1YJWF

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yjwF00
5GAPK 1IPAA 3NK7A 2QA4F 3LFOA 3G71F 1GZ0A 1YHQF 1VQ6F 1CK2A 3CG6A 3V7QA 1VQ4F 1NMUB 1E7KA 2OTLF 5EO3A 5FJ4C 1W40A 2VGMA 3G6EF 1QVGF 2VGNA 2QEXF 4BY9D 1M1KH 3G4SF 1VQOF 2QI2A 2JNBA 5FLXM 1VQ8F 5GIPC 2OHWA 3PAFA 3NK6A 4LCKA 1S72F 1W2BF 1Q82H 2LBWA 5IT9M 2CZWA 2FC3A 1QVFF 3ON1A 1XBIA 2KG4A 5G4VC 1YJ9F 1NJIH 1KC8H 1YIJF 1VQNF 3CPWF 5DCVA 3NVKE 3OW2F 4X3MA 3CCRF 3CCSF 1W42A 3OBYA 3CMAF 1VQMF 3HJWC 2KTUA 2ALEA 3LWRC 1VQKF 3E1YA 3OBWA 3RA6A 3VI6A 3SIVA 1N8RH 3HAXD 4C4WC 3VMFB 3AGKA 3CC7F 3CXCF 1K8AH 3CC4F 1DT9A 3PLAC 2BO1A 3CMEF 1W41A 2WALA 3J7AR 5GINC 3CCJF 5G4UC 3CC2F 3I56F 2OTJF 3CD6F 2AIFA 1Q86H 3FFMA 3NMUC 3NVIB 3J81M 3J80M 4TZZA 3I55F 2LBXA 1RLGA 3N4ZA 1YI2F 5GANK 3GYQA 1Q7YH 3LWQC 3JCMM 3E20B 1M90H 1X7PA 3RA5A 1VQ9F 3V7EA 1PXWA 1ZWZA 3JAMM 2HVYD 1K73H 3CCQF 5A2QM 5GIOC 1CN7A 1VQLF 1K9MH 3CCVF 1KQSF 1X52A 3LWOC 2I6DA 1H7MA 1RA4A 3LWVC 1KD1H 1VQ5F 3CCUF 3SIUA 1YJNF 3CCEF 1T0KB 3WXMB 3CCLF 1X7OA 1GO0A 4X3LA 1JJ2F 3O85A 1VQ7F 3IR9A 1VQPF 1W3EX 5EWRA 1GO1A 1Q81H 4NUTA 3CCMF 1YJWF 3CPQA 2OZBA 2KTVA 1SDSA 4BW0B 3N4YA 3MCAB 3LWPC 1YITF
chains in the Genus database with same CATH superfamily
3NK7A 1U3PA 3G71F 1GZ0A 2GZLA 1YHQF 5EIBC 2ZOVA 1U3LA 3CG6A 5LP6B 1SZQA 5EO3A 3HKDA 1JD1A 3JAWA 4ZK7A 1JN1A 3JARB 1FFXB 4TV8A 3UT5B 5EB0A 3KHNA 5IJ9A 4X1IB 5HP7A 4LNUB 3G4SF 2QI2A 1RQ7A 3B6NA 3VOBA 1R1MA 4DRXA 2OHWA 3HTNA 3NK6A 1NQ3A 4DXDA 5LYJB 3RYCA 2H8CA 4ERHA 5CA1A 2B33A 3MDOA 2CZWA 4C8GA 1IV3A 3N2GA 4EI9A 3M4SA 3M1XA 4O4LA 1XV2A 4M8IA 2KG4A 3RYIA 4O4JA 2R751 2H8EA 3GTZA 3RYFA 3RE3A 5KMGB 1KC8H 5GONB 3CPWF 2HQSC 5DCVA 4X20B 4X3MA 4ZOLB 3JALA 4XCQA 3CMAF 3OBYA 3FD5A 1VQMF 3JATA 3LMEA 4NWOB 1YQNA 1VQKF 4O2AA 3RA6A 1VHAA 2BTOA 3SIVA 4HNAA 3U0OA 5LXTA 3HAXD 1YITF 4FFBA 2AMTA 4C4WC 5BMVB 5HXZA 3CC7F 4BVQA 2I6RA 5HP8A 4G4ZA 1Q8RA 3J7AR 4O4HB 2VAPA 3I56F 5EYPB 2OTJF 3JAKA 5JCOC 3HKEB 3WGNA 3NMUC 3KJKA 4IHJA 3J81M 4TV9B 4TZZA 3LDTA 2HRUA 3WJQA 5JVDB 3LWQC 5J2UB 5KX5A 2Z1UA 1U43A 2H6LA 