2DT4A

Crystal structure of pyrococcus horikoshii a plant- and prokaryote-conserved (ppc) protein at 1.60 resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
143
structure length
143
Chain Sequence
b'MVTGMFSLGRTYLFRVPEGEELLTYIKNFCKKEGIETAIINGIGTLKNPKIGYFLEEKKEYKVIPLKGSYELISLIGNVSLKDGEPFVHAHVSLGNEEGIVFGGHLVEGEVFVAEIFLQELKGEKIERKPTKYGLALWEELKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0802
molecule tags Structural genomics, unknown function
source organism Pyrococcus horikoshii
publication title Crystal structure of Pyrococcus horikoshii PPC protein at 1.60 A resolution
pubmed doi rcsb
total genus 27
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2dt4A00
2DT4A 2NMUA 3HTNA 4BT7A 2P6YA 2H6LA 4BT3A 4BT2A 4BT6A 3HWUA 2HX0A 1XV2A 4BT5A 4BT4A
chains in the Genus database with same CATH superfamily
3LWQC 1VQ8F 5MN5A 3RA6A 2B33A 3I3FA 5IJ0A 3OW2F 3F0EA 4X1IA 1ODEA 3CMEF 2HP0B 2L26A 3AGKA 2FGYA 3KHNA 4O2AB 3SIUA 1SZQA 3HKEA 3T80A 2VXYA 1Z5VA 1GO1A 5FLXM 3CMAF 3JAWB 3E22B 2QEXF 1SA0B 2JNBA 2BTQB 4X3MA 1K8AH 1W40A 3N2GB 1DT9A 2ZVZA 3KJKA 5HP7A 5GIOC 2CHSA 3CG6A 4TUYA 3TD4A 3BYQA 1JY8A 5IJ0B 3HJWC 4C82A 4I55B 1U3PA 3JASA 5LYJA 2HS4A 3WGLA 2HX0A 1X7OA 2AIFA 4RQOA 1QAHA 3RYHA 2DT4A 5EZYB 2I6DA 1YQNA 3K14A 2CHTA 2FC3A 2VGMA 4NQ3A 3JVHA 2N48A 1YJWF 5EB0A 2UYNA 5HY1A 4LCKA 4BT3A 3WJRA 4O4LA 1YJ9F 1YIJF 1VQ5F 2V9YA 1NJIH 5CB4B 4G4XA 4I4TB 3P0ZA 3KJJA 3CCSF 1S72F 1ZWZA 3N2KB 4LNUB 2VAWA 4B5CA 4HNAB 1XV2A 4IHJB 3P4EA 3JASB 1TVKA 4U39A 3IMPA 2IQQA 1TVKB 3FD5A 4BT6A 2CVLA 3WGJA 4ZHYB 3I7TA 2UYJA 5LP6A 5IJ9B 3HAXD 1FNKA 3KE1A 2GLZA 1W5FA 3VOAA 1RQ7A 2CZWA 4C8IA 4I50B 5JCOA 3UT5B 1JFFA 5FNVB 3RYFB 3I56F 3CCJF 3HKBA 4BT5A 1FSZA 1NMUB 3NK6A 4G4ZA 3IEQA 1XRGA 4O2AA 3HWUA 5IYZB 1JD1A 1W5AA 3CC7F 3F0DA 2UYKA 1Q7YH 5EB1B 4DRXB 1OAPA 1Z5WA 5JH7A 5BMVA 3G4SF 3TD3A 5LXTB 5BMVB 4I50A 3V3TA 4G4WA 4BW0B 3G6EF 5CA1B 5CA1A 4PWTA 3RYFA 4WBNB 4BVTA 2VAMA 