  2H8E A;  2L26 A;  2RB9 A;  1RA4 A;  4ZK7 A;  1YIT F;  3K12 A;  1VQ9 F;  4HNA B;  1YGY A;  3CC4 F;  4PWT A;  1JFF A;  2V9Y A;  4C8G A;  1KNK A;  3TD4 A;  2GVI A;  4F6R B;  5CB4 A;  3G71 F;  3KIZ A;  2VAW A;  3CCJ F;  5HXU A;  4HNA A;  2HS0 A;  1W55 A;  2BTO A;  1NJI H;  4KWE A;  1W59 A;  1GO1 A;  1K8A H;  4LCK A;  2UYP A;  4I55 B;  2K1S A;  5HY1 A;  3WXM B;  1JJ2 F;  1XBI A;  4B5C A;  3P4E A;  4O2B B;  2AIZ P;  5JVD B;  3HAX D;  3I56 F;  2H6L A;  3VIU A;  1W40 A;  3O85 A;  3HJW C;  1VQ5 F;  5LA6 A;  2HRU A;  4O4I A;  1Q8R A;  5HY0 A;  2LBX A;  4O2B A;  4WBN A;  2KG4 A;  1TVK B;  1W5A A;  3QHD A;  4ZHY B;  1YIJ F;  3PAF A;  4G88 A;  4TV9 B;  5JQG A;  3S02 A;  3V7Q A;  1VK3 A;  5IJ9 B;  3N2G B;  4IHJ B;  2VAP A;  3JAW A;  5EIB C;  2UZH A;  4EI8 A;  3CYP B;  2RHH A;  3R0P A;  1NQ3 A;  3IKE A;  4B62 A;  5J2T B;  4TV9 A;  2LBT A;  5IJ9 A;  5BMV A;  3G6E F;  4YJ2 B;  2HX0 A;  5J2T A;  1U40 A;  2HP0 A;  4U3J A;  3RYI B;  3N4Y A;  4I4T A;  3WJR A;  5ITZ B;  2HP3 A;  4BT2 A;  3V7E A;  3VOB A;  1YI2 F;  4C81 A;  2VGM A;  3RE3 A;  3M1X A;  3JAR A;  3M4S A;  3ZO8 A;  2IG8 A;  1FFX A;  3CCQ F;  3S0H A;  3RYI A;  1TUB B;  2H8C A;  4C8I A;  2JNB A;  3CCM F;  3N4Z A;  3I55 F;  5EO3 A;  1ONI A;  3CCU F;  4U39 A;  4NQ3 A;  5EB1 B;  4BT4 A;  5CA0 A;  1VH8 A;  3IR9 A;  3J81 M;  1Z5V A;  3I3F A;  3D01 A;  1TUB A;  3HKD B;  4X1Y A;  5FNV B;  5C8Y B;  5LOV B;  3VYS C;  3IKF A;  4ZHW A;  3CG6 A;  1PF5 A;  1UFY A;  2Z01 A;  1Q86 H;  2YYE A;  3JCM M;  4BT6 A;  4EB6 A;  3CCE F;  1W5B A;  3HKC A;  5EYP B;  4RQO A;  5LOV A;  3JAT B;  3KHN A;  2Z1F A;  2NMU A;  4X20 A;  3OON A;  1K9M H;  4O2A B;  1RLU A;  2CWJ A;  1W42 A;  3IEQ A;  2I6R A;  2ALE A;  3OBY A;  3JAL B;  4IIJ A;  3VCZ A;  3KE1 A;  1X25 A;  4O4J A;  1W57 A;  5G4V C;  1VQL F;  3WGL A;  5JCO C;  1VQM F;  2AIF A;  2Q1Y A;  3HKB B;  5EAZ A;  1XRG A;  3E22 B;  3KJJ A;  3ELC A;  4BT3 A;  5IYZ A;  2OTL F;  4O4L A;  1CK2 A;  2GLZ A;  1SDS A;  3LWQ C;  3F0G A;  2QEX F;  1KNJ A;  2OHW A;  3SIV A;  5MN6 