1QU9A 2AIZP 3JAMM 3D54A 5LP6C 1SA0A 3T80A 4C8EA 4C8IA 2RB9A 2VAWA 2UYKA 3RYHB 2G9IA 1KQSF 1H7MA 1X25A 1YJNF 1X7OA 4X3LA 3IKFA 3BYQA 3WGMA 3IR9A 2RHOA 4BT2A 1JFFB 1Q81H 3N2KA 5EZYA 4EI8A 3CPQA 4X1YA 5CB4A 2DT4A 3EORA 5LOVA 3LYBA 5HY4A 1IPAA 5GAPK 1PF5A 2ZF8A 3F0DA 5AVMA 5HWEA 3HKBB 1XRGA 2W8BC 3K2XA 3ZOPA 3JASB 3D00A 3TD5A 4YJ2A 2VGMA 3G6EF 1QVGF 2VGNA 4O4IB 3P10A 4BY9D 1M1KH 2CHSA 3ZO8A 2OTMA 5IYZB 3PAFA 4LCKA 1S72F 3DC2A 5HY0A 3ERNA 5J2TB 3ELCA 1FNKA 4ZHVA 2ZVZA 1KNKA 3OONA 2HP0A 5HXUA 1QVFF 3CB2A 3GHZA 3S02A 4U39A 2Z01A 4RHAA 5FNVA 4R40B 4RQOA 3VO8A 3OW2F 3NVKE 4G4XA 3CCRF 4O2BB 1W42A 3VTIC 4I50B 5B8FA 5HY1A 1KNJA 4TUYA 2KTUA 4WBNB 3LWRC 2NMUA 3OBWA 5IJ0A 5EB1B 4ZHQA 1TUBB 3QHDA 3I3FA 4X1KA 3VMFB 5LA6B 4I4TA 3CC4F 3VYUC 1DBFA 3E22B 3PLAC 4YJ3A 1RQ2A 3C9UA 4EI7A 3CMEF 4BVSA 3IKEA 1W41A 4U3JB 5JQGB 3TD3A 4ZI7A 4C82A 2GVIA 1H48A 4EB6B 3NVIB 5ITZB 5JCOA 1XHOA 3N4ZA 5GANK 3GYQA 4I55A 1OAPA 2ZODA 1X7PA 4IIJB 1PXWA 3HKCA 3WGLA 3JVHA 1K73H 3CCQF 5JH7B 5A2QM 1JY8A 5GIOC 3CYQA 2RHJA 1COMA 2CSLA 5LP6A 1K9MH 1VQLF 3LWOC 3K0TA 1RA4A 4PWTA 3SIUA 1W5EA 3I7TA 3JARA 1FFXA 3UT5A 3O85A 1W5FA 4X1IA 4LNUA 1W3EX 1TVKB 4F6RB 4C81A 5LYJA 1UI9A 1FSZA 3N4YA 4BW0B 5G4UC 2HS4A 3MBMA 1VQ6F 3M84A 2RHLA 4ZHWA 5C8YB 2EWCA 3V7QA 1VQ4F 1QD9A 1NMUB 1E7KA 1VQVA 2OTLF 2VAMA 2HP3A 1U40A 5KMGA 5CA0B 5GONA 3FD6A 4X20A 3FBAA 4ZOLA 2QTPA 3F0FA 3F0EA 4BT3A 2HX0A 3IEQA 5GIPC 2UYNB 1Q82H 4O4LB 1ONIA 5IT9M 5BMVA 3VYTC 2FC3A 3ON1A 5MN4A 3HKDB 1T0AA 2K1SA 1XBIA 5G4VC 4ZHYB 3JAWB 1W59A 1NJIH 1YIJF 1VQNF 2PHNA 4TV8B 2HS3A 4O4HA 2CHTA 3HWUA 5IJ9B 5EYPA 3CCSF 3HKEA 4DRXB 2ALEA 3VI6A 4TV9A 5MN6A 3RYCB 1YGYA 5CA1B 3D01A 3S0HA 3ZP4A 5JVDA 3N2GB 2BTQB 3MQWA 5J2UA 1K8AH 3WPWA 2UYJA 3S06A 3RYIB 4O4JB 3RYFB 2UYPA 3RYHA 1J7HA 4KWEA 3JALB 3JATB 3WJRA 2Z1TA 4G4YA 3CD6F 3FFMA 1FNJA 4O2AB 3J80M 3Q8HA 2LBXA 4HNAB 2CWJA 3L7QA 1RLGA 5LXTB 1JFFA 4FFBB 3KE1A 3QUWA 1VH8A 3TD4A 1VQ9F 2IQQA 4G88A 1ZWZA 3K12A 3IEWA 1H47A 3HKBA 3S0YA 2Z1EA 3CCVF 3F0GA 2I6DA 2P6YA 4B46A 1KD1H 1VQ5F 3CCUF 3JAKB 3JASA 