1YJWF

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yjwF00
3SIVA 1YI2F 3RA5A 1KC8H 3NVKE 3SIUA 3I56F 2OHWA 3CG6A 1GO0A 3CCQF 2KG4A 2WALA 3J7AR 2OTJF 1E7KA 3CCSF 3JAMM 3E1YA 2LBWA 1W2BF 2KTVA 3CPQA 1W40A 1DT9A 1VQ7F 2HVYD 3HAXD 1W42A 1S72F 1YIJF 3CCUF 1YJNF 2KTUA 1X52A 1CN7A 5GIPC 3HJWC 1VQ8F 3PLAC 1X7OA 1VQ9F 4LCKA 1VQLF 3CC2F 1QVFF 2QEXF 2QA4F 1VQ4F 3CCLF 3IR9A 1PXWA 3CXCF 1K9MH 2LBXA 3OBWA 1GO1A 1K8AH 3LWVC 2FC3A 2QI2A 4BW0B 3WXMB 1W3EX 3VI6A 1Q86H 3CMAF 3RA6A 1K73H 3NK6A 1YJ9F 1VQOF 1RLGA 1Q81H 5GINC 1YJWF 1KD1H 3CCEF 1Q82H 3AGKA 2VGNA 3LWQC 3FFMA 1X7PA 1GZ0A 2ALEA 3I55F 3LFOA 4NUTA 1IPAA 3OBYA 1YITF 1VQ5F 3JCMM 2JNBA 3CCRF 2I6DA 3CCVF 5EWRA 3OW2F 1VQKF 2OTLF 1M1KH 3LWOC 1VQPF 2OZBA 3MCAB 2AIFA 2VGMA 3G71F 3NVIB 1XBIA 5IT9M 3V7QA 3CCJF 1VQ6F 1VQNF 5G4VC 3E20B 4X3LA 1CK2A 4C4WC 5G4UC 3NK7A 5FLXM 1NJIH 1SDSA 5A2QM 3N4ZA 1ZWZA 1JJ2F 3CC7F 3PAFA 3NMUC 1KQSF 3CPWF 4TZZA 5EO3A 1RA4A 3J81M 2CZWA 3VMFB 3CCMF 5DCVA 5GANK 3G6EF 3ON1A 3CD6F 4BY9D 3CC4F 3G4SF 1T0KB 5GIOC 5FJ4C 3CMEF 1VQMF 1M90H 1H7MA 3GYQA 1W41A 1Q7YH 3V7EA 1QVGF 1YHQF 3N4YA 2BO1A 1N8RH 4X3MA 1NMUB 3J80M 3O85A 5GAPK 3LWRC 3LWPC
chains in the Genus database with same CATH superfamily
5MN6A 2IG8A 3I3FA 5ITZB 3RA5A 3NVKE 1XHOA 5EAZA 1GO0A 3CCQF 3S0HA 2KG4A 3J7AR 4O4LA 4C8IA 3DC2A 4B5CA 4I55A 3CCSF 1H48A 3E1YA 5HXZA 3RE3A 3C9SA 4C82A 3N2GA 2HVYD 1KNKA 2OTMA 3HTNA 2QTPA 3KE1A 1YJNF 2DT4A 2AIZP 1CN7A 3PLAC 1X7OA 4O4LB 5KX5B 2QA4F 5JVDA 1VQ4F 4M8IA 4B46A 3VTIC 5LP6A 3IMPA 1W581 3D00A 4TUYA 1U43A 3LWVC 1SZQA 3N2GB 2QI2A 5EIBC 3VYSC 5HXUA 3VI6A 1Q86H 2R6R1 3RA6A 3WGJA 4B45A 1VQOF 2Z01A 1UFYA 3CCEF 3KIZA 2Z1EA 3AGKA 4BVSA 3LWQC 1X7PA 5BMVA 1VHAA 3P10A 4O2BA 1RQ2A 2ZAUA 3CCRF 1COMA 4DRXA 5EWRA 3OW2F 1VQKF 2OZBA 3MCAB 2VGMA 3F0DA 3F0GA 4KWEA 3G71F 4BVTA 4O4JA 3CCJF 1VQ6F 4G88A 3RYIA 3E20B 1CK2A 5J2UA 5FLXM 1ONIA 3QUWA 5BMVB 3OONA 1OAPA 4O2BB 3ELCA 1QU9A 1XRGA 3VCZA 2UYKA 3CC7F 4ERHA 2LBTA 3K2XA 3CPWF 3K14A 4BT4A 4HNAA 3MCQA 5EO3A 3CCMF 2KGWA 4F6RB 4TV8B 3N2KA 3CC4F 3G4SF 