2RHOA 3D01A 4O4HB 5GIPC 3PLAC 3CPWF 3LYBA 1FFXA 1NQ3A 2H8CA 4O4HA 2EWCA 2QI2A 3LFOA 5GANK 2Q1YA 4IHJA 3K12A 3S0YA 5EIBD 4C81A 1VQLF 3VYTC 4M8IA 4BT2A 1IPAA 1W57A 2BTUA 2H8EA 1YITF 1IV4A 3HKEB 4ZOLB 2PHNA 3JAKB 2Z1UA 3S0WA 3VOBA 2UYPA 3E20B 5EYPB 5LOVA 3C9RA 3I55F 5A2QM 2HQSC 1VQ7F 3JALB 4BT7A 5MN6A 2CSLA 1VQNF 3IKFA 3UT5A 3GTZA 3L7QA 5C8YA 2CWJA 4C8GA 4O4LB 3M84A 4YJ2A 5G4UC 4G4VA 3RYIA 3MBMA 3B6NA 5HY4A 1YGYA 2OTJF 3WGKA 5GAPK 3WPWA 1PXWA 1PF5A 3NK7A 3HKBB 2ZF8A 3ELCA 4FFBA 2AIZP 1H48A 2QA4F 3CPQA 5J2TB 1J7HA 5HP8A 5EWRA 1Q86H 2KG4A 3C9SA 1M1KH 4BVQA 2HP3A 4ZOLA 2DYYA 2F9ZC 3GHZA 1XHOA 3M4SA 2HVYD 4G4YA 4TV8A 1X52A 3CB2A 3ZP4A 5GONA 5CA0B 5HXUA 1DBFA 2HS3A 1T0KB 4TUYB 3JARB 3VCZA 5EIBC 1N8RH 3N4YA 1JFFB 1W2BF 1KD1H 3NMUC 1OFUA 2H6LA 3VMFB 1QVFF 2VAPA 4C4WC 2ALEA 3LWVC 2Z1TA 3N2KA 4LNUA 4R40B 2OZBA 2LBTA 4XCQA 2Z1FA 4YJ3B 4RHAA 1XBIA 5HY0A 5ITZB 3WPXA 4G88A 3VO8A 3CXCF 1IV3A 1COMA 3TD5A 1H7MA 3ERNA 4DRXA 3J7AR 3CD6F 4TV9A 4O4JB 4ZHQA 5JVDA 5IJ9A 1JN1A 1KNJA 1W42A 1X25A 5KMGA 4YJ2B 2HS0A 4E6EA 4NWOB 3C8LA 1TUBB 3LWRC 5HXZA 3N2GA 5JCOC 5LA6A 4ZI7B 3FBAA 3MDOA 3OBWA 4IIJA 3F0FA 2OTLF 4C8EA 4ZHVA 4IIJB 3WGNA 3CC2F 2GZLA 1RLGA 2RHLA 4X1IB 3VYUC 3DC2A 3FD6A 3J80M 3CCMF 5IT9M 5G4VC 3CCEF 1CK2A 1W41A 4X1KB 3LDTA 2UYNB 1W59A 4EI9A 1RA4A 3CCVF 2HRUA 5DCVA 1R1MA 3JCMM 5JQGA 3M1XA 4U3JA 2KTUA 3JATA 3F0GA 4KWEA 4F6RB 2ZODA 3O85A 4ZK7A 3PAFA 1KNKA 1Q8RA 3VI6A 2BTOA 3S06A 5FNVA 3RYCB 1VQ9F 5B8FA 3F6MA 2AMTA 3QTYA 3RE3A 5HY2A 3V7EA 4I55A 3G71F 3WXMB 4X1YA 2Q1XA 3D54A 1CN7A 3Q8HA 1H47A 2CW4A 4X1YB 4X1KA 3V4DA 5J2TA 4BVRA 3JAKA 3JAMM 4O4IB 3S02A 4YJ3A 2G9IA 2VGNA 1W5EA 3HKDA 4EB6B 3OBYA 5HWEA 3SIVA 1SA0A 3ESJA 1QVGF 1VQOF 5LP6B 2KGWA 3GYQA 1SDSA 2LBXA 1VQ4F 1U40A 4X20A 2LCAA 4TV8B 4X20B 3K2XA 3K0TA 3RA5A 2Z1EA 1K9MH 1CLIA 2PMPA 4BT4A 1E7KA 1VQVA 1GX1A 3U0OA 2HRYA 4TZZA 1VK3A 5LYJB 3HKCB 3S03A 4B45A 3S0HA 3C9TA 2ZOVA 3CYQA 2MQEA 5EZYA 3E1YA 3E22A 