2DT4A

Crystal structure of pyrococcus horikoshii a plant- and prokaryote-conserved (ppc) protein at 1.60 resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
143
structure length
143
Chain Sequence
MVTGMFSLGRTYLFRVPEGEELLTYIKNFCKKEGIETAIINGIGTLKNPKIGYFLEEKKEYKVIPLKGSYELISLIGNVSLKDGEPFVHAHVSLGNEEGIVFGGHLVEGEVFVAEIFLQELKGEKIERKPTKYGLALWEELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0802
publication title Crystal structure of Pyrococcus horikoshii PPC protein at 1.60 A resolution
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 27
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2dt4A00
1XV2A 4BT7A 2DT4A 3HTNA 2P6YA 4BT6A 4BT4A 4BT5A 4BT3A 3HWUA 4BT2A 2HX0A 2H6LA 2NMUA
chains in the Genus database with same CATH superfamily
3E1YA 3RYCA 5JVDA 1VHAA 3WGNA 4ZHQA 3F6MA 4G4VA 3CCMF 1YQNA 1VQNF 5J2TA 3MBMA 2CHTA 5HP8A 1VQ9F 2UZHA 3C9TA 2ZVYA 2MQEA 5BMVA 3CCEF 5EZYA 5GANK 3VOBA 3PAFA 4I55B 3UT5A 3K14A 1JN1A 5IJ0A 3RYFA 2HP0B 5JQGB 4YJ2B 1VQOF 3BYQA 3CYPB 1U3PA 5LP6A 2VAPA 2OTLF 5GIPC 3JAWA 4BT6A 1ZWZA 2LBXA 5A2QM 2DYYA 1W581 3OW2F 5HY1A 1GO1A 2H8CA 2UYNA 3IEWA 3MDOA 1XHOA 3FBAA 3WGJA 5FNVA 3CCJF 2W8BC 3ON1A 3B6NA 3HKDB 4YJ3B 1IV2A 1Q7YH 2B33A 2CZWA 4ZOLA 4ZHVA 3LYBA 1FFXB 2EWCA 2VXYA 3P10A 4I55A 4U3JA 3EORA 3VCZA 1W5FA 2HP0A 1TUBA 5JQGA 3T80A 4YJ2A 3VYTC 4DXDA 2Z01A 1TVKA 3CYQA 4X3MA 1GZ0A 1RLGA 3WJRA 5IT9M 4M8IA 3NK6A 4IHJB 3ELCA 3HKBB 4G4ZA 4NQ3A 3DC2A 2HX0A 4BT2A 2ZOVA 3N4YA 1RQ7A 4TV9A 5JCOA 3RA6A 3LWRC 3QTYA 2WALA 3LFOA 2G9IA 3F0FA 3CCLF 4R40B 2HRYA 4BT4A 4O4HA 2CVLA 2V9YA 1H48A 3D00A 4O4JA 1N8RH 3MQWA 5LYJB 1FFXA 3IEQA 3G6EF 1VQPF 4C8IA 2AIZP 1RLUA 1IV3A 3WGKA 3D01A 1M1KH 4TUYB 4DRXB 3OONA 5CA0B 1GX1A 1JFFB 5IYZB 3JVHA 5GINC 1FNKA 1QVGF 3GYQA 4BT7A 4BVQA 1KNJA 4X1YA 3NMUC 3RYCB 4ZHYB 3HKEA 4O2AA 3CXCF 3WGMA 1VQ6F 3CPQA 3KIZA 5J2TB 3N4ZA 3D54A 3FFMA 3P0ZA 5BMVB 5LYJA 2ZF8A 5EZYB 4BVRA 3HWUA 3O85A 2HQSC 