4G4VA 3S03A 3CCLF 1GO0A 1JJ2F 4O4IA 4IHJB 5MN5A 2RHHA 1VQ7F 4BT6A 1VQPF 1W581 2CVLA 1CLIA 4NUTA 3P0ZA 5IYZA 1YJWF 4BT5A 2F9ZC 5KX5B 2BTUA 3MCAB 3VCZA 2UZHA 2Q1XA 5J2TA 2QA4F 1SA0B 1W5AA 3LFOA 3ESJA 1CK2A 5FJ4C 2VXYA 4BT4A 1W40A 4G4WA 3VYSC 2QEXF 1W55A 4O2BA 5HY2A 4I50A 1Z5VA 1VK3A 1VQOF 2MQEA 3F6MA 2JNBA 3N2KB 5EZYB 5FLXM 1VQ8F 4WBNA 3ZP7A 4X1YB 5CB4B 1W2BF 2L26A 3WJPA 2LBWA 4BVTA 1ODEA 1TUBA 5LOVB 3WPXA 1IV2A 4BT7A 3WGKA 5LA6A 1UFYA 3E22A 2HS0A 2V9YA 1YJ9F 4YJ2B 2LBTA 4U3JA 5JQGA 3IMPA 3VIUA 3WGJA 5EAZA 3HJWC 2N48A 3P4EA 4EB6A 2KGWA 3E1YA 5ITZA 2CW4A 1IV1A 3CYPB 1GX1A 2ZVYA 1N8RH 1W57A 2IG8A 3AGKA 2YYEA 2HP0B 3CXCF 2R6R1 4IIJA 1DT9A 5JH7A 2BO1A 2LCAA 2WALA 5FNVB 4E6EA 5GINC 3CCJF 3MCQA 3CC2F 3C8LA 3DDNA 2AIFA 2DYYA 3KIZA 4TUYB 1Q86H 2HRYA 1QAHA 5IJ0B 3I55F 4ZHQB 3K14A 1YI2F 4X1KB 1TVKA 4F6RA 3KJJA 1Q7YH 1Z5WA 3C9SA 3FPIA 3JCMM 3E20B 4I4TB 1M90H 3V7EA 3RA5A 4YJ3B 2HVYD 3QTYA 5EIBD 2IAFA 3V3TA 5C8YA 1RLUA 1CN7A 4B45A 1X52A 2Z1FA 4BVRA 4NQ3A 3LWVC 2ZAUA 4ZI7B 3CCEF 1T0KB 3WXMB 5CA0A 3C9TA 3R0PA 3C9RA 3V4DA 2Q1YA 2GLZA 1OFUA 5EWRA 1GO1A 2YXZA 1IV4A 3VOAA 3CCMF 4I55B 2OZBA 2UYNA 1W5BA 2FGYA 2KTVA 1SDSA 3S0WA 2PMPA 3LWPC 3HKCB 4B62A 4B5CA
chains in the Genus database with same CATH topology
5HY4A 1IPAA 3NK7A 5GAPK 2QA4F 3LFOA 3G71F 1GZ0A 5HWEA 1YHQF 1VQ6F 1CK2A 3CG6A 3V7QA 1VQ4F 1NMUB 1E7KA 2OTLF 5EO3A 5FJ4C 3D00A 1W40A 2VGMA 3G6EF 1QVGF 2VGNA 2QEXF 5HY2A 4BY9D 1M1KH 3G4SF 1VQOF 2QI2A 2JNBA 5FLXM 1VQ8F 5GIPC 2OHWA 3PAFA 3NK6A 4LCKA 1S72F 1W2BF 1Q82H 2LBWA 4BVTA 5HY0A 5IT9M 2CZWA 5HXUA 2FC3A 1QVFF 4EI9A 3ON1A 1XBIA 2KG4A 5G4VC 1YJ9F 1NJIH 1KC8H 1YIJF 1VQNF 3CPWF 5DCVA 3NVKE 3OW2F 4X3MA 3CCRF 3CCSF 4XCQA 1W42A 3OBYA 3CMAF 1VQMF 5HY1A 3HJWC 2KTUA 2ALEA 3LWRC 1VQKF 3E1YA 3OBWA 3RA6A 3VI6A 3SIVA 1N8RH 3HAXD 4C4WC 3VMFB 5HXZA 3AGKA 3CC7F 3CXCF 1K8AH 3CC4F 4BVQA 1DT9A 3PLAC 4EI7A 2BO1A 3CMEF 4BVSA 1W41A 2WALA 3J7AR 5GINC 3CCJF 5G4UC 3CC2F 3I56F 2OTJF 3CD6F 2AIFA 1Q86H 3FFMA 3NMUC 3NVIB 3J81M 3J80M 4TZZA 3I55F 2LBXA 1RLGA 3N4ZA 1YI2F 5GANK 