1T0KB 4O4JB 2IQQA 3TD4A 5FJ4C 2G9IA 3RYHB 4X1YB 5JCOA 2GLZA 2P6YA 1H7MA 2Z1FA 1Q7YH 4R40B 3TD5A 3IEQA 4RQOA 1H47A 1QVGF 3WGMA 1VH8A 3JASB 1YHQF 4HNAB 4BT5A 1VK3A 3F0EA 3LDTA 3J80M 2YXZA 5GAPK 3VO8A 5HY2A 3LWPC 2PMPA 1RLUA 2HRYA 5HP7A 4ZK7A 1TVKB 3K12A 5EB1B 3P0ZA 4I50A 2WALA 5LP6C 2Q1YA 1Z5VA 2F9ZC 3LYBA 5B8FA 5LOVB 4IHJA 3DDNA 2ZVYA 1S72F 1YIJF 3K0TA 3D54A 5GIPC 3HJWC 2L26A 1Z5WA 4I50B 1VQLF 3S06A 2QEXF 3M4SA 2HS3A 4E6EA 2RHHA 3GTZA 1PXWA 4DXDA 3OBWA 1GX1A 4NQ3A 1K8AH 5KX5A 4IHJB 4X20B 5AVMA 4EI7A 1W57A 4BT6A 1K73H 5HY4A 5IYZB 4YJ3A 3VIUA 1Q8RA 3QHDA 1RLGA 1KD1H 1RQ7A 5GINC 1YJWF 5LYJA 2Z1TA 2CHTA 3FFMA 4ZI7B 5IJ9A 1GZ0A 5KMGB 2RHJA 2HRUA 5HP8A 1IPAA 3OBYA 4EB6A 3JCMM 4FFBA 3MDOA 2N48A 2CW4A 3CYQA 3I7TA 3JARA 2ZODA 3CB2A 4YJ3B 5JCOC 2K1SA 3VYUC 5IT9M 2CHSA 2CWJA 4C4WC 2NMUA 3NK7A 5LYJB 4C8GA 5IJ9B 1NJIH 1FSZA 3S0WA 2CVLA 3N4ZA 1W5AA 3PAFA 4EB6B 1JN1A 3NMUC 2H6LA 1KQSF 4FFBB 3WGLA 3WPXA 3S03A 3J81M 1VQVA 2UZHA 3JARB 5GANK 2HP3A 3LMEA 4LNUB 4ZHYB 2LCAA 4X1IA 4O4HA 4F6RA 4TV8A 3TD3A 3V4DA 3WGKA 3WJPA 1M90H 1U40A 1W41A 3V7EA 2ZF8A 3RYHA 3S0YA 1FNJA 4X1YA 4NWOB 3F6MA 3KJJA 2FGYA 2VAPA 1N8RH 2AMTA 4X3MA 3VYTC 4C8EA 1UI9A 4ZOLB 1YI2F 3JASA 1XV2A 4U3JB 4X1IB 3SIUA 4O4HB 2MQEA 2PHNA 3Q8HA 4XCQA 2OTJF 1TVKA 1T0AA 2LBWA 1W2BF 2KTVA 3JALA 4G4VA 3CPQA 1W40A 1DT9A 1VQ7F 2RB9A 3HAXD 1W42A 3JAKB 2HQSC 1JY8A 2UYJA 1YQNA 1W55A 2KTUA 1X52A 5LOVA 5CA0B 2RHLA 4BT7A 1VQ8F 3UT5B 4LCKA 1QD9A 4G4WA 1VQ9F 4TV9B 4G4YA 2VAWA 3CCLF 5JH7A 2CSLA 2UYPA 3CXCF 2LBXA 1OFUA 1GO1A 1W5EA 3JALB 5J2TA 2FC3A 4BW0B 3WXMB 3RYCA 2GZLA 3ZOPA 3MQWA 5MN4A 4PWTA 4EI9A 3HKDB 5EIBD 3D01A 4X20A 1Q81H 3IKEA 4IIJA 2VGNA 3ZO8A 3FBAA 5IYZA 5JH7B 2ALEA 3LFOA 1YITF 1VQ5F 3T80A 3ESJA 2JNBA 3U0OA 3HKBA 2I6DA 4ZI7A 5J2TB 1W59A 5KMGA 1SA0A 3RYCB 2OTLF 1M1KH 3VOBA 3LWOC 4O2AB 2UYNA 2AIFA 1CLIA 5LXTA 3QTYA 5FNVB 3HKCA 3V7QA 3R0PA 4IIJB 4X3LA 5HY0A 4WBNA 2DYYA 3KJKA 4B62A 4ZHQA 2W8BC 3E22A 1SDSA 5A2QM 4C81A 2ZVZA 1U3PA 3HKBB 5EB0A 1FNKA 1SA0B 2CZWA 1U3LA 2Z1UA 3B6NA 3F0FA 1DBFA 3G6EF 3ON1A 