A;  4XCQ A;  3HKB A;  3CPQ A;  2GZL A;  3E22 A;  4TZZ A;  2QI2 A;  5LP6 C;  5A2Q M;  3UT5 A;  3HWU A;  3RYC A;  1X52 A;  3K0T A;  4TUY B;  2UYK A;  5B8F A;  1X7O A;  2BO1 A;  2FGY A;  5DCV A;  1OFU A;  1RQ7 A;  3JAS B;  3QUW A;  4O4H B;  3P0Z A;  2WAL A;  3ZOP A;  1H47 A;  4FFB B;  4NUT A;  5KX5 B;  4F6R A;  4TUY A;  2UYN B;  4G4V A;  5KMG B;  3LFO A;  2HQS C;  3LWO C;  4X1K B;  4YJ3 B;  1IV1 A;  3MCQ A;  4ZI7 B;  3VYT C;  3CC7 F;  3LWR C;  4I55 A;  4ZHV A;  2I6D A;  2ZVZ A;  3K2X A;  4G4X A;  1VQ7 F;  1CLI A;  3D54 A;  1Q82 H;  3TD3 A;  3VO8 A;  3MCA B;  5JVD A;  4YJ3 A;  5HXZ A;  2ZVY A;  2OTM A;  5AVM A;  2R75 1;  5GIP C;  1N8R H;  3GYQ A;  4B46 A;  1U43 A;  3RA6 A;  4G4W A;  3K14 A;  3ESJ A;  1H7M A;  3EOR A;  3T80 A;  3C9R A;  3WGK A;  1FNK A;  1X7P A;  3MDO A;  3VMF B;  3RYH B;  2PHN A;  5CA1 B;  1QD9 A;  3FBA A;  2QA4 F;  1TVK A;  4DRX B;  1GX1 A;  2DYY A;  5HY4 A;  1KQS F;  2KTU A;  4ERH A;  4TV8 B;  3TD5 A;  2CW4 A;  3D00 A;  3CXC F;  3N2G A;  4IHJ A;  5MN4 A;  1VQ4 F;  1VQK F;  3VI6 A;  4DRX A;  2Z1T A;  1YJN F;  3C9U A;  1YJW F;  1SA0 B;  1RQ2 A;  5LYJ B;  4YJ2 A;  3CCR F;  1FNJ A;  2LBW A;  3OBW A;  1ODE A;  3CME F;  2FC3 A;  3NK6 A;  3N2K B;  1IV3 A;  3C9S A;  4BT7 A;  3C8L A;  3JAK B;  5ITZ A;  1OAP A;  1U3L A;  5IJ0 B;  1H48 A;  1UI9 A;  1QVF F;  4RHA A;  3E20 B;  3VOA A;  4BVQ A;  1IV2 A;  1E7K A;  2EWC A;  2OTJ F;  3NMU C;  3ON1 A;  2ZF8 A;  5IT9 M;  2HS3 A;  1QAH A;  3HTN A;  5GON B;  5LXT B;  1VQ8 F;  2HS4 A;  3FD6 A;  4LNU B;  3WGJ A;  2CHS A;  1S72 F;  5C8Y A;  3VYU C;  3HKD A;  5FNV A;  5EZY B;  3KJK A;  4X1I B;  3RYF B;  3FFM A;  1PXW A;  4I50 B;  1K73 H;  1VQP F;  2Q1X A;  1Z5W A;  2HVY D;  5EYP A;  1GO0 A;  3JAT A;  3S0W A;  3J7A R;  5J2U B;  1YHQ F;  1IV4 A;  4DXD A;  4O2A A;  2CSL A;  3CMA F;  5GIO C;  3IMP A;  1GZ0 A;  5JH7 B;  4NWO B;  3V4D A;  5EWR A;  5LP6 B;  2ZOD A;  1T0K B;  1ZWZ A;  3JAL A;  4ZOL B;  3ZP7 A;  3VTI C;  1VQO F;  4ZHQ B;  2IAF A;  2CVL A;  5G4U C;  1W3E X;  3WPW A;  3MQW A;  