3GYQA 1Q7YH 3LWQC 3JCMM 3E20B 1M90H 1X7PA 3RA5A 1VQ9F 3V7EA 1PXWA 1ZWZA 3JAMM 2HVYD 1K73H 3CCQF 5A2QM 3V3TA 5GIOC 1CN7A 1VQLF 1K9MH 3CCVF 1KQSF 1X52A 3LWOC 2I6DA 4BVRA 1H7MA 1RA4A 4NQ3A 3LWVC 1KD1H 3CCUF 1VQ5F 3SIUA 1YJNF 3CCEF 1T0KB 3WXMB 3CCLF 1X7OA 1GO0A 4X3LA 1JJ2F 3O85A 1VQ7F 2GLZA 3IR9A 1VQPF 1W3EX 5EWRA 1GO1A 1Q81H 4NUTA 4EI8A 3CCMF 1YJWF 3CPQA 2OZBA 2FGYA 2KTVA 1SDSA 2F9ZC 4BW0B 3N4YA 3MCAB 3LWPC 1YITF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAP K;  1IPA A;  3NK7 A;  2QA4 F;  3LFO A;  3G71 F;  1GZ0 A;  1YHQ F;  1VQ6 F;  1CK2 A;  3CG6 A;  3V7Q A;  1VQ4 F;  1NMU B;  1E7K A;  2OTL F;  5EO3 A;  5FJ4 C;  1W40 A;  2VGM A;  3G6E F;  1QVG F;  2VGN A;  2QEX F;  4BY9 D;  1M1K H;  3G4S F;  1VQO F;  2QI2 A;  2JNB A;  5FLX M;  1VQ8 F;  5GIP C;  2OHW A;  3PAF A;  3NK6 A;  4LCK A;  1S72 F;  1W2B F;  1Q82 H;  2LBW A;  5IT9 M;  2CZW A;  2FC3 A;  1QVF F;  3ON1 A;  1XBI A;  2KG4 A;  5G4V C;  1YJ9 F;  1NJI H;  1KC8 H;  1YIJ F;  1VQN F;  3CPW F;  5DCV A;  3NVK E;  3OW2 F;  4X3M A;  3CCR F;  3CCS F;  1W42 A;  3OBY A;  3CMA F;  1VQM F;  3HJW C;  2KTU A;  2ALE A;  3LWR C;  1VQK F;  3E1Y A;  3OBW A;  3RA6 A;  3VI6 A;  3SIV A;  1N8R H;  3HAX D;  4C4W C;  3VMF B;  3AGK A;  3CC7 F;  3CXC F;  1K8A H;  3CC4 F;  1DT9 A;  3PLA C;  2BO1 A;  3CME F;  1W41 A;  2WAL A;  3J7A R;  5GIN C;  3CCJ F;  5G4U C;  3CC2 F;  3I56 F;  2OTJ F;  3CD6 F;  2AIF A;  1Q86 H;  3FFM A;  3NMU C;  3NVI B;  3J81 M;  3J80 M;  4TZZ A;  3I55 F;  2LBX A;  1RLG A;  3N4Z A;  1YI2 F;  5GAN K;  3GYQ A;  1Q7Y H;  3LWQ C;  3JCM M;  3E20 B;  1M90 H;  1X7P A;  3RA5 A;  1VQ9 F;  3V7E A;  1PXW A;  1ZWZ A;  3JAM M;  2HVY D;  1K73 H;  3CCQ F;  5A2Q M;  5GIO C;  1CN7 A;  1VQL F;  1K9M H;  3CCV F;  1KQS F;  1X52 A;  3LWO C;  2I6D A;  1H7M A;  1RA4 A;  3LWV C;  1KD1 H;  1VQ5 F;  3CCU F;  3SIU A;  1YJN F;  3CCE F;  1T0K B;  3WXM B;  3CCL F;  1X7O A;  1GO0 A;  4X3L A;  1JJ2 F;  3O85 A;  1VQ7 F;  3IR9 A;  1VQP F;  1W3E X;  5EWR A;  1GO1 A;  1Q81 H;  4NUT A;  3CCM F;  1YJW F;  3CPQ A;  2OZB A;  2KTV A;  1SDS A;  4BW0 B;  3N4Y A;  3MCA B;  3LWP C;  1YIT F; 