3CD6F 2UYNB 4BY9D 5LXTB 2H8CA 3HKCB 4WBNB 3CMEF 5CA1B 1JFFA 1VQMF 4EI8A 4ZHQB 4BT3A 3ERNA 3E22B 4LNUA 3GYQA 3IKFA 4ZHWA 3ZP4A 3FD5A 2H8EA 3N4YA 3MBMA 3LWRC 3O85A 3SIVA 3JATA 1IV3A 5LA6A 3S02A 1KC8H 4I55B 3I56F 1JFFB 1QAHA 2OHWA 5IJ0A 3CG6A 4O4IA 4ZOLA 3ZP7A 1W5BA 2EWCA 3FD6A 1E7KA 4U3JA 1TUBA 3JAMM 2I6RA 3V3TA 1IV1A 2GVIA 3JVHA 3C9UA 3JAWA 3C9RA 1FFXA 4RHAA 3JATB 1NQ3A 5LA6B 3CCUF 3WGNA 2VXYA 5JVDB 5IJ0B 4O4IB 5C8YA 3JAKA 3M1XA 5LP6B 4TUYB 3GHZA 5EYPA 3VOAA 3CC2F 2HX0A 1QVFF 1TUBB 5CA0A 1X25A 3IR9A 1J7HA 1K9MH 3UT5A 3JAWB 5GONA 4TV9A 5MN5A 1W3EX 1FFXB 3CMAF 3NK6A 1YJ9F 4YJ2A 2BTOA 1ODEA 5JQGA 2ZOVA 5C8YB 1Q82H 1PF5A 4X1KA 1IV2A 5EYPB 1R1MA 2HS0A 3WPWA 4DRXB 1YGYA 3HKDA 3KHNA 3I55F 4NUTA 5GONB 3CCVF 4I4TA 3RYIB 4G4XA 5J2UB 4ZHVA 1VQPF 3NVIB 3RYFA 1XBIA 2HP0A 3EORA 3HKEA 4YJ2B 5JQGB 3WJRA 4BVQA 2BTUA 2V9YA 5EZYA 5G4VC 1VQNF 5G4UC 4X1KB 4BVRA 3M84A 4O2AA 1KNJA 5FNVA 5CB4A 1ZWZA 1JJ2F 1JD1A 3C8LA 3N2KB 2YYEA 2BTQB 2RHOA 5HWEA 2R751 4I4TB 4TZZA 4BT2A 3VMFB 1RA4A 5DCVA 3WJQA 3RYFB 2HP0B 3HKEB 3IEWA 3CYPB 2VAMA 3FPIA 5ITZA 5GIOC 5EZYB 1W5FA 2IAFA 3BYQA 2B33A 5CB4B 4U39A 2Q1XA 5HY1A 3P4EA 2HS4A 5CA1A 3C9TA 4G4ZA 2BO1A 1IV4A 1NMUB 3HWUA 3L7QA
chains in the Genus database with same CATH topology
3SIVA 1YI2F 3RA5A 1KC8H 3NVKE 3SIUA 3I56F 2OHWA 3CG6A 1GO0A 3CCQF 2KG4A 2WALA 3J7AR 4XCQA 2OTJF 1E7KA 3CCSF 3JAMM 3V3TA 3E1YA 2F9ZC 2LBWA 5HXZA 1W2BF 2KTVA 3CPQA 1W40A 1DT9A 1VQ7F 2HVYD 3HAXD 1W42A 1S72F 1YIJF 3CCUF 1YJNF 2KTUA 1X52A 1CN7A 5GIPC 3HJWC 1VQ8F 3PLAC 1X7OA 1VQ9F 4LCKA 1VQLF 3CC2F 1QVFF 2QEXF 2QA4F 1VQ4F 3CCLF 3IR9A 1PXWA 3CXCF 1K9MH 2LBXA 3OBWA 4NQ3A 1GO1A 3D00A 1K8AH 3LWVC 4EI7A 2FC3A 2QI2A 4BW0B 3WXMB 1W3EX 5HXUA 3VI6A 1Q86H 3CMAF 3RA6A 1K73H 5HY4A 4EI9A 3NK6A 1YJ9F 1VQOF 1RLGA 1Q81H 5GINC 1YJWF 1KD1H 3CCEF 1Q82H 3AGKA 2VGNA 4BVSA 3LWQC 3FFMA 1X7PA 1GZ0A 2ALEA 3I55F 3LFOA 4NUTA 1IPAA 3OBYA 1YITF 1VQ5F 3JCMM 2JNBA 3CCRF 2I6DA 3CCVF 5EWRA 3OW2F 1VQKF 2OTLF 1M1KH 3LWOC 1VQPF 2OZBA 3MCAB 2AIFA 2VGMA 3G71F 3NVIB 1XBIA 4BVTA 5IT9M 3V7QA 