5IJ0B 2CW4A 3LWPC 3RYFB 4NWOB 2JNBA 4G88A 1T0AA 4LNUA 5C8YA 4XCQA 4EI8A 5IYZA 3JAWB 4BT5A 1Q82H 3S0WA 1K8AH 3HTNA 5DCVA 3I7TA 1SZQA 2GLZA 5KX5A 4BVSA 1VQMF 3QUWA 4X20B 3VOAA 1K73H 1IV1A 2HS4A 2UYNB 5FNVB 5AVMA 2OZBA 2UYKA 3IMPA 1NMUB 3IKEA 4ZOLB 2KGWA 1XRGA 3M4SA 2HS3A 2GVIA 4U3JB 5LXTA 3N2KA 3VYUC 3E20B 3K2XA 1TUBB 3QHDA 2HP3A 2N48A 3JAKA 3CCSF 1TVKB 4RQOA 3CC7F 4ZK7A 5HXZA 1KD1H 2NMUA 3S0HA 2ZAUA 2RHOA 2KG4A 2UYJA 4TV9B 4X20A 1W5AA 3G71F 5HXUA 5CA1A 4O4HB 4O4JB 3G4SF 3M84A 2BTQB 1W2BF 3HKCA 4WBNA 1IPAA 3J7AR 5G4VC 4B46A 3J81M 3OBYA 4E6EA 3CMAF 1QVFF 1W41A 2R751 3WJPA 1Z5WA 1X52A 5FJ4C 4C82A 5KMGB 2PMPA 1X25A 2BO1A 3NVKE 3VMFB 1K9MH 2Q1YA 3WJQA 4X1YB 5EB1B 3WPWA 3KJJA 2QA4F 4PWTA 3HKEB 4ERHA 4O2AB 1YITF 1YIJF 2H8EA 3KJKA 3K12A 4BT3A 2Z1TA 4G4XA 5EYPA 1DT9A 1NQ3A 2BTUA 3K0TA 1S72F 4ZI7B 3CPWF 3JASB 3RA5A 1JD1A 1X7OA 1X7PA 1U3LA 4FFBB 4C8GA 1U40A 1RA4A 3RE3A 5CB4A 3C9SA 5EIBC 1YJWF 2BTOA 4LCKA 1W59A 4LNUB 3VTIC 5C8YB 4X1KA 3ZP4A 5KMGA 4TV8A 3FPIA 4O2BA 1IV4A 5ITZA 1VQ8F 1CK2A 1COMA 2RHJA 3MCQA 3ZOPA 4I50B 3Q8HA 5HY2A 5KX5B 1OAPA 5EB0A 3E22A 2Z1EA 4RHAA 1YHQF 3LDTA 3M1XA 2LCAA 1W40A 3HJWC 3OBWA 2ZODA 3MCAB 4ZI7A 1UFYA 3FD6A 3JASA 3JALA 5LA6A 2QTPA 2VGMA 1Z5VA 2KTVA 5J2UA 4C4WC 4FFBA 3PLAC 1U43A 2RHLA 5LXTB 3N2KB 1Q86H 3F0DA 3NVIB 3JAMM 3V7QA 3JAKB 5B8FA 3CCRF 3CCUF 5LOVB 3VIUA 4C8EA 2HRUA 3HAXD 3JARA 4G4WA 1FSZA 3DDNA 4I50A 3LWQC 1E7KA 1H7MA 1SA0A 1W55A 2QI2A 2HS0A 1YJ9F 3KHNA 1UI9A 1ONIA 1Q81H 1NJIH 1FNJA 5CA1B 3AGKA 4G4YA 4O4IB 1VH8A 4HNAA 2AIFA 3RYHB 5JH7A 3I55F 3WXMB 3HKCB 4WBNB 3SIVA 3VYSC 2IQQA 3C9UA 2UYPA 3ESJA 4F6RA 1VQ7F 4KWEA 4NUTA 3R0PA 1W57A 1W5EA 3F0EA 1T0KB 1QU9A 5LOVA 3L7QA 4U39A 3JATA 2CSLA 1PF5A 3F0GA 5GONA 3V3TA 4B5CA 1W42A 3TD3A 3KE1A 5MN4A 4B45A 2YYEA 2PHNA 2OTMA 3CMEF 5EYPB 2FC3A 2H6LA 1XV2A 3RYIA 1W3EX 4O4IA 1VQVA 3RYHA 3WPXA 2I6RA 3U0OA 2VGNA 4O4LA 3CB2A 5IJ9A 3C9RA 5CB4B 4IIJB 5LP6C 1KNKA 5EIBD 2IAFA 