1YJWF

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yjwF00
1W41A 3I56F 1VQNF 3CCJF 3CCUF 5GANK 2KTUA 1YJWF 1GO0A 1YHQF 2BO1A 3LWOC 4C4WC 2CZWA 3OBWA 3AGKA 3G6EF 1M90H 1H7MA 1VQPF 1NJIH 1ZWZA 2KG4A 2LBXA 3CCMF 5GAPK 3E1YA 3PLAC 3ON1A 1GO1A 3SIUA 2KTVA 1T0KB 3LFOA 2OTLF 1IPAA 3FFMA 3N4YA 3CCRF 4NUTA 5GINC 5EWRA 3J81M 5GIPC 3CC7F 3CG6A 3N4ZA 3OBYA 1W40A 1YIJF 5FLXM 3CD6F 5GIOC 1VQ4F 2ALEA 1RLGA 3HJWC 3CPWF 3CC4F 5EO3A 2LBWA 3LWRC 2QI2A 3CCLF 2I6DA 1X52A 3PAFA 3JCMM 1W42A 5DCVA 3CC2F 3CMAF 1RA4A 3G71F 3WXMB 2VGMA 1VQMF 1W2BF 3LWQC 1KD1H 1E7KA 3JAMM 3CXCF 1VQOF 4BY9D 3LWPC 1QVGF 1YITF 3CPQA 3HAXD 1KQSF 2OZBA 2WALA 3RA6A 1CN7A 3G4SF 2OTJF 1M1KH 1VQ7F 3CMEF 3VI6A 1DT9A 2VGNA 2AIFA 1K8AH 3NMUC 3NK7A 3E20B 1S72F 1Q86H 3MCAB 1XBIA 1K73H 5IT9M 3J80M 3LWVC 1VQ9F 1YJNF 3RA5A 3OW2F 5G4VC 1SDSA 5G4UC 3IR9A 5FJ4C 3CCEF 2QA4F 3VMFB 1VQLF 1Q7YH 5A2QM 1NMUB 4LCKA 1YI2F 1X7OA 1GZ0A 4X3MA 3SIVA 4X3LA 1K9MH 3V7QA 1N8RH 3CCVF 1QVFF 1X7PA 1Q81H 3NVKE 2HVYD 2FC3A 3NK6A 1YJ9F 3CCSF 4BW0B 4TZZA 3I55F 2QEXF 1VQ5F 1VQ6F 2OHWA 3O85A 3V7EA 1VQ8F 1W3EX 3CCQF 1JJ2F 2JNBA 1PXWA 3GYQA 1VQKF 3NVIB 1Q82H 1KC8H 3J7AR 1CK2A
chains in the Genus database with same CATH superfamily
4O4LB 3I56F 4X1IA 3CYPB 3UT5B 3CCJF 3CCUF 2LCAA 2BO1A 1QD9A 3RE3A 4LNUB 4RHAA 3IMPA 5LXTA 2Z01A 1ZWZA 2HS3A 3RYHA 3VYSC 3S03A 2N48A 3EORA 4I4TB 1GO1A 4KWEA 3SIUA 1W5EA 4ZHQA 5IYZA 1T0KB 3VOBA 2CHTA 3FFMA 1X25A 3F0GA 3JASA 4NUTA 5EWRA 4X1KB 4YJ2A 3M1XA 2ALEA 2GLZA 5LA6B 5EYPA 2QI2A 3LWRC 3V3TA 3R0PA 3FPIA 4BT5A 5DCVA 1JN1A 2UZHA 4R40B 3G71F 2HRUA 3MCQA 1W2BF 4EB6B 3LWQC 1KD1H 3JAMM 4I55A 1TVKA 4TV9A 3LWPC 1QVGF 1YITF 3HAXD 3FD5A 2OZBA 2WALA 3HKBB 1M1KH 1VQ7F 2VGNA 2CW4A 4ZHWA 3E20B 1TUBA 5CA0A 1U3LA 3QUWA 4O2AB 3RYFB 2RB9A 5EZYA 2R6R1 2YXZA 1VQ9F 1YJNF 1SA0A 3RA5A 3OW2F 2UYKA 3VYTC 1JFFB 4X1KA 2HP3A 5FJ4C 4HNAB 1PF5A 3VMFB 1VQLF 3MQWA 5A2QM 1JY8A 4LCKA 1X7OA 1GZ0A 3KHNA 1ODEA 1K9MH 4ZOLA 1IV3A 3JARA 2K1SA 2RHHA 1Q81H 1VHAA 4O4IB 3WGJA 4FFBA 1YJ9F 1W55A 3JAKA 1UI9A 3MBMA 4I55B 1VQ5F 