4BVQA 3CCJF 1VQ6F 1VQNF 3E20B 4X3LA 5HY0A 1CK2A 5G4VC 4C4WC 3NK7A 5FLXM 5G4UC 4BVRA 1NJIH 1SDSA 3N4ZA 5A2QM 1ZWZA 1JJ2F 3CC7F 3PAFA 3NMUC 1KQSF 5HWEA 3CPWF 4TZZA 5EO3A 1RA4A 3J81M 2CZWA 3VMFB 3CCMF 5DCVA 5GANK 3G6EF 3ON1A 3CD6F 4BY9D 3CC4F 3G4SF 1T0KB 5GIOC 5FJ4C 3CMEF 1VQMF 4EI8A 1M90H 2GLZA 1H7MA 3GYQA 1W41A 1Q7YH 5HY1A 3V7EA 1QVGF 1YHQF 2FGYA 3N4YA 2BO1A 1N8RH 4X3MA 1NMUB 3J80M 3O85A 5GAPK 3LWRC 5HY2A 3LWPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIV A;  1YI2 F;  3RA5 A;  1KC8 H;  3NVK E;  3SIU A;  3I56 F;  2OHW A;  3CG6 A;  1GO0 A;  3CCQ F;  2KG4 A;  2WAL A;  3J7A R;  2OTJ F;  1E7K A;  3CCS F;  3JAM M;  3E1Y A;  2LBW A;  1W2B F;  2KTV A;  3CPQ A;  1W40 A;  1DT9 A;  1VQ7 F;  2HVY D;  3HAX D;  1W42 A;  1S72 F;  1YIJ F;  3CCU F;  1YJN F;  2KTU A;  1X52 A;  1CN7 A;  5GIP C;  3HJW C;  1VQ8 F;  3PLA C;  1X7O A;  1VQ9 F;  4LCK A;  1VQL F;  3CC2 F;  1QVF F;  2QEX F;  2QA4 F;  1VQ4 F;  3CCL F;  3IR9 A;  1PXW A;  3CXC F;  1K9M H;  2LBX A;  3OBW A;  1GO1 A;  1K8A H;  3LWV C;  2FC3 A;  2QI2 A;  4BW0 B;  3WXM B;  1W3E X;  3VI6 A;  1Q86 H;  3CMA F;  3RA6 A;  1K73 H;  3NK6 A;  1YJ9 F;  1VQO F;  1RLG A;  1Q81 H;  5GIN C;  1YJW F;  1KD1 H;  3CCE F;  1Q82 H;  3AGK A;  2VGN A;  3LWQ C;  3FFM A;  1X7P A;  1GZ0 A;  2ALE A;  3I55 F;  3LFO A;  4NUT A;  1IPA A;  3OBY A;  1YIT F;  1VQ5 F;  3JCM M;  2JNB A;  3CCR F;  2I6D A;  3CCV F;  5EWR A;  3OW2 F;  1VQK F;  2OTL F;  1M1K H;  3LWO C;  1VQP F;  2OZB A;  3MCA B;  2AIF A;  2VGM A;  3G71 F;  3NVI B;  1XBI A;  5IT9 M;  3V7Q A;  3CCJ F;  1VQ6 F;  1VQN F;  5G4V C;  3E20 B;  4X3L A;  1CK2 A;  4C4W C;  5G4U C;  3NK7 A;  5FLX M;  1NJI H;  1SDS A;  5A2Q M;  3N4Z A;  1ZWZ A;  1JJ2 F;  3CC7 F;  3PAF A;  3NMU C;  1KQS F;  3CPW F;  4TZZ A;  5EO3 A;  1RA4 A;  3J81 M;  2CZW A;  3VMF B;  3CCM F;  5DCV A;  5GAN K;  3G6E F;  3ON1 A;  3CD6 F;  4BY9 D;  3CC4 F;  3G4S F;  1T0K B;  5GIO C;  5FJ4 C;  3CME F;  1VQM F;  1M90 H;  1H7M A;  3GYQ A;  1W41 A;  1Q7Y H;  3V7E A;  1QVG F;  1YHQ F;  3N4Y A;  2BO1 A;  1N8R H;  4X3M A;  1NMU B;  3J80 M;  3O85 A;  5GAP K;  3LWR C;  3LWP C; 