4X1KB 4X3LA 2I6DA 1VQ5F 3GHZA 2RHHA 4TV8B 4BY9D 4O2BB 5ITZB 3CC4F 1SDSA 4TZZA 1CN7A 3ZP7A 3S02A 4I4TB 2P6YA 3LWOC 3CC2F 5MN6A 1YJNF 1YI2F 1VQKF 3E22B 4BW0B 2K1SA 2KTUA 1RQ2A 3VO8A 2QEXF 3CCQF 2ZVZA 3IR9A 2LBWA 5GIOC 3J80M 2VAMA 3JALB 2GZLA 5LA6B 2CHSA 2VAWA 4X1IB 5J2UB 5GAPK 4IIJA 1Q8RA 2Z1FA 3TD4A 3VI6A 3SIUA 5FLXM 1VQLF 5HP7A 2AMTA 3N2GB 1YGYA 1QAHA 3GTZA 3NK7A 5JCOC 1DBFA 2F9ZC 3HKDA 3CG6A 4YJ3A 2FGYA 3JARB 4I4TA 1CLIA 3S06A 1H47A 2CWJA 1SA0B 4EI9A 5G4UC 1XBIA 2OHWA 2IG8A 1KQSF 4EB6B 3S0YA 1VK3A 1GO0A 4HNAB 2HVYD 1M90H 5JH7B 3JCMM 3I3FA 4IHJA 3S03A 4X1IA 2Q1XA 3HKBA 2OTJF 3I56F 1PXWA 4F6RB 4BVTA 3P4EA 2Z1UA 1ODEA 3ERNA 5JVDB 3N2GA 4ZHQB 2L26A 4B62A 1QD9A 3JATB 4ZHWA 5EAZA 3ZO8A 5GONB 3V4DA 1JY8A 2DT4A 2LBTA 5HWEA 3TD5A 1JJ2F 2R6R1 3WGLA 1R1MA 3UT5B 3CD6F 3IKFA 5HY4A 3RYIB 4EB6A 3CCVF 2ALEA 3LMEA 2YXZA 4C81A 1VQ4F 1KC8H 5MN5A 4TUYA 4DRXA 5CA0A 5LP6B 4O4LB 1W5BA 3LWVC 1JFFA 5HY0A 5IJ9B 1OFUA 5EWRA 1J7HA 3V7EA 3C8LA 3FD5A 4EI7A 2RB9A 5EO3A
chains in the Genus database with same CATH topology
1XV2A 4BT7A 2DT4A 3HTNA 2P6YA 4BT6A 4BT4A 4BT5A 4BT3A 3HWUA 4BT2A 2HX0A 2H6LA 2NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XV2 A;  4BT7 A;  2DT4 A;  3HTN A;  2P6Y A;  4BT6 A;  4BT4 A;  4BT5 A;  4BT3 A;  3HWU A;  4BT2 A;  2HX0 A;  2H6L A;  2NMU A; 
#chains in the Genus database with same CATH topology
 3E1Y A;  3RYC A;  5JVD A;  1VHA A;  3WGN A;  4ZHQ A;  3F6M A;  4G4V A;  3CCM F;  1YQN A;  1VQN F;  5J2T A;  3MBM A;  2CHT A;  5HP8 A;  1VQ9 F;  2UZH A;  3C9T A;  2ZVY A;  2MQE A;  5BMV A;  3CCE F;  5EZY A;  5GAN K;  3VOB A;  3PAF A;  4I55 B;  3UT5 A;  3K14 A;  1JN1 A;  5IJ0 A;  3RYF A;  2HP0 B;  5JQG B;  4YJ2 B;  1VQO F;  3BYQ A;  3CYP B;  1U3P A;  5LP6 A;  2VAP A;  2OTL F;  5GIP C;  3JAW A;  4BT6 A;  1ZWZ A;  2LBX A;  5A2Q M;  2DYY A;  1W58 1;  3OW2 F;  5HY1 A;  1GO1 A;  2H8C A;  2UYN A;  3IEW A;  3MDO A;  1XHO A;  3FBA A;  