2OHWA 3O85A 4TV9B 3V7EA 4BVRA 4O4JB 3LYBA 5JH7B 5FNVB 2V9YA 4I4TA 4U3JB 1VQKF 4BVTA 3JASB 5IJ9B 3E22A 3KE1A 4U39A 2CSLA 5HY4A 1CK2A 3V4DA 4YJ2B 1RQ7A 5J2TA 1VQNF 5HY1A 1GO0A 1U3PA 4TV8B 4C4WC 3AGKA 3G6EF 1H7MA 4B46A 5BMVA 5HP8A 2LBXA 1Z5VA 3CCMF 3E1YA 3LDTA 1YQNA 4WBNA 5LP6C 5MN5A 2PMPA 2CVLA 3KJKA 3N4YA 5LP6B 3TD4A 3J81M 4EB6A 2Z1UA 3P0ZA 1YIJF 1W40A 2MQEA 3OBYA 3TD3A 3RYCA 3CD6F 3HKCB 5GIOC 2RHOA 3P10A 3CPWF 2UYNB 3B6NA 2R751 5ITZA 5KMGA 1X52A 3JCMM 1JFFA 3CC2F 2LBTA 4BT3A 1RA4A 3CMAF 3WXMB 2ZVZA 3VTIC 4X1YB 4BVSA 5GONB 2GVIA 1KNKA 4BVQA 5IJ0A 3CXCF 5JCOA 1VQOF 4ZOLB 2OTJF 4X20A 4IIJB 3WGLA 2ZF8A 3VI6A 1OAPA 4M8IA 3MDOA 5J2UB 3NMUC 2IAFA 4BT4A 1TVKB 5CB4B 4BT2A 3JAKB 4C81A 4C8GA 4ZHYB 1XBIA 3ZP4A 1K73H 1VK3A 5EIBC 4B5CA 4F6RA 4IHJA 1IV4A 5FNVA 2HS0A 1SDSA 5G4VC 2P6YA 3IR9A 2G9IA 3E22B 4ZI7A 2UYPA 2QTPA 1TUBB 4G4VA 4G88A 5EZYB 4EI7A 2HX0A 1NMUB 3K2XA 3SIVA 2UYNA 4X3LA 3V7QA 1FFXB 5B8FA 1QVFF 3CCVF 3NVKE 1U40A 3I7TA 5HWEA 2HVYD 2BTQB 3N2GB 4PWTA 5LXTB 2Z1EA 3HKEA 3I55F 3JARB 1VQ6F 1Q8RA 1OFUA 3K0TA 3U0OA 2CWJA 4WBNB 4ZHQB 4TUYA 3JAWB 4B62A 5AVMA 1COMA 1QU9A 1Q82H 1IV1A 1GX1A 3D00A 3WPXA 3ZOPA 3WJQA 5JH7A 3K12A 3WGNA 1XHOA 3F0EA 3JVHA 4ZK7A 1M90H 3WGMA 2NMUA 3WPWA 4U3JA 4ERHA 1NJIH 1FSZA 5EYPB 5KMGB 5KX5B 3C9UA 5EAZA 5GONA 3CB2A 3PLAC 3ON1A 4O4HA 5JVDB 2FGYA 2OTLF 2F9ZC 5LYJB 4G4ZA 4BT6A 3ELCA 4O2BA 2AIZP 5GINC 1W581 2GZLA 5J2UA 3VOAA 4X1IB 2HP0A 3HKBA 3HTNA 1FNJA 3GTZA 2ZOVA 1FNKA 3RYIA 1RLGA 3T80A 4F6RB 3HJWC 2BTOA 2HRYA 5EO3A 2LBWA 3ERNA 3CCLF 2I6DA 3M4SA 4ZHVA 4I50A 3L7QA 3VIUA 5CB4A 1W57A 3LMEA 3HKCA 3IEWA 2VGMA 4EI9A 5ITZB 3N2KA 3HWUA 1RLUA 5C8YB 4ZI7B 4X1YA 3G4SF 2B33A 2VAPA 1DT9A 4RQOA 2AIFA 1K8AH 3NK7A 5CA1A 1U43A 5IJ0B 1S72F 1Q86H 3MCAB 3ESJA 5IT9M 3J80M 2KGWA 3S02A 3LWVC 3WGKA 3HKDA 1VQVA 2IG8A 4IIJA 5G4UC 2HP0B 4IHJB 4E6EA 3CCEF 2VAWA 3IKFA 2W8BC 1R1MA 4B45A 1Q7YH 4TUYB 5HY2A 1YI2F 1XV2A 4DRXA 3FD6A 2UYJA 5J2TB 3QHDA 1NQ3A 5IYZB 2ZODA 1N8RH 1X7PA 1KNJA 3DC2A 5EB1B 3JATA 3S0YA 3JALA 3CCSF 2RHLA 3VCZA 5HP7A 1H48A 4O4HB 