#chains in the Genus database with same CATH topology
 5MN6 A;  2IG8 A;  3I3F A;  5ITZ B;  3RA5 A;  3NVK E;  1XHO A;  5EAZ A;  1GO0 A;  3CCQ F;  3S0H A;  2KG4 A;  3J7A R;  4O4L A;  4C8I A;  3DC2 A;  4B5C A;  4I55 A;  3CCS F;  1H48 A;  3E1Y A;  5HXZ A;  3RE3 A;  3C9S A;  4C82 A;  3N2G A;  2HVY D;  1KNK A;  2OTM A;  3HTN A;  2QTP A;  3KE1 A;  1YJN F;  2DT4 A;  2AIZ P;  1CN7 A;  3PLA C;  1X7O A;  4O4L B;  5KX5 B;  2QA4 F;  5JVD A;  1VQ4 F;  4M8I A;  4B46 A;  3VTI C;  5LP6 A;  3IMP A;  1W58 1;  3D00 A;  4TUY A;  1U43 A;  3LWV C;  1SZQ A;  3N2G B;  2QI2 A;  5EIB C;  3VYS C;  5HXU A;  3VI6 A;  1Q86 H;  2R6R 1;  3RA6 A;  3WGJ A;  4B45 A;  1VQO F;  2Z01 A;  1UFY A;  3CCE F;  3KIZ A;  2Z1E A;  3AGK A;  4BVS A;  3LWQ C;  1X7P A;  5BMV A;  1VHA A;  3P10 A;  4O2B A;  1RQ2 A;  2ZAU A;  3CCR F;  1COM A;  4DRX A;  5EWR A;  3OW2 F;  1VQK F;  2OZB A;  3MCA B;  2VGM A;  3F0D A;  3F0G A;  4KWE A;  3G71 F;  4BVT A;  4O4J A;  3CCJ F;  1VQ6 F;  4G88 A;  3RYI A;  3E20 B;  1CK2 A;  5J2U A;  5FLX M;  1ONI A;  3QUW A;  5BMV B;  3OON A;  1OAP A;  4O2B B;  3ELC A;  1QU9 A;  1XRG A;  3VCZ A;  2UYK A;  3CC7 F;  4ERH A;  2LBT A;  3K2X A;  3CPW F;  3K14 A;  4BT4 A;  4HNA A;  3MCQ A;  5EO3 A;  3CCM F;  2KGW A;  4F6R B;  4TV8 B;  3N2K A;  3CC4 F;  3G4S F;  1T0K B;  4O4J B;  2IQQ A;  3TD4 A;  5FJ4 C;  2G9I A;  3RYH B;  4X1Y B;  5JCO A;  2GLZ A;  2P6Y A;  1H7M A;  2Z1F A;  1Q7Y H;  4R40 B;  3TD5 A;  3IEQ A;  4RQO A;  1H47 A;  1QVG F;  3WGM A;  1VH8 A;  3JAS B;  1YHQ F;  4HNA B;  4BT5 A;  1VK3 A;  3F0E A;  3LDT A;  3J80 M;  2YXZ A;  5GAP K;  3VO8 A;  5HY2 A;  3LWP C;  2PMP A;  1RLU A;  2HRY A;  5HP7 A;  4ZK7 A;  1TVK B;  3K12 A;  5EB1 B;  3P0Z A;  4I50 A;  2WAL A;  5LP6 C;  2Q1Y A;  1Z5V A;  2F9Z C;  3LYB A;  5B8F A;  5LOV B;  4IHJ A;  3DDN A;  2ZVY A;  1S72 F;  1YIJ F;  3K0T A;  3D54 A;  5GIP C;  3HJW C;  2L26 A;  1Z5W A;  4I50 B;  1VQL F;  3S06 A;  2QEX F;  3M4S A;  2HS3 A;  4E6E A;  2RHH A;  