1YJWF

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yjwF00
3N4ZA 1YITF 3O85A 1H7MA 5A2QM 4TZZA 1KQSF 3HAXD 1T0KB 2WALA 5DCVA 2OHWA 3JAMM 3GYQA 1K9MH 3NMUC 1K8AH 1X7PA 2VGMA 2OTLF 3V7QA 5GINC 3NVKE 1S72F 1E7KA 1X7OA 1CK2A 3CMAF 3SIVA 1RLGA 1PXWA 5IT9M 3OW2F 1M90H 1W3EX 1W2BF 1Q82H 2KTVA 2VGNA 1YHQF 2LBXA 3LWVC 2JNBA 1VQ8F 1QVFF 1DT9A 1JJ2F 2QEXF 3NVIB 1Q7YH 1ZWZA 3NK6A 2LBWA 1VQOF 2ALEA 2QI2A 1NMUB 3CMEF 5GIPC 1W40A 1VQ7F 3CCEF 3CD6F 3SIUA 1KD1H 3CCSF 1KC8H 1NJIH 3CC2F 3OBWA 3ON1A 3G4SF 1VQLF 1GO1A 3V7EA 1Q86H 4LCKA 4BW0B 1X52A 1VQKF 1W41A 2FC3A 1QVGF 3CCQF 1YJ9F 1M1KH 1CN7A 5GANK 3J81M 3FFMA 3CCRF 4NUTA 1YIJF 3G71F 1XBIA 5FLXM 1VQPF 4C4WC 3VI6A 5G4UC 3IR9A 3CC7F 5EWRA 3CCVF 1K73H 5G4VC 1W42A 3MCAB 3CG6A 1RA4A 3G6EF 3CCJF 1