2H6LA 4C8EA 5JVDA 5LYJA 1W3EX 3UT5A 5C8YA 3CCQF 3DDNA 2HQSC 3NVIB 4O2BB 5LP6A 1KC8H 3J7AR 3RYHB 1XRGA 3VYUC 3JAWA 1W41A 2RHJA 3KIZA 4YJ3B 5GANK 1W5BA 2KTUA 1YJWF 1YHQF 3LWOC 3IKEA 2CZWA 2CHSA 3OBWA 3QTYA 4I50B 1VQPF 2ZAUA 1VH8A 2KG4A 3RYIB 1J7HA 5GAPK 2VXYA 3F0FA 2DT4A 5HXZA 3C8LA 2KTVA 1FFXA 4G4WA 3LFOA 3VO8A 2AMTA 3GHZA 3D01A 1IPAA 1JD1A 4O2AA 3RYFA 5IJ9A 3CCRF 5KX5A 2IQQA 2Q1YA 2EWCA 5GIPC 3HKEB 3P4EA 3CC7F 3CG6A 3N4ZA 2Q1XA 2PHNA 2DYYA 5FLXM 5JCOC 4X20B 4TV8A 1H47A 1VQ4F 3BYQA 4O4LA 3S06A 4HNAA 3CC4F 3D54A 4BT7A 4LNUA 4C8IA 5BMVB 4DXDA 4G4YA 1DBFA 1ONIA 4C82A 3PAFA 4G4XA 1W42A 2HS4A 3CYQA 5EIBD 5LOVB 3S0HA 3ZP7A 1CLIA 1W5FA 1VQMF 5MN6A 2YYEA 1E7KA 2I6RA 3FBAA 4FFBB 2H8CA 1QAHA 5MN4A 2L26A 2ZVYA 4BY9D 3Q8HA 3CPQA 3WJRA 1W5AA 1KQSF 5JQGA 3RA6A 1CN7A 5CA0B 4O4JA 3JATB 3RYCB 5HY0A 3CMEF 1SA0B 3C9TA 1YGYA 3JALB 3K14A 3N2GA 5CA1B 3F6MA 1UFYA 3KJJA 2BTUA 4NQ3A 2VAMA 2Z1TA 5EB0A 2QA4F 3HKDB 3I3FA 3WJPA 5HXUA 4O4IA 3ZO8A 4X3MA 3C9SA 4YJ3A 1RQ2A 1SZQA 3S0WA 3OONA 5LOVA 3TD5A 2FC3A 3NK6A 2H8EA 4NWOB 2OTMA 4BW0B 4TZZA 3M84A 3N2KB 2Z1FA 5LA6A 2QEXF 3IEQA 4DRXB 4XCQA 1VQ8F 3F0DA 3C9RA 4EI8A 1Z5WA 1JJ2F 2JNBA 5JQGB 1T0AA 1IV2A 1PXWA 3GYQA 1W59A
chains in the Genus database with same CATH topology
1W41A 3I56F 1VQNF 3CCJF 3CCUF 5HY1A 5GANK 2KTUA 1YJWF 1GO0A 1YHQF 2BO1A 3LWOC 4C4WC 2CZWA 3OBWA 3AGKA 3G6EF 1M90H 1H7MA 1VQPF 1NJIH 1ZWZA 2KG4A 2LBXA 3CCMF 5GAPK 3E1YA 3PLAC 3ON1A 5HXZA 1GO1A 3SIUA 2KTVA 1T0KB 2FGYA 3LFOA 2OTLF 2F9ZC 1IPAA 3FFMA 3N4YA 3CCRF 4NUTA 5GINC 5EWRA 3J81M 5GIPC 3CC7F 3CG6A 3N4ZA 3OBYA 1W40A 1YIJF 5FLXM 3CD6F 5GIOC 1VQ4F 2ALEA 2GLZA 1RLGA 3HJWC 3CPWF 3CC4F 5EO3A 2LBWA 2QI2A 3LWRC 3CCLF 3V3TA 2I6DA 1X52A 3PAFA 3JCMM 1W42A 5DCVA 3CC2F 3CMAF 1RA4A 3G71F 3WXMB 2VGMA 1VQMF 1W2BF 3LWQC 4BVSA 4EI9A 1KD1H 1E7KA 3JAMM 4BVQA 3CXCF 1VQOF 4BY9D 3LWPC 1QVGF 1YITF 3CPQA 3HAXD 1KQSF 2OZBA 2WALA 3RA6A 1CN7A 3G4SF 2OTJF 1M1KH 5HY0A 3CMEF 1VQ7F 3VI6A 1DT9A 2VGNA 2AIFA 1K8AH 3NMUC 3NK7A 3E20B 1S72F 1Q86H 3MCAB 1XBIA 1K73H 5IT9M 3J80M 3LWVC 