3GTZ A;  1PXW A;  4DXD A;  3OBW A;  1GX1 A;  4NQ3 A;  1K8A H;  5KX5 A;  4IHJ B;  4X20 B;  5AVM A;  4EI7 A;  1W57 A;  4BT6 A;  1K73 H;  5HY4 A;  5IYZ B;  4YJ3 A;  3VIU A;  1Q8R A;  3QHD A;  1RLG A;  1KD1 H;  1RQ7 A;  5GIN C;  1YJW F;  5LYJ A;  2Z1T A;  2CHT A;  3FFM A;  4ZI7 B;  5IJ9 A;  1GZ0 A;  5KMG B;  2RHJ A;  2HRU A;  5HP8 A;  1IPA A;  3OBY A;  4EB6 A;  3JCM M;  4FFB A;  3MDO A;  2N48 A;  2CW4 A;  3CYQ A;  3I7T A;  3JAR A;  2ZOD A;  3CB2 A;  4YJ3 B;  5JCO C;  2K1S A;  3VYU C;  5IT9 M;  2CHS A;  2CWJ A;  4C4W C;  2NMU A;  3NK7 A;  5LYJ B;  4C8G A;  5IJ9 B;  1NJI H;  1FSZ A;  3S0W A;  2CVL A;  3N4Z A;  1W5A A;  3PAF A;  4EB6 B;  1JN1 A;  3NMU C;  2H6L A;  1KQS F;  4FFB B;  3WGL A;  3WPX A;  3S03 A;  3J81 M;  1VQV A;  2UZH A;  3JAR B;  5GAN K;  2HP3 A;  3LME A;  4LNU B;  4ZHY B;  2LCA A;  4X1I A;  4O4H A;  4F6R A;  4TV8 A;  3TD3 A;  3V4D A;  3WGK A;  3WJP A;  1M90 H;  1U40 A;  1W41 A;  3V7E A;  2ZF8 A;  3RYH A;  3S0Y A;  1FNJ A;  4X1Y A;  4NWO B;  3F6M A;  3KJJ A;  2FGY A;  2VAP A;  1N8R H;  2AMT A;  4X3M A;  3VYT C;  4C8E A;  1UI9 A;  4ZOL B;  1YI2 F;  3JAS A;  1XV2 A;  4U3J B;  4X1I B;  3SIU A;  4O4H B;  2MQE A;  2PHN A;  3Q8H A;  4XCQ A;  2OTJ F;  1TVK A;  1T0A A;  2LBW A;  1W2B F;  2KTV A;  3JAL A;  4G4V A;  3CPQ A;  1W40 A;  1DT9 A;  1VQ7 F;  2RB9 A;  3HAX D;  1W42 A;  3JAK B;  2HQS C;  1JY8 A;  2UYJ A;  1YQN A;  1W55 A;  2KTU A;  1X52 A;  5LOV A;  5CA0 B;  2RHL A;  4BT7 A;  1VQ8 F;  3UT5 B;  4LCK A;  1QD9 A;  4G4W A;  1VQ9 F;  4TV9 B;  4G4Y A;  2VAW A;  3CCL F;  5JH7 A;  2CSL A;  2UYP A;  3CXC F;  2LBX A;  1OFU A;  1GO1 A;  1W5E A;  3JAL B;  5J2T A;  2FC3 A;  4BW0 B;  3WXM B;  3RYC A;  2GZL A;  3ZOP A;  3MQW A;  5MN4 A;  4PWT A;  4EI9 A;  3HKD B;  5EIB D;  3D01 A;  4X20 A;  1Q81 H;  3IKE A;  4IIJ A;  2VGN A;  3ZO8 A;  3FBA A;  5IYZ A;  5JH7 B;  2ALE A;  3LFO A;  1YIT F;  1VQ5 F;  3T80 A;  3ESJ A;  2JNB A;  3U0O A;  3HKB A;  2I6D A;  4ZI7 A;  5J2T B;  1W59 A;  5KMG A;  1SA0 A;  3RYC B;  2OTL F;  1M1K H;  3VOB A;  3LWO C;  