3WGJ A;  5FNV A;  3CCJ F;  2W8B C;  3ON1 A;  3B6N A;  3HKD B;  4YJ3 B;  1IV2 A;  1Q7Y H;  2B33 A;  2CZW A;  4ZOL A;  4ZHV A;  3LYB A;  1FFX B;  2EWC A;  2VXY A;  3P10 A;  4I55 A;  4U3J A;  3EOR A;  3VCZ A;  1W5F A;  2HP0 A;  1TUB A;  5JQG A;  3T80 A;  4YJ2 A;  3VYT C;  4DXD A;  2Z01 A;  1TVK A;  3CYQ A;  4X3M A;  1GZ0 A;  1RLG A;  3WJR A;  5IT9 M;  4M8I A;  3NK6 A;  4IHJ B;  3ELC A;  3HKB B;  4G4Z A;  4NQ3 A;  3DC2 A;  2HX0 A;  4BT2 A;  2ZOV A;  3N4Y A;  1RQ7 A;  4TV9 A;  5JCO A;  3RA6 A;  3LWR C;  3QTY A;  2WAL A;  3LFO A;  2G9I A;  3F0F A;  3CCL F;  4R40 B;  2HRY A;  4BT4 A;  4O4H A;  2CVL A;  2V9Y A;  1H48 A;  3D00 A;  4O4J A;  1N8R H;  3MQW A;  5LYJ B;  1FFX A;  3IEQ A;  3G6E F;  1VQP F;  4C8I A;  2AIZ P;  1RLU A;  1IV3 A;  3WGK A;  3D01 A;  1M1K H;  4TUY B;  4DRX B;  3OON A;  5CA0 B;  1GX1 A;  1JFF B;  5IYZ B;  3JVH A;  5GIN C;  1FNK A;  1QVG F;  3GYQ A;  4BT7 A;  4BVQ A;  1KNJ A;  4X1Y A;  3NMU C;  3RYC B;  4ZHY B;  3HKE A;  4O2A A;  3CXC F;  3WGM A;  1VQ6 F;  3CPQ A;  3KIZ A;  5J2T B;  3N4Z A;  3D54 A;  3FFM A;  3P0Z A;  5BMV B;  5LYJ A;  2ZF8 A;  5EZY B;  4BVR A;  3HWU A;  3O85 A;  2HQS C;  5IJ0 B;  2CW4 A;  3LWP C;  3RYF B;  4NWO B;  2JNB A;  4G88 A;  1T0A A;  4LNU A;  5C8Y A;  4XCQ A;  4EI8 A;  5IYZ A;  3JAW B;  4BT5 A;  1Q82 H;  3S0W A;  1K8A H;  3HTN A;  5DCV A;  3I7T A;  1SZQ A;  2GLZ A;  5KX5 A;  4BVS A;  1VQM F;  3QUW A;  4X20 B;  3VOA A;  1K73 H;  1IV1 A;  2HS4 A;  2UYN B;  5FNV B;  5AVM A;  2OZB A;  2UYK A;  3IMP A;  1NMU B;  3IKE A;  4ZOL B;  2KGW A;  1XRG A;  3M4S A;  2HS3 A;  2GVI A;  4U3J B;  5LXT A;  3N2K A;  3VYU C;  3E20 B;  3K2X A;  1TUB B;  3QHD A;  2HP3 A;  2N48 A;  3JAK A;  3CCS F;  1TVK B;  4RQO A;  3CC7 F;  4ZK7 A;  5HXZ A;  1KD1 H;  2NMU A;  3S0H A;  2ZAU A;  2RHO A;  2KG4 A;  2UYJ A;  4TV9 B;  4X20 A;  1W5A A;  3G71 F;  5HXU A;  5CA1 A;  4O4H B;  4O4J B;  3G4S F;  3M84 A;  2BTQ B;  1W2B F;  