1Q7Y H;  2YXZ A;  2B33 A;  3E1Y A;  4ZOL A;  3CD6 F;  2VAM A;  3B6N A;  5HP8 A;  3S06 A;  3F0E A;  3RA5 A;  4EI9 A;  1JFF B;  4BY9 D;  1VQV A;  2CZW A;  2W8B C;  3C9T A;  5MN5 A;  2ZOV A;  2QTP A;  4EI7 A;  3FD5 A;  2BTQ B;  5CB4 B;  3WPX A;  1FSZ A;  1JN1 A;  3J80 M;  3NVK E;  3WJP A;  5FLX M;  3WJQ A;  3LWV C;  2ZAU A;  2DT4 A;  3JAS A;  4O4H A;  1DBF A;  3V3T A;  3DC2 A;  3DDN A;  4M8I A;  3Q8H A;  4FFB A;  1Q81 H;  5KX5 A;  2UYN A;  5KMG A;  1IPA A;  3BYQ A;  3FPI A;  4X1K A;  3M84 A;  2BTU A;  2N48 A;  2P6Y A;  4ZI7 A;  2G9I A;  1VHA A;  1XV2 A;  5HWE A;  3F0D A;  5LA6 B;  1COM A;  4O4I B;  3CCL F;  4WBN B;  1T0A A;  4BT5 A;  4BVS A;  1YQN A;  1R1M A;  5JQG B;  2RHL A;  3RYH A;  2LCA A;  5CA1 A;  3JAW B;  1W5F A;  3JAM M;  2UYJ A;  2OZB A;  5GAN K;  5FJ4 C;  1J7H A;  1DT9 A;  5EB0 A;  2RHO A;  3ERN A;  3QTY A;  4TV8 A;  5BMV B;  1VQN F;  5GIN C;  2HRY A;  3F0F A;  4R40 B;  3S03 A;  2HP0 B;  3LYB A;  4U3J B;  1SA0 A;  4I4T B;  2RHJ A;  3CCV F;  1W41 A;  2KGW A;  5GAP K;  5LYJ A;  3P10 A;  3NK7 A;  2MQE A;  3S0Y A;  3LME A;  1XHO A;  3JAR B;  3HKE B;  3U0O A;  1FFX B;  3N2K A;  3NVI B;  3WGM A;  3JAK A;  4X3M A;  5HY2 A;  1SZQ A;  4BVR A;  3G4S F;  1KC8 H;  4E6E A;  1KD1 H;  1W58 1;  2VGN A;  3CB2 A;  1W5E A;  5IJ0 A;  5CA0 B;  1QVG F;  3OW2 F;  3HKE A;  1M90 H;  2AMT A;  3AGK A;  2PMP A;  3IEW A;  4X1Y B;  4G4Y A;  3GTZ A;  3WGN A;  1JY8 A;  5GON A;  3JVH A;  5LXT A;  4EB6 B;  3HKC B;  4LNU A;  4X3L A;  3F6M A;  3PLA C;  1W2B F;  3SIU A;  4X20 B;  3CYQ A;  5EZY A;  1RLG A;  4X1I A;  3RYF A;  5JCO A;  4I50 A;  2VXY A;  2KTV A;  5EIB D;  1VQ6 F;  3LWP C;  3GHZ A;  2Z1U A;  1U3P A;  4IIJ B;  4C4W C;  4O4J B;  3LDT A;  5HP7 A;  1YJ9 F;  5J2U A;  4C8E A;  1M1K H;  4B45 A;  2IQQ A;  5IYZ B;  3L7Q A; 
#chains in the Genus database with same CATH homology
 4BT5 A;  4BT2 A;  3HTN A;  2DT4 A;  2P6Y A;  4BT6 A;  1XV2 A;  4BT4 A;  2HX0 A;  4BT7 A;  4BT3 A;  2H6L A;  3HWU A;  2NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...