2IAFA 4EI8A 4EB6A 2ZAUA 1T0AA 5LXTA 5JH7B 3HTNA 3MCQA 2QTPA 3QHDA 3JARA 1GO0A 3ZOPA 5KX5A 3WJQA 1YI2F 2I6RA 3ON1A 1KC8H 2W8BC 1UFYA 3DDNA 3KIZA 3VIUA 4F6RA 4ZI7A 5J2UB 3CC4F 3V7QA 2BO1A 3C9UA 5CB4A 2WALA 3RYCA 3P10A 5AVMA 3J81M 3RYHB 2KTVA 1VQPF 3CCUF 3IR9A 2YXZA 1Q82H 3NVKE 2Z01A 2OTMA 1W581 2ZVYA 3CCRF 5KMGB 1VQKF 4ZHWA 3R0PA 2R6R1 3OONA 5JVDB 4O2BA 3IKEA 3JATB 5EO3A 5CA0A 1JJ2F 5FJ4C 1QD9A 4EI7A 2GVIA 4FFBB 3QUWA 1QU9A 1RQ2A 2HP0A 3N4ZA 1VHAA 3FFMA 1ONIA 4O4IA 3VYSC 5GINC 2YYEA 1RLUA 1VQ6F 1YHQF 1IV2A 3JALA 1U3LA 4TV9B 3JAWA 5LP6C 1W5BA 1K73H 3D00A 5EYPA 5LOVB 3NVIB 3MQWA 3HKDB 1X7PA 5EAZA 2IG8A 1Q81H 1FNJA 5JQGB 3LMEA 4NUTA 2K1SA 4ERHA 4WBNA 4B46A 4O2BB 1GZ0A 4X3LA 3CYPB 3WJPA 1M90H 4BY9D 2R751 1U43A 2P6YA 5KX5B 3IEWA 2RB9A 1UI9A 3WGMA 3VTIC 5J2UA 5ITZA 4B62A 4HNAA 5MN4A 1IV1A 3CCQF 4BVSA 1VH8A 3CCLF 1KQSF 5IYZA 2OHWA 2LBWA 3LWOC 1W3EX 1YJNF 3HKCA 1W55A 1TUBA 1VQMF 3ZP7A 3MCAB 3LWPC 2NMUA 4O4JA 4ZHQB 4DXDA 3RYIB 2RHHA 4U3JB 4I4TA 3ZO8A 5LA6B 2UZHA 3FPIA 2RHJA 5GONB 5C8YB 3EORA 1FFXB
chains in the Genus database with same CATH topology
2DT4A 2NMUA 3HTNA 4BT7A 2P6YA 2H6LA 4BT3A 4BT2A 4BT6A 3HWUA 2HX0A 1XV2A 4BT5A 4BT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT4 A;  2NMU A;  3HTN A;  4BT7 A;  2P6Y A;  2H6L A;  4BT3 A;  4BT2 A;  4BT6 A;  3HWU A;  2HX0 A;  1XV2 A;  4BT5 A;  4BT4 A; 
#chains in the Genus database with same CATH topology
 3LWQ C;  1VQ8 F;  5MN5 A;  3RA6 A;  2B33 A;  3I3F A;  5IJ0 A;  3OW2 F;  3F0E A;  4X1I A;  1ODE A;  3CME F;  2HP0 B;  2L26 A;  3AGK A;  2FGY A;  3KHN A;  4O2A B;  3SIU A;  1SZQ A;  3HKE A;  3T80 A;  2VXY A;  1Z5V A;  1GO1 A;  5FLX M;  3CMA F;  3JAW B;  3E22 B;  2QEX F;  1SA0 B;  2JNB A;  2BTQ B;  4X3M A;  1K8A H;  1W40 A;  3N2G B;  1DT9 A;  2ZVZ A;  3KJK A;  5HP7 A;  5GIO C;  2CHS A;  3CG6 A;  4TUY A;  3TD4 A;  3BYQ A;  1JY8 A;  5IJ0 B;  3HJW C;  4C82 A;  4I55 B;  1U3P A;  3JAS A;  5LYJ A;  2HS4 