1VQ9F 1YJNF 3RA5A 3OW2F 5G4VC 1SDSA 4NQ3A 5G4UC 3IR9A 5FJ4C 3CCEF 2QA4F 4EI7A 3VMFB 1VQLF 1Q7YH 5HY2A 5A2QM 1NMUB 5HXUA 4LCKA 1YI2F 1X7OA 1GZ0A 4X3MA 3SIVA 4X3LA 1K9MH 3V7QA 1N8RH 3CCVF 1QVFF 1X7PA 1Q81H 3NVKE 5HWEA 2HVYD 2FC3A 3NK6A 1YJ9F 3CCSF 4BW0B 4TZZA 3I55F 2QEXF 1VQ5F 1VQ6F 2OHWA 3O85A 3V7EA 4BVRA 4XCQA 1W3EX 1VQ8F 4EI8A 3CCQF 1JJ2F 2JNBA 1PXWA 3GYQA 1VQKF 3NVIB 4BVTA 1Q82H 1KC8H 3J7AR 3D00A 5HY4A 1CK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W41 A;  3I56 F;  1VQN F;  3CCJ F;  3CCU F;  5GAN K;  2KTU A;  1YJW F;  1GO0 A;  1YHQ F;  2BO1 A;  3LWO C;  4C4W C;  2CZW A;  3OBW A;  3AGK A;  3G6E F;  1M90 H;  1H7M A;  1VQP F;  1NJI H;  1ZWZ A;  2KG4 A;  2LBX A;  3CCM F;  5GAP K;  3E1Y A;  3PLA C;  3ON1 A;  1GO1 A;  3SIU A;  2KTV A;  1T0K B;  3LFO A;  2OTL F;  1IPA A;  3FFM A;  3N4Y A;  3CCR F;  4NUT A;  5GIN C;  5EWR A;  3J81 M;  5GIP C;  3CC7 F;  3CG6 A;  3N4Z A;  3OBY A;  1W40 A;  1YIJ F;  5FLX M;  3CD6 F;  5GIO C;  1VQ4 F;  2ALE A;  1RLG A;  3HJW C;  3CPW F;  3CC4 F;  5EO3 A;  2LBW A;  3LWR C;  2QI2 A;  3CCL F;  2I6D A;  1X52 A;  3PAF A;  3JCM M;  1W42 A;  5DCV A;  3CC2 F;  3CMA F;  1RA4 A;  3G71 F;  3WXM B;  2VGM A;  1VQM F;  1W2B F;  3LWQ C;  1KD1 H;  1E7K A;  3JAM M;  3CXC F;  1VQO F;  4BY9 D;  3LWP C;  1QVG F;  1YIT F;  3CPQ A;  3HAX D;  1KQS F;  2OZB A;  2WAL A;  3RA6 A;  1CN7 A;  3G4S F;  2OTJ F;  1M1K H;  1VQ7 F;  3CME F;  3VI6 A;  1DT9 A;  2VGN A;  2AIF A;  1K8A H;  3NMU C;  3NK7 A;  3E20 B;  1S72 F;  1Q86 H;  3MCA B;  1XBI A;  1K73 H;  5IT9 M;  3J80 M;  3LWV C;  1VQ9 F;  1YJN F;  3RA5 A;  3OW2 F;  5G4V C;  1SDS A;  5G4U C;  3IR9 A;  5FJ4 C;  3CCE F;  2QA4 F;  3VMF B;  1VQL F;  1Q7Y H;  5A2Q M;  1NMU B;  4LCK A;  1YI2 F;  1X7O A;  1GZ0 A;  4X3M A;  3SIV A;  4X3L A;  1K9M H;  3V7Q A;  1N8R H;  3CCV F;  1QVF F;  1X7P A;  1Q81 H;  3NVK E;  2HVY D;  2FC3 A;  3NK6 A;  1YJ9 F;  3CCS F;  4BW0 B;  4TZZ A;  3I55 F;  2QEX F;  1VQ5 F;  1VQ6 F;  2OHW A;  3O85 A;  3V7E A;  1VQ8 F;  1W3E X;  3CCQ F;  1JJ2 F;  2JNB A;  1PXW A;  3GYQ A;  1VQK F;  3NVI B;  1Q82 H;  1KC8 H;  3J7A R;  1CK2 A; 