3HKC A;  4WBN A;  1IPA A;  3J7A R;  5G4V C;  4B46 A;  3J81 M;  3OBY A;  4E6E A;  3CMA F;  1QVF F;  1W41 A;  2R75 1;  3WJP A;  1Z5W A;  1X52 A;  5FJ4 C;  4C82 A;  5KMG B;  2PMP A;  1X25 A;  2BO1 A;  3NVK E;  3VMF B;  1K9M H;  2Q1Y A;  3WJQ A;  4X1Y B;  5EB1 B;  3WPW A;  3KJJ A;  2QA4 F;  4PWT A;  3HKE B;  4ERH A;  4O2A B;  1YIT F;  1YIJ F;  2H8E A;  3KJK A;  3K12 A;  4BT3 A;  2Z1T A;  4G4X A;  5EYP A;  1DT9 A;  1NQ3 A;  2BTU A;  3K0T A;  1S72 F;  4ZI7 B;  3CPW F;  3JAS B;  3RA5 A;  1JD1 A;  1X7O A;  1X7P A;  1U3L A;  4FFB B;  4C8G A;  1U40 A;  1RA4 A;  3RE3 A;  5CB4 A;  3C9S A;  5EIB C;  1YJW F;  2BTO A;  4LCK A;  1W59 A;  4LNU B;  3VTI C;  5C8Y B;  4X1K A;  3ZP4 A;  5KMG A;  4TV8 A;  3FPI A;  4O2B A;  1IV4 A;  5ITZ A;  1VQ8 F;  1CK2 A;  1COM A;  2RHJ A;  3MCQ A;  3ZOP A;  4I50 B;  3Q8H A;  5HY2 A;  5KX5 B;  1OAP A;  5EB0 A;  3E22 A;  2Z1E A;  4RHA A;  1YHQ F;  3LDT A;  3M1X A;  2LCA A;  1W40 A;  3HJW C;  3OBW A;  2ZOD A;  3MCA B;  4ZI7 A;  1UFY A;  3FD6 A;  3JAS A;  3JAL A;  5LA6 A;  2QTP A;  2VGM A;  1Z5V A;  2KTV A;  5J2U A;  4C4W C;  4FFB A;  3PLA C;  1U43 A;  2RHL A;  5LXT B;  3N2K B;  1Q86 H;  3F0D A;  3NVI B;  3JAM M;  3V7Q A;  3JAK B;  5B8F A;  3CCR F;  3CCU F;  5LOV B;  3VIU A;  4C8E A;  2HRU A;  3HAX D;  3JAR A;  4G4W A;  1FSZ A;  3DDN A;  4I50 A;  3LWQ C;  1E7K A;  1H7M A;  1SA0 A;  1W55 A;  2QI2 A;  2HS0 A;  1YJ9 F;  3KHN A;  1UI9 A;  1ONI A;  1Q81 H;  1NJI H;  1FNJ A;  5CA1 B;  3AGK A;  4G4Y A;  4O4I B;  1VH8 A;  4HNA A;  2AIF A;  3RYH B;  5JH7 A;  3I55 F;  3WXM B;  3HKC B;  4WBN B;  3SIV A;  3VYS C;  2IQQ A;  3C9U A;  2UYP A;  3ESJ A;  4F6R A;  1VQ7 F;  4KWE A;  4NUT A;  3R0P A;  1W57 A;  1W5E A;  3F0E A;  1T0K B;  1QU9 A;  5LOV A;  3L7Q A;  4U39 A;  3JAT A;  2CSL A;  1PF5 A;  3F0G A;  5GON A;  3V3T A;  4B5C A;  1W42 A;  3TD3 A;  3KE1 A;  5MN4 A;  4B45 A;  2YYE A;  2PHN A;  2OTM A;  3CME F;  5EYP B;  2FC3 