#chains in the Genus database with same CATH topology
 3NK7 A;  1U3P A;  3G71 F;  1GZ0 A;  2GZL A;  1YHQ F;  5EIB C;  2ZOV A;  1U3L A;  3CG6 A;  5LP6 B;  1SZQ A;  5EO3 A;  3HKD A;  1JD1 A;  3JAW A;  4ZK7 A;  1JN1 A;  3JAR B;  1FFX B;  4TV8 A;  3UT5 B;  5EB0 A;  3KHN A;  5IJ9 A;  4X1I B;  5HP7 A;  4LNU B;  3G4S F;  2QI2 A;  1RQ7 A;  3B6N A;  3VOB A;  1R1M A;  4DRX A;  2OHW A;  3HTN A;  3NK6 A;  1NQ3 A;  4DXD A;  5LYJ B;  3RYC A;  2H8C A;  4ERH A;  5CA1 A;  2B33 A;  3MDO A;  2CZW A;  4C8G A;  1IV3 A;  3N2G A;  4EI9 A;  3M4S A;  3M1X A;  4O4L A;  1XV2 A;  4M8I A;  2KG4 A;  3RYI A;  4O4J A;  2R75 1;  2H8E A;  3GTZ A;  3RYF A;  3RE3 A;  5KMG B;  1KC8 H;  5GON B;  3CPW F;  2HQS C;  5DCV A;  4X20 B;  4X3M A;  4ZOL B;  3JAL A;  4XCQ A;  3CMA F;  3OBY A;  3FD5 A;  1VQM F;  3JAT A;  3LME A;  4NWO B;  1YQN A;  1VQK F;  4O2A A;  3RA6 A;  1VHA A;  2BTO A;  3SIV A;  4HNA A;  3U0O A;  5LXT A;  3HAX D;  1YIT F;  4FFB A;  2AMT A;  4C4W C;  5BMV B;  5HXZ A;  3CC7 F;  4BVQ A;  2I6R A;  5HP8 A;  4G4Z A;  1Q8R A;  3J7A R;  4O4H B;  2VAP A;  3I56 F;  5EYP B;  2OTJ F;  3JAK A;  5JCO C;  3HKE B;  3WGN A;  3NMU C;  3KJK A;  4IHJ A;  3J81 M;  4TV9 B;  4TZZ A;  3LDT A;  2HRU A;  3WJQ A;  5JVD B;  3LWQ C;  5J2U B;  5KX5 A;  2Z1U A;  1U43 A;  2H6L A;  1QU9 A;  2AIZ P;  3JAM M;  3D54 A;  5LP6 C;  1SA0 A;  3T80 A;  4C8E A;  4C8I A;  2RB9 A;  2VAW A;  2UYK A;  3RYH B;  2G9I A;  1KQS F;  1H7M A;  1X25 A;  1YJN F;  1X7O A;  4X3L A;  3IKF A;  3BYQ A;  3WGM A;  3IR9 A;  2RHO A;  4BT2 A;  1JFF B;  1Q81 H;  3N2K A;  5EZY A;  4EI8 A;  3CPQ A;  4X1Y A;  5CB4 A;  2DT4 A;  3EOR A;  5LOV A;  3LYB A;  5HY4 A;  1IPA A;  5GAP K;  1PF5 A;  2ZF8 A;  3F0D A;  5AVM A;  5HWE A;  3HKB B;  1XRG A;  2W8B C;  3K2X A;  3ZOP A;  3JAS B;  3D00 A;  3TD5 A;  4YJ2 A;  2VGM A;  3G6E F;  1QVG F;  2VGN A;  4O4I B;  3P10 A;  4BY9 D;  1M1K H;  2CHS A;  3ZO8 A;  2OTM A;  5IYZ B;  3PAF A;  4LCK A;  1S72 F;  3DC2 A;  5HY0 A;  3ERN