#chains in the Genus database with same CATH topology
 4O4L B;  3I56 F;  4X1I A;  3CYP B;  3UT5 B;  3CCJ F;  3CCU F;  2LCA A;  2BO1 A;  1QD9 A;  3RE3 A;  4LNU B;  4RHA A;  3IMP A;  5LXT A;  2Z01 A;  1ZWZ A;  2HS3 A;  3RYH A;  3VYS C;  3S03 A;  2N48 A;  3EOR A;  4I4T B;  1GO1 A;  4KWE A;  3SIU A;  1W5E A;  4ZHQ A;  5IYZ A;  1T0K B;  3VOB A;  2CHT A;  3FFM A;  1X25 A;  3F0G A;  3JAS A;  4NUT A;  5EWR A;  4X1K B;  4YJ2 A;  3M1X A;  2ALE A;  2GLZ A;  5LA6 B;  5EYP A;  2QI2 A;  3LWR C;  3V3T A;  3R0P A;  3FPI A;  4BT5 A;  5DCV A;  1JN1 A;  2UZH A;  4R40 B;  3G71 F;  2HRU A;  3MCQ A;  1W2B F;  4EB6 B;  3LWQ C;  1KD1 H;  3JAM M;  4I55 A;  1TVK A;  4TV9 A;  3LWP C;  1QVG F;  1YIT F;  3HAX D;  3FD5 A;  2OZB A;  2WAL A;  3HKB B;  1M1K H;  1VQ7 F;  2VGN A;  2CW4 A;  4ZHW A;  3E20 B;  1TUB A;  5CA0 A;  1U3L A;  3QUW A;  4O2A B;  3RYF B;  2RB9 A;  5EZY A;  2R6R 1;  2YXZ A;  1VQ9 F;  1YJN F;  1SA0 A;  3RA5 A;  3OW2 F;  2UYK A;  3VYT C;  1JFF B;  4X1K A;  2HP3 A;  5FJ4 C;  4HNA B;  1PF5 A;  3VMF B;  1VQL F;  3MQW A;  5A2Q M;  1JY8 A;  4LCK A;  1X7O A;  1GZ0 A;  3KHN A;  1ODE A;  1K9M H;  4ZOL A;  1IV3 A;  3JAR A;  2K1S A;  2RHH A;  1Q81 H;  1VHA A;  4O4I B;  3WGJ A;  4FFB A;  1YJ9 F;  1W55 A;  3JAK A;  1UI9 A;  3MBM A;  4I55 B;  1VQ5 F;  2OHW A;  3O85 A;  4TV9 B;  3V7E A;  4BVR A;  4O4J B;  3LYB A;  5JH7 B;  5FNV B;  2V9Y A;  4I4T A;  4U3J B;  1VQK F;  4BVT A;  3JAS B;  5IJ9 B;  3E22 A;  3KE1 A;  4U39 A;  2CSL A;  5HY4 A;  1CK2 A;  3V4D A;  4YJ2 B;  1RQ7 A;  5J2T A;  1VQN F;  5HY1 A;  1GO0 A;  1U3P A;  4TV8 B;  4C4W C;  3AGK A;  3G6E F;  1H7M A;  4B46 A;  5BMV A;  5HP8 A;  2LBX A;  1Z5V A;  3CCM F;  3E1Y A;  3LDT A;  1YQN A;  4WBN A;  5LP6 C;  5MN5 A;  2PMP A;  2CVL A;  3KJK A;  3N4Y A;  5LP6 B;  3TD4 A;  3J81 M;  4EB6 A;  2Z1U A;  3P0Z A;  1YIJ F;  1W40 A;  2MQE A;  3OBY A;  3TD3 A;  3RYC A;  3CD6 F;  3HKC B;  5GIO C;  2RHO A;  3P10 A;  3CPW F;  2UYN B;  3B6N A;  2R75 1;  