A;  2H6L A;  1XV2 A;  3RYI A;  1W3E X;  4O4I A;  1VQV A;  3RYH A;  3WPX A;  2I6R A;  3U0O A;  2VGN A;  4O4L A;  3CB2 A;  5IJ9 A;  3C9R A;  5CB4 B;  4IIJ B;  5LP6 C;  1KNK A;  5EIB D;  2IAF A;  4X1K B;  4X3L A;  2I6D A;  1VQ5 F;  3GHZ A;  2RHH A;  4TV8 B;  4BY9 D;  4O2B B;  5ITZ B;  3CC4 F;  1SDS A;  4TZZ A;  1CN7 A;  3ZP7 A;  3S02 A;  4I4T B;  2P6Y A;  3LWO C;  3CC2 F;  5MN6 A;  1YJN F;  1YI2 F;  1VQK F;  3E22 B;  4BW0 B;  2K1S A;  2KTU A;  1RQ2 A;  3VO8 A;  2QEX F;  3CCQ F;  2ZVZ A;  3IR9 A;  2LBW A;  5GIO C;  3J80 M;  2VAM A;  3JAL B;  2GZL A;  5LA6 B;  2CHS A;  2VAW A;  4X1I B;  5J2U B;  5GAP K;  4IIJ A;  1Q8R A;  2Z1F A;  3TD4 A;  3VI6 A;  3SIU A;  5FLX M;  1VQL F;  5HP7 A;  2AMT A;  3N2G B;  1YGY A;  1QAH A;  3GTZ A;  3NK7 A;  5JCO C;  1DBF A;  2F9Z C;  3HKD A;  3CG6 A;  4YJ3 A;  2FGY A;  3JAR B;  4I4T A;  1CLI A;  3S06 A;  1H47 A;  2CWJ A;  1SA0 B;  4EI9 A;  5G4U C;  1XBI A;  2OHW A;  2IG8 A;  1KQS F;  4EB6 B;  3S0Y A;  1VK3 A;  1GO0 A;  4HNA B;  2HVY D;  1M90 H;  5JH7 B;  3JCM M;  3I3F A;  4IHJ A;  3S03 A;  4X1I A;  2Q1X A;  3HKB A;  2OTJ F;  3I56 F;  1PXW A;  4F6R B;  4BVT A;  3P4E A;  2Z1U A;  1ODE A;  3ERN A;  5JVD B;  3N2G A;  4ZHQ B;  2L26 A;  4B62 A;  1QD9 A;  3JAT B;  4ZHW A;  5EAZ A;  3ZO8 A;  5GON B;  3V4D A;  1JY8 A;  2DT4 A;  2LBT A;  5HWE A;  3TD5 A;  1JJ2 F;  2R6R 1;  3WGL A;  1R1M A;  3UT5 B;  3CD6 F;  3IKF A;  5HY4 A;  3RYI B;  4EB6 A;  3CCV F;  2ALE A;  3LME A;  2YXZ A;  4C81 A;  1VQ4 F;  1KC8 H;  5MN5 A;  4TUY A;  4DRX A;  5CA0 A;  5LP6 B;  4O4L B;  1W5B A;  3LWV C;  1JFF A;  5HY0 A;  5IJ9 B;  1OFU A;  5EWR A;  1J7H A;  3V7E A;  3C8L A;  3FD5 A;  4EI7 A;  2RB9 A;  5EO3 A; 
#chains in the Genus database with same CATH homology
 1XV2 A;  4BT7 A;  2DT4 A;  3HTN A;  2P6Y A;  4BT6 A;  4BT4 A;  4BT5 A;  4BT3 A;  3HWU A;  4BT2 A;  2HX0 A;  2H6L A;  2NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...