A;  5J2T B;  3ELC A;  1FNK A;  4ZHV A;  2ZVZ A;  1KNK A;  3OON A;  2HP0 A;  5HXU A;  1QVF F;  3CB2 A;  3GHZ A;  3S02 A;  4U39 A;  2Z01 A;  4RHA A;  5FNV A;  4R40 B;  4RQO A;  3VO8 A;  3OW2 F;  3NVK E;  4G4X A;  3CCR F;  4O2B B;  1W42 A;  3VTI C;  4I50 B;  5B8F A;  5HY1 A;  1KNJ A;  4TUY A;  2KTU A;  4WBN B;  3LWR C;  2NMU A;  3OBW A;  5IJ0 A;  5EB1 B;  4ZHQ A;  1TUB B;  3QHD A;  3I3F A;  4X1K A;  3VMF B;  5LA6 B;  4I4T A;  3CC4 F;  3VYU C;  1DBF A;  3E22 B;  3PLA C;  4YJ3 A;  1RQ2 A;  3C9U A;  4EI7 A;  3CME F;  4BVS A;  3IKE A;  1W41 A;  4U3J B;  5JQG B;  3TD3 A;  4ZI7 A;  4C82 A;  2GVI A;  1H48 A;  4EB6 B;  3NVI B;  5ITZ B;  5JCO A;  1XHO A;  3N4Z A;  5GAN K;  3GYQ A;  4I55 A;  1OAP A;  2ZOD A;  1X7P A;  4IIJ B;  1PXW A;  3HKC A;  3WGL A;  3JVH A;  1K73 H;  3CCQ F;  5JH7 B;  5A2Q M;  1JY8 A;  5GIO C;  3CYQ A;  2RHJ A;  1COM A;  2CSL A;  5LP6 A;  1K9M H;  1VQL F;  3LWO C;  3K0T A;  1RA4 A;  4PWT A;  3SIU A;  1W5E A;  3I7T A;  3JAR A;  1FFX A;  3UT5 A;  3O85 A;  1W5F A;  4X1I A;  4LNU A;  1W3E X;  1TVK B;  4F6R B;  4C81 A;  5LYJ A;  1UI9 A;  1FSZ A;  3N4Y A;  4BW0 B;  5G4U C;  2HS4 A;  3MBM A;  1VQ6 F;  3M84 A;  2RHL A;  4ZHW A;  5C8Y B;  2EWC A;  3V7Q A;  1VQ4 F;  1QD9 A;  1NMU B;  1E7K A;  1VQV A;  2OTL F;  2VAM A;  2HP3 A;  1U40 A;  5KMG A;  5CA0 B;  5GON A;  3FD6 A;  4X20 A;  3FBA A;  4ZOL A;  2QTP A;  3F0F A;  3F0E A;  4BT3 A;  2HX0 A;  3IEQ A;  5GIP C;  2UYN B;  1Q82 H;  4O4L B;  1ONI A;  5IT9 M;  5BMV A;  3VYT C;  2FC3 A;  3ON1 A;  5MN4 A;  3HKD B;  1T0A A;  2K1S A;  1XBI A;  5G4V C;  4ZHY B;  3JAW B;  1W59 A;  1NJI H;  1YIJ F;  1VQN F;  2PHN A;  4TV8 B;  2HS3 A;  4O4H A;  2CHT A;  3HWU A;  5IJ9 B;  5EYP A;  3CCS F;  3HKE A;  4DRX B;  2ALE A;  3VI6 A;  4TV9 A;  5MN6 A;  3RYC B;  1YGY A;  5CA1 B;  3D01 A;  3S0H A;  3ZP4 A;  5JVD A;  3N2G B;  2BTQ B;  3MQW A;  5J2U A;  1K8A H;  3WPW A;  2UYJ A;  3S06 A;  3RYI B;  4O4J B;  3RYF B;  2UYP A;  3RYH A;  1J7H A;  4KWE A;  3JAL B;  3JAT B;  3WJR A;  2Z1T A;  4G4Y A;  3CD6 F;  