5ITZ A;  5KMG A;  1X52 A;  3JCM M;  1JFF A;  3CC2 F;  2LBT A;  4BT3 A;  1RA4 A;  3CMA F;  3WXM B;  2ZVZ A;  3VTI C;  4X1Y B;  4BVS A;  5GON B;  2GVI A;  1KNK A;  4BVQ A;  5IJ0 A;  3CXC F;  5JCO A;  1VQO F;  4ZOL B;  2OTJ F;  4X20 A;  4IIJ B;  3WGL A;  2ZF8 A;  3VI6 A;  1OAP A;  4M8I A;  3MDO A;  5J2U B;  3NMU C;  2IAF A;  4BT4 A;  1TVK B;  5CB4 B;  4BT2 A;  3JAK B;  4C81 A;  4C8G A;  4ZHY B;  1XBI A;  3ZP4 A;  1K73 H;  1VK3 A;  5EIB C;  4B5C A;  4F6R A;  4IHJ A;  1IV4 A;  5FNV A;  2HS0 A;  1SDS A;  5G4V C;  2P6Y A;  3IR9 A;  2G9I A;  3E22 B;  4ZI7 A;  2UYP A;  2QTP A;  1TUB B;  4G4V A;  4G88 A;  5EZY B;  4EI7 A;  2HX0 A;  1NMU B;  3K2X A;  3SIV A;  2UYN A;  4X3L A;  3V7Q A;  1FFX B;  5B8F A;  1QVF F;  3CCV F;  3NVK E;  1U40 A;  3I7T A;  5HWE A;  2HVY D;  2BTQ B;  3N2G B;  4PWT A;  5LXT B;  2Z1E A;  3HKE A;  3I55 F;  3JAR B;  1VQ6 F;  1Q8R A;  1OFU A;  3K0T A;  3U0O A;  2CWJ A;  4WBN B;  4ZHQ B;  4TUY A;  3JAW B;  4B62 A;  5AVM A;  1COM A;  1QU9 A;  1Q82 H;  1IV1 A;  1GX1 A;  3D00 A;  3WPX A;  3ZOP A;  3WJQ A;  5JH7 A;  3K12 A;  3WGN A;  1XHO A;  3F0E A;  3JVH A;  4ZK7 A;  1M90 H;  3WGM A;  2NMU A;  3WPW A;  4U3J A;  4ERH A;  1NJI H;  1FSZ A;  5EYP B;  5KMG B;  5KX5 B;  3C9U A;  5EAZ A;  5GON A;  3CB2 A;  3PLA C;  3ON1 A;  4O4H A;  5JVD B;  2FGY A;  2OTL F;  2F9Z C;  5LYJ B;  4G4Z A;  4BT6 A;  3ELC A;  4O2B A;  2AIZ P;  5GIN C;  1W58 1;  2GZL A;  5J2U A;  3VOA A;  4X1I B;  2HP0 A;  3HKB A;  3HTN A;  1FNJ A;  3GTZ A;  2ZOV A;  1FNK A;  3RYI A;  1RLG A;  3T80 A;  4F6R B;  3HJW C;  2BTO A;  2HRY A;  5EO3 A;  2LBW A;  3ERN A;  3CCL F;  2I6D A;  3M4S A;  4ZHV A;  4I50 A;  3L7Q A;  3VIU A;  5CB4 A;  1W57 A;  3LME A;  3HKC A;  3IEW A;  2VGM A;  4EI9 A;  5ITZ B;  3N2K A;  3HWU A;  1RLU A;  5C8Y B;  4ZI7 B;  4X1Y A;  3G4S F;  2B33 A;  2VAP A;  1DT9 A;  4RQO A;  2AIF A;  1K8A H;  3NK7 A;  5CA1 A;  1U43 A;  5IJ0 B;  1S72 F;  1Q86 H;  3MCA B;  3ESJ A;  5IT9 M;  3J80 M;  2KGW A;  3S02 A;  3LWV C;  3WGK A;  3HKD A;  1VQV A;  2IG8 A;  4IIJ A;  