A;  3WGL A;  2HX0 A;  1X7O A;  2AIF A;  4RQO A;  1QAH A;  3RYH A;  2DT4 A;  5EZY B;  2I6D A;  1YQN A;  3K14 A;  2CHT A;  2FC3 A;  2VGM A;  4NQ3 A;  3JVH A;  2N48 A;  1YJW F;  5EB0 A;  2UYN A;  5HY1 A;  4LCK A;  4BT3 A;  3WJR A;  4O4L A;  1YJ9 F;  1YIJ F;  1VQ5 F;  2V9Y A;  1NJI H;  5CB4 B;  4G4X A;  4I4T B;  3P0Z A;  3KJJ A;  3CCS F;  1S72 F;  1ZWZ A;  3N2K B;  4LNU B;  2VAW A;  4B5C A;  4HNA B;  1XV2 A;  4IHJ B;  3P4E A;  3JAS B;  1TVK A;  4U39 A;  3IMP A;  2IQQ A;  1TVK B;  3FD5 A;  4BT6 A;  2CVL A;  3WGJ A;  4ZHY B;  3I7T A;  2UYJ A;  5LP6 A;  5IJ9 B;  3HAX D;  1FNK A;  3KE1 A;  2GLZ A;  1W5F A;  3VOA A;  1RQ7 A;  2CZW A;  4C8I A;  4I50 B;  5JCO A;  3UT5 B;  1JFF A;  5FNV B;  3RYF B;  3I56 F;  3CCJ F;  3HKB A;  4BT5 A;  1FSZ A;  1NMU B;  3NK6 A;  4G4Z A;  3IEQ A;  1XRG A;  4O2A A;  3HWU A;  5IYZ B;  1JD1 A;  1W5A A;  3CC7 F;  3F0D A;  2UYK A;  1Q7Y H;  5EB1 B;  4DRX B;  1OAP A;  1Z5W A;  5JH7 A;  5BMV A;  3G4S F;  3TD3 A;  5LXT B;  5BMV B;  4I50 A;  3V3T A;  4G4W A;  4BW0 B;  3G6E F;  5CA1 B;  5CA1 A;  4PWT A;  3RYF A;  4WBN B;  4BVT A;  2VAM A;  2RHO A;  3D01 A;  4O4H B;  5GIP C;  3PLA C;  3CPW F;  3LYB A;  1FFX A;  1NQ3 A;  2H8C A;  4O4H A;  2EWC A;  2QI2 A;  3LFO A;  5GAN K;  2Q1Y A;  4IHJ A;  3K12 A;  3S0Y A;  5EIB D;  4C81 A;  1VQL F;  3VYT C;  4M8I A;  4BT2 A;  1IPA A;  1W57 A;  2BTU A;  2H8E A;  1YIT F;  1IV4 A;  3HKE B;  4ZOL B;  2PHN A;  3JAK B;  2Z1U A;  3S0W A;  3VOB A;  2UYP A;  3E20 B;  5EYP B;  5LOV A;  3C9R A;  3I55 F;  5A2Q M;  2HQS C;  1VQ7 F;  3JAL B;  4BT7 A;  5MN6 A;  2CSL A;  1VQN F;  3IKF A;  3UT5 A;  3GTZ A;  3L7Q A;  5C8Y A;  2CWJ A;  4C8G A;  4O4L B;  3M84 A;  4YJ2 A;  5G4U C;  4G4V A;  3RYI A;  3MBM A;  3B6N A;  5HY4 A;  1YGY A;  2OTJ F;  3WGK A;  5GAP K;  3WPW A;  1PXW A;  1PF5 A;  3NK7 A;  3HKB B;  2ZF8 A;  3ELC A;  4FFB A;  2AIZ P;  1H48 A;  2QA4 F;  3CPQ A;  5J2T B;  1J7H A;  5HP8 A;  5EWR A;  1Q86 