3FFM A;  1FNJ A;  4O2A B;  3J80 M;  3Q8H A;  2LBX A;  4HNA B;  2CWJ A;  3L7Q A;  1RLG A;  5LXT B;  1JFF A;  4FFB B;  3KE1 A;  3QUW A;  1VH8 A;  3TD4 A;  1VQ9 F;  2IQQ A;  4G88 A;  1ZWZ A;  3K12 A;  3IEW A;  1H47 A;  3HKB A;  3S0Y A;  2Z1E A;  3CCV F;  3F0G A;  2I6D A;  2P6Y A;  4B46 A;  1KD1 H;  1VQ5 F;  3CCU F;  3JAK B;  3JAS A;  4G4V A;  3S03 A;  3CCL F;  1GO0 A;  1JJ2 F;  4O4I A;  4IHJ B;  5MN5 A;  2RHH A;  1VQ7 F;  4BT6 A;  1VQP F;  1W58 1;  2CVL A;  1CLI A;  4NUT A;  3P0Z A;  5IYZ A;  1YJW F;  4BT5 A;  2F9Z C;  5KX5 B;  2BTU A;  3MCA B;  3VCZ A;  2UZH A;  2Q1X A;  5J2T A;  2QA4 F;  1SA0 B;  1W5A A;  3LFO A;  3ESJ A;  1CK2 A;  5FJ4 C;  2VXY A;  4BT4 A;  1W40 A;  4G4W A;  3VYS C;  2QEX F;  1W55 A;  4O2B A;  5HY2 A;  4I50 A;  1Z5V A;  1VK3 A;  1VQO F;  2MQE A;  3F6M A;  2JNB A;  3N2K B;  5EZY B;  5FLX M;  1VQ8 F;  4WBN A;  3ZP7 A;  4X1Y B;  5CB4 B;  1W2B F;  2L26 A;  3WJP A;  2LBW A;  4BVT A;  1ODE A;  1TUB A;  5LOV B;  3WPX A;  1IV2 A;  4BT7 A;  3WGK A;  5LA6 A;  1UFY A;  3E22 A;  2HS0 A;  2V9Y A;  1YJ9 F;  4YJ2 B;  2LBT A;  4U3J A;  5JQG A;  3IMP A;  3VIU A;  3WGJ A;  5EAZ A;  3HJW C;  2N48 A;  3P4E A;  4EB6 A;  2KGW A;  3E1Y A;  5ITZ A;  2CW4 A;  1IV1 A;  3CYP B;  1GX1 A;  2ZVY A;  1N8R H;  1W57 A;  2IG8 A;  3AGK A;  2YYE A;  2HP0 B;  3CXC F;  2R6R 1;  4IIJ A;  1DT9 A;  5JH7 A;  2BO1 A;  2LCA A;  2WAL A;  5FNV B;  4E6E A;  5GIN C;  3CCJ F;  3MCQ A;  3CC2 F;  3C8L A;  3DDN A;  2AIF A;  2DYY A;  3KIZ A;  4TUY B;  1Q86 H;  2HRY A;  1QAH A;  5IJ0 B;  3I55 F;  4ZHQ B;  3K14 A;  1YI2 F;  4X1K B;  1TVK A;  4F6R A;  3KJJ A;  1Q7Y H;  1Z5W A;  3C9S A;  3FPI A;  3JCM M;  3E20 B;  4I4T B;  1M90 H;  3V7E A;  3RA5 A;  4YJ3 B;  2HVY D;  3QTY A;  5EIB D;  2IAF A;  3V3T A;  5C8Y A;  1RLU A;  1CN7 A;  4B45 A;  1X52 A;  2Z1F A;  4BVR A;  4NQ3 A;  3LWV C;  2ZAU A;  4ZI7 B;  3CCE F;  1T0K B;  3WXM B;  5CA0 A;  3C9T A;  3R0P A;  3C9R A;  3V4D A;  2Q1Y A;  2GLZ A;  1OFU A;  5EWR A;  1GO1 A;  2YXZ A;  1IV4 A;  3VOA A;  3CCM F;  4I55 B;  2OZB A;  2UYN A;  1W5B A;  2FGY A;  2KTV A;  1SDS A;  3S0W A;  2PMP A;  3LWP C;  3HKC B;  4B62 A;  4B5C A; 