5G4U C;  2HP0 B;  4IHJ B;  4E6E A;  3CCE F;  2VAW A;  3IKF A;  2W8B C;  1R1M A;  4B45 A;  1Q7Y H;  4TUY B;  5HY2 A;  1YI2 F;  1XV2 A;  4DRX A;  3FD6 A;  2UYJ A;  5J2T B;  3QHD A;  1NQ3 A;  5IYZ B;  2ZOD A;  1N8R H;  1X7P A;  1KNJ A;  3DC2 A;  5EB1 B;  3JAT A;  3S0Y A;  3JAL A;  3CCS F;  2RHL A;  3VCZ A;  5HP7 A;  1H48 A;  4O4H B;  2H6L A;  4C8E A;  5JVD A;  5LYJ A;  1W3E X;  3UT5 A;  5C8Y A;  3CCQ F;  3DDN A;  2HQS C;  3NVI B;  4O2B B;  5LP6 A;  1KC8 H;  3J7A R;  3RYH B;  1XRG A;  3VYU C;  3JAW A;  1W41 A;  2RHJ A;  3KIZ A;  4YJ3 B;  5GAN K;  1W5B A;  2KTU A;  1YJW F;  1YHQ F;  3LWO C;  3IKE A;  2CZW A;  2CHS A;  3OBW A;  3QTY A;  4I50 B;  1VQP F;  2ZAU A;  1VH8 A;  2KG4 A;  3RYI B;  1J7H A;  5GAP K;  2VXY A;  3F0F A;  2DT4 A;  5HXZ A;  3C8L A;  2KTV A;  1FFX A;  4G4W A;  3LFO A;  3VO8 A;  2AMT A;  3GHZ A;  3D01 A;  1IPA A;  1JD1 A;  4O2A A;  3RYF A;  5IJ9 A;  3CCR F;  5KX5 A;  2IQQ A;  2Q1Y A;  2EWC A;  5GIP C;  3HKE B;  3P4E A;  3CC7 F;  3CG6 A;  3N4Z A;  2Q1X A;  2PHN A;  2DYY A;  5FLX M;  5JCO C;  4X20 B;  4TV8 A;  1H47 A;  1VQ4 F;  3BYQ A;  4O4L A;  3S06 A;  4HNA A;  3CC4 F;  3D54 A;  4BT7 A;  4LNU A;  4C8I A;  5BMV B;  4DXD A;  4G4Y A;  1DBF A;  1ONI A;  4C82 A;  3PAF A;  4G4X A;  1W42 A;  2HS4 A;  3CYQ A;  5EIB D;  5LOV B;  3S0H A;  3ZP7 A;  1CLI A;  1W5F A;  1VQM F;  5MN6 A;  2YYE A;  1E7K A;  2I6R A;  3FBA A;  4FFB B;  2H8C A;  1QAH A;  5MN4 A;  2L26 A;  2ZVY A;  4BY9 D;  3Q8H A;  3CPQ A;  3WJR A;  1W5A A;  1KQS F;  5JQG A;  3RA6 A;  1CN7 A;  5CA0 B;  4O4J A;  3JAT B;  3RYC B;  5HY0 A;  3CME F;  1SA0 B;  3C9T A;  1YGY A;  3JAL B;  3K14 A;  3N2G A;  5CA1 B;  3F6M A;  1UFY A;  3KJJ A;  2BTU A;  4NQ3 A;  2VAM A;  2Z1T A;  5EB0 A;  2QA4 F;  3HKD B;  3I3F A;  3WJP A;  5HXU A;  4O4I A;  3ZO8 A;  4X3M A;  3C9S A;  4YJ3 A;  1RQ2 A;  1SZQ A;  3S0W A;  3OON A;  5LOV A;  3TD5 A;  2FC3 A;  3NK6 A;  2H8E A;  4NWO B;  2OTM A;  4BW0 B;  4TZZ A;  3M84 A;  3N2K B;  2Z1F A;  5LA6 A;  2QEX F;  3IEQ A;  4DRX B;  4XCQ A;  1VQ8 F;  3F0D A;  3C9R A;  4EI8 A;  1Z5W A;  1JJ2 F;  2JNB A;  5JQG B;  1T0A A;  1IV2 A;  1PXW A;  3GYQ A;  1W59 A; 