H;  2KG4 A;  3C9S A;  1M1K H;  4BVQ A;  2HP3 A;  4ZOL A;  2DYY A;  2F9Z C;  3GHZ A;  1XHO A;  3M4S A;  2HVY D;  4G4Y A;  4TV8 A;  1X52 A;  3CB2 A;  3ZP4 A;  5GON A;  5CA0 B;  5HXU A;  1DBF A;  2HS3 A;  1T0K B;  4TUY B;  3JAR B;  3VCZ A;  5EIB C;  1N8R H;  3N4Y A;  1JFF B;  1W2B F;  1KD1 H;  3NMU C;  1OFU A;  2H6L A;  3VMF B;  1QVF F;  2VAP A;  4C4W C;  2ALE A;  3LWV C;  2Z1T A;  3N2K A;  4LNU A;  4R40 B;  2OZB A;  2LBT A;  4XCQ A;  2Z1F A;  4YJ3 B;  4RHA A;  1XBI A;  5HY0 A;  5ITZ B;  3WPX A;  4G88 A;  3VO8 A;  3CXC F;  1IV3 A;  1COM A;  3TD5 A;  1H7M A;  3ERN A;  4DRX A;  3J7A R;  3CD6 F;  4TV9 A;  4O4J B;  4ZHQ A;  5JVD A;  5IJ9 A;  1JN1 A;  1KNJ A;  1W42 A;  1X25 A;  5KMG A;  4YJ2 B;  2HS0 A;  4E6E A;  4NWO B;  3C8L A;  1TUB B;  3LWR C;  5HXZ A;  3N2G A;  5JCO C;  5LA6 A;  4ZI7 B;  3FBA A;  3MDO A;  3OBW A;  4IIJ A;  3F0F A;  2OTL F;  4C8E A;  4ZHV A;  4IIJ B;  3WGN A;  3CC2 F;  2GZL A;  1RLG A;  2RHL A;  4X1I B;  3VYU C;  3DC2 A;  3FD6 A;  3J80 M;  3CCM F;  5IT9 M;  5G4V C;  3CCE F;  1CK2 A;  1W41 A;  4X1K B;  3LDT A;  2UYN B;  1W59 A;  4EI9 A;  1RA4 A;  3CCV F;  2HRU A;  5DCV A;  1R1M A;  3JCM M;  5JQG A;  3M1X A;  4U3J A;  2KTU A;  3JAT A;  3F0G A;  4KWE A;  4F6R B;  2ZOD A;  3O85 A;  4ZK7 A;  3PAF A;  1KNK A;  1Q8R A;  3VI6 A;  2BTO A;  3S06 A;  5FNV A;  3RYC B;  1VQ9 F;  5B8F A;  3F6M A;  2AMT A;  3QTY A;  3RE3 A;  5HY2 A;  3V7E A;  4I55 A;  3G71 F;  3WXM B;  4X1Y A;  2Q1X A;  3D54 A;  1CN7 A;  3Q8H A;  1H47 A;  2CW4 A;  4X1Y B;  4X1K A;  3V4D A;  5J2T A;  4BVR A;  3JAK A;  3JAM M;  4O4I B;  3S02 A;  4YJ3 A;  2G9I A;  2VGN A;  1W5E A;  3HKD A;  4EB6 B;  3OBY A;  5HWE A;  3SIV A;  1SA0 A;  3ESJ A;  1QVG F;  1VQO F;  5LP6 B;  2KGW A;  3GYQ A;  1SDS A;  2LBX A;  1VQ4 F;  1U40 A;  4X20 A;  2LCA A;  4TV8 B;  4X20 B;  3K2X A;  3K0T A;  3RA5 A;  2Z1E A;  1K9M H;  1CLI A;  2PMP A;  4BT4 A;  1E7K A;  1VQV A;  1GX1 A;  3U0O A;  2HRY