4O2A B;  2UYN A;  2AIF A;  1CLI A;  5LXT A;  3QTY A;  5FNV B;  3HKC A;  3V7Q A;  3R0P A;  4IIJ B;  4X3L A;  5HY0 A;  4WBN A;  2DYY A;  3KJK A;  4B62 A;  4ZHQ A;  2W8B C;  3E22 A;  1SDS A;  5A2Q M;  4C81 A;  2ZVZ A;  1U3P A;  3HKB B;  5EB0 A;  1FNK A;  1SA0 B;  2CZW A;  1U3L A;  2Z1U A;  3B6N A;  3F0F A;  1DBF A;  3G6E F;  3ON1 A;  3CD6 F;  2UYN B;  4BY9 D;  5LXT B;  2H8C A;  3HKC B;  4WBN B;  3CME F;  5CA1 B;  1JFF A;  1VQM F;  4EI8 A;  4ZHQ B;  4BT3 A;  3ERN A;  3E22 B;  4LNU A;  3GYQ A;  3IKF A;  4ZHW A;  3ZP4 A;  3FD5 A;  2H8E A;  3N4Y A;  3MBM A;  3LWR C;  3O85 A;  3SIV A;  3JAT A;  1IV3 A;  5LA6 A;  3S02 A;  1KC8 H;  4I55 B;  3I56 F;  1JFF B;  1QAH A;  2OHW A;  5IJ0 A;  3CG6 A;  4O4I A;  4ZOL A;  3ZP7 A;  1W5B A;  2EWC A;  3FD6 A;  1E7K A;  4U3J A;  1TUB A;  3JAM M;  2I6R A;  3V3T A;  1IV1 A;  2GVI A;  3JVH A;  3C9U A;  3JAW A;  3C9R A;  1FFX A;  4RHA A;  3JAT B;  1NQ3 A;  5LA6 B;  3CCU F;  3WGN A;  2VXY A;  5JVD B;  5IJ0 B;  4O4I B;  5C8Y A;  3JAK A;  3M1X A;  5LP6 B;  4TUY B;  3GHZ A;  5EYP A;  3VOA A;  3CC2 F;  2HX0 A;  1QVF F;  1TUB B;  5CA0 A;  1X25 A;  3IR9 A;  1J7H A;  1K9M H;  3UT5 A;  3JAW B;  5GON A;  4TV9 A;  5MN5 A;  1W3E X;  1FFX B;  3CMA F;  3NK6 A;  1YJ9 F;  4YJ2 A;  2BTO A;  1ODE A;  5JQG A;  2ZOV A;  5C8Y B;  1Q82 H;  1PF5 A;  4X1K A;  1IV2 A;  5EYP B;  1R1M A;  2HS0 A;  3WPW A;  4DRX B;  1YGY A;  3HKD A;  3KHN A;  3I55 F;  4NUT A;  5GON B;  3CCV F;  4I4T A;  3RYI B;  4G4X A;  5J2U B;  4ZHV A;  1VQP F;  3NVI B;  3RYF A;  1XBI A;  2HP0 A;  3EOR A;  3HKE A;  4YJ2 B;  5JQG B;  3WJR A;  4BVQ A;  2BTU A;  2V9Y A;  5EZY A;  5G4V C;  1VQN F;  5G4U C;  4X1K B;  4BVR A;  3M84 A;  4O2A A;  1KNJ A;  5FNV A;  5CB4 A;  1ZWZ A;  1JJ2 F;  1JD1 A;  3C8L A;  3N2K B;  2YYE A;  2BTQ B;  2RHO A;  5HWE A;  2R75 1;  4I4T B;  4TZZ A;  4BT2 A;  3VMF B;  1RA4 A;  5DCV A;  3WJQ A;  3RYF B;  2HP0 B;  3HKE B;  3IEW A;  3CYP B;  2VAM A;  3FPI A;  5ITZ A;  5GIO C;  5EZY B;  1W5F A;  2IAF A;  3BYQ A;  2B33 A;  5CB4 B;  4U39 A;  2Q1X A;  5HY1 A;  3P4E A;  2HS4 A;  5CA1 A;  3C9T A;  4G4Z A;  2BO1 A;  1IV4 A;  1NMU B;  3HWU A;  3L7Q A; 