#chains in the Genus database with same CATH homology
 1W41 A;  3I56 F;  1VQN F;  3CCJ F;  3CCU F;  5HY1 A;  5GAN K;  2KTU A;  1YJW F;  1GO0 A;  1YHQ F;  2BO1 A;  3LWO C;  4C4W C;  2CZW A;  3OBW A;  3AGK A;  3G6E F;  1M90 H;  1H7M A;  1VQP F;  1NJI H;  1ZWZ A;  2KG4 A;  2LBX A;  3CCM F;  5GAP K;  3E1Y A;  3PLA C;  3ON1 A;  5HXZ A;  1GO1 A;  3SIU A;  2KTV A;  1T0K B;  2FGY A;  3LFO A;  2OTL F;  2F9Z C;  1IPA A;  3FFM A;  3N4Y A;  3CCR F;  4NUT A;  5GIN C;  5EWR A;  3J81 M;  5GIP C;  3CC7 F;  3CG6 A;  3N4Z A;  3OBY A;  1W40 A;  1YIJ F;  5FLX M;  3CD6 F;  5GIO C;  1VQ4 F;  2ALE A;  2GLZ A;  1RLG A;  3HJW C;  3CPW F;  3CC4 F;  5EO3 A;  2LBW A;  2QI2 A;  3LWR C;  3CCL F;  3V3T A;  2I6D A;  1X52 A;  3PAF A;  3JCM M;  1W42 A;  5DCV A;  3CC2 F;  3CMA F;  1RA4 A;  3G71 F;  3WXM B;  2VGM A;  1VQM F;  1W2B F;  3LWQ C;  4BVS A;  4EI9 A;  1KD1 H;  1E7K A;  3JAM M;  4BVQ A;  3CXC F;  1VQO F;  4BY9 D;  3LWP C;  1QVG F;  1YIT F;  3CPQ A;  3HAX D;  1KQS F;  2OZB A;  2WAL A;  3RA6 A;  1CN7 A;  3G4S F;  2OTJ F;  1M1K H;  5HY0 A;  3CME F;  1VQ7 F;  3VI6 A;  1DT9 A;  2VGN A;  2AIF A;  1K8A H;  3NMU C;  3NK7 A;  3E20 B;  1S72 F;  1Q86 H;  3MCA B;  1XBI A;  1K73 H;  5IT9 M;  3J80 M;  3LWV C;  1VQ9 F;  1YJN F;  3RA5 A;  3OW2 F;  5G4V C;  1SDS A;  4NQ3 A;  5G4U C;  3IR9 A;  5FJ4 C;  3CCE F;  2QA4 F;  4EI7 A;  3VMF B;  1VQL F;  1Q7Y H;  5HY2 A;  5A2Q M;  1NMU B;  5HXU A;  4LCK A;  1YI2 F;  1X7O A;  1GZ0 A;  4X3M A;  3SIV A;  4X3L A;  1K9M H;  3V7Q A;  1N8R H;  3CCV F;  1QVF F;  1X7P A;  1Q81 H;  3NVK E;  5HWE A;  2HVY D;  2FC3 A;  3NK6 A;  1YJ9 F;  3CCS F;  4BW0 B;  4TZZ A;  3I55 F;  2QEX F;  1VQ5 F;  1VQ6 F;  2OHW A;  3O85 A;  3V7E A;  4BVR A;  4XCQ A;  1W3E X;  1VQ8 F;  4EI8 A;  3CCQ F;  1JJ2 F;  2JNB A;  1PXW A;  3GYQ A;  1VQK F;  3NVI B;  4BVT A;  1Q82 H;  1KC8 H;  3J7A R;  3D00 A;  5HY4 A;  1CK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...