A;  4TZZ A;  1VK3 A;  5LYJ B;  3HKC B;  3S03 A;  4B45 A;  3S0H A;  3C9T A;  2ZOV A;  3CYQ A;  2MQE A;  5EZY A;  3E1Y A;  3E22 A;  2IAF A;  4EI8 A;  4EB6 A;  2ZAU A;  1T0A A;  5LXT A;  5JH7 B;  3HTN A;  3MCQ A;  2QTP A;  3QHD A;  3JAR A;  1GO0 A;  3ZOP A;  5KX5 A;  3WJQ A;  1YI2 F;  2I6R A;  3ON1 A;  1KC8 H;  2W8B C;  1UFY A;  3DDN A;  3KIZ A;  3VIU A;  4F6R A;  4ZI7 A;  5J2U B;  3CC4 F;  3V7Q A;  2BO1 A;  3C9U A;  5CB4 A;  2WAL A;  3RYC A;  3P10 A;  5AVM A;  3J81 M;  3RYH B;  2KTV A;  1VQP F;  3CCU F;  3IR9 A;  2YXZ A;  1Q82 H;  3NVK E;  2Z01 A;  2OTM A;  1W58 1;  2ZVY A;  3CCR F;  5KMG B;  1VQK F;  4ZHW A;  3R0P A;  2R6R 1;  3OON A;  5JVD B;  4O2B A;  3IKE A;  3JAT B;  5EO3 A;  5CA0 A;  1JJ2 F;  5FJ4 C;  1QD9 A;  4EI7 A;  2GVI A;  4FFB B;  3QUW A;  1QU9 A;  1RQ2 A;  2HP0 A;  3N4Z A;  1VHA A;  3FFM A;  1ONI A;  4O4I A;  3VYS C;  5GIN C;  2YYE A;  1RLU A;  1VQ6 F;  1YHQ F;  1IV2 A;  3JAL A;  1U3L A;  4TV9 B;  3JAW A;  5LP6 C;  1W5B A;  1K73 H;  3D00 A;  5EYP A;  5LOV B;  3NVI B;  3MQW A;  3HKD B;  1X7P A;  5EAZ A;  2IG8 A;  1Q81 H;  1FNJ A;  5JQG B;  3LME A;  4NUT A;  2K1S A;  4ERH A;  4WBN A;  4B46 A;  4O2B B;  1GZ0 A;  4X3L A;  3CYP B;  3WJP A;  1M90 H;  4BY9 D;  2R75 1;  1U43 A;  2P6Y A;  5KX5 B;  3IEW A;  2RB9 A;  1UI9 A;  3WGM A;  3VTI C;  5J2U A;  5ITZ A;  4B62 A;  4HNA A;  5MN4 A;  1IV1 A;  3CCQ F;  4BVS A;  1VH8 A;  3CCL F;  1KQS F;  5IYZ A;  2OHW A;  2LBW A;  3LWO C;  1W3E X;  1YJN F;  3HKC A;  1W55 A;  1TUB A;  1VQM F;  3ZP7 A;  3MCA B;  3LWP C;  2NMU A;  4O4J A;  4ZHQ B;  4DXD A;  3RYI B;  2RHH A;  4U3J B;  4I4T A;  3ZO8 A;  5LA6 B;  2UZH A;  3FPI A;  2RHJ A;  5GON B;  5C8Y B;  3EOR A;  1FFX B; 
#chains in the Genus database with same CATH homology
 2DT4 A;  2NMU A;  3HTN A;  4BT7 A;  2P6Y A;  2H6L A;  4BT3 A;  4BT2 A;  4BT6 A;  3HWU A;  2HX0 A;  1XV2 A;  4BT5 A;  4BT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...