#chains in the Genus database with same CATH homology
 3SIV A;  1YI2 F;  3RA5 A;  1KC8 H;  3NVK E;  3SIU A;  3I56 F;  2OHW A;  3CG6 A;  1GO0 A;  3CCQ F;  2KG4 A;  2WAL A;  3J7A R;  4XCQ A;  2OTJ F;  1E7K A;  3CCS F;  3JAM M;  3V3T A;  3E1Y A;  2F9Z C;  2LBW A;  5HXZ A;  1W2B F;  2KTV A;  3CPQ A;  1W40 A;  1DT9 A;  1VQ7 F;  2HVY D;  3HAX D;  1W42 A;  1S72 F;  1YIJ F;  3CCU F;  1YJN F;  2KTU A;  1X52 A;  1CN7 A;  5GIP C;  3HJW C;  1VQ8 F;  3PLA C;  1X7O A;  1VQ9 F;  4LCK A;  1VQL F;  3CC2 F;  1QVF F;  2QEX F;  2QA4 F;  1VQ4 F;  3CCL F;  3IR9 A;  1PXW A;  3CXC F;  1K9M H;  2LBX A;  3OBW A;  4NQ3 A;  1GO1 A;  3D00 A;  1K8A H;  3LWV C;  4EI7 A;  2FC3 A;  2QI2 A;  4BW0 B;  3WXM B;  1W3E X;  5HXU A;  3VI6 A;  1Q86 H;  3CMA F;  3RA6 A;  1K73 H;  5HY4 A;  4EI9 A;  3NK6 A;  1YJ9 F;  1VQO F;  1RLG A;  1Q81 H;  5GIN C;  1YJW F;  1KD1 H;  3CCE F;  1Q82 H;  3AGK A;  2VGN A;  4BVS A;  3LWQ C;  3FFM A;  1X7P A;  1GZ0 A;  2ALE A;  3I55 F;  3LFO A;  4NUT A;  1IPA A;  3OBY A;  1YIT F;  1VQ5 F;  3JCM M;  2JNB A;  3CCR F;  2I6D A;  3CCV F;  5EWR A;  3OW2 F;  1VQK F;  2OTL F;  1M1K H;  3LWO C;  1VQP F;  2OZB A;  3MCA B;  2AIF A;  2VGM A;  3G71 F;  3NVI B;  1XBI A;  4BVT A;  5IT9 M;  3V7Q A;  4BVQ A;  3CCJ F;  1VQ6 F;  1VQN F;  3E20 B;  4X3L A;  5HY0 A;  1CK2 A;  5G4V C;  4C4W C;  3NK7 A;  5FLX M;  5G4U C;  4BVR A;  1NJI H;  1SDS A;  3N4Z A;  5A2Q M;  1ZWZ A;  1JJ2 F;  3CC7 F;  3PAF A;  3NMU C;  1KQS F;  5HWE A;  3CPW F;  4TZZ A;  5EO3 A;  1RA4 A;  3J81 M;  2CZW A;  3VMF B;  3CCM F;  5DCV A;  5GAN K;  3G6E F;  3ON1 A;  3CD6 F;  4BY9 D;  3CC4 F;  3G4S F;  1T0K B;  5GIO C;  5FJ4 C;  3CME F;  1VQM F;  4EI8 A;  1M90 H;  2GLZ A;  1H7M A;  3GYQ A;  1W41 A;  1Q7Y H;  5HY1 A;  3V7E A;  1QVG F;  1YHQ F;  2FGY A;  3N4Y A;  2BO1 A;  1N8R H;  4X3M A;  1NMU B;  3J80 M;  3O85 A;  5GAP K;  3LWR C;  5HY2 A;  3LWP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...