#chains in the Genus database with same CATH homology
 5HY4 A;  1IPA A;  3NK7 A;  5GAP K;  2QA4 F;  3LFO A;  3G71 F;  1GZ0 A;  5HWE A;  1YHQ F;  1VQ6 F;  1CK2 A;  3CG6 A;  3V7Q A;  1VQ4 F;  1NMU B;  1E7K A;  2OTL F;  5EO3 A;  5FJ4 C;  3D00 A;  1W40 A;  2VGM A;  3G6E F;  1QVG F;  2VGN A;  2QEX F;  5HY2 A;  4BY9 D;  1M1K H;  3G4S F;  1VQO F;  2QI2 A;  2JNB A;  5FLX M;  1VQ8 F;  5GIP C;  2OHW A;  3PAF A;  3NK6 A;  4LCK A;  1S72 F;  1W2B F;  1Q82 H;  2LBW A;  4BVT A;  5HY0 A;  5IT9 M;  2CZW A;  5HXU A;  2FC3 A;  1QVF F;  4EI9 A;  3ON1 A;  1XBI A;  2KG4 A;  5G4V C;  1YJ9 F;  1NJI H;  1KC8 H;  1YIJ F;  1VQN F;  3CPW F;  5DCV A;  3NVK E;  3OW2 F;  4X3M A;  3CCR F;  3CCS F;  4XCQ A;  1W42 A;  3OBY A;  3CMA F;  1VQM F;  5HY1 A;  3HJW C;  2KTU A;  2ALE A;  3LWR C;  1VQK F;  3E1Y A;  3OBW A;  3RA6 A;  3VI6 A;  3SIV A;  1N8R H;  3HAX D;  4C4W C;  3VMF B;  5HXZ A;  3AGK A;  3CC7 F;  3CXC F;  1K8A H;  3CC4 F;  4BVQ A;  1DT9 A;  3PLA C;  4EI7 A;  2BO1 A;  3CME F;  4BVS A;  1W41 A;  2WAL A;  3J7A R;  5GIN C;  3CCJ F;  5G4U C;  3CC2 F;  3I56 F;  2OTJ F;  3CD6 F;  2AIF A;  1Q86 H;  3FFM A;  3NMU C;  3NVI B;  3J81 M;  3J80 M;  4TZZ A;  3I55 F;  2LBX A;  1RLG A;  3N4Z A;  1YI2 F;  5GAN K;  3GYQ A;  1Q7Y H;  3LWQ C;  3JCM M;  3E20 B;  1M90 H;  1X7P A;  3RA5 A;  1VQ9 F;  3V7E A;  1PXW A;  1ZWZ A;  3JAM M;  2HVY D;  1K73 H;  3CCQ F;  5A2Q M;  3V3T A;  5GIO C;  1CN7 A;  1VQL F;  1K9M H;  3CCV F;  1KQS F;  1X52 A;  3LWO C;  2I6D A;  4BVR A;  1H7M A;  1RA4 A;  4NQ3 A;  3LWV C;  1KD1 H;  3CCU F;  1VQ5 F;  3SIU A;  1YJN F;  3CCE F;  1T0K B;  3WXM B;  3CCL F;  1X7O A;  1GO0 A;  4X3L A;  1JJ2 F;  3O85 A;  1VQ7 F;  2GLZ A;  3IR9 A;  1VQP F;  1W3E X;  5EWR A;  1GO1 A;  1Q81 H;  4NUT A;  4EI8 A;  3CCM F;  1YJW F;  3CPQ A;  2OZB A;  2FGY A;  2KTV A;  1SDS A;  2F9Z C;  4BW0 B;  3N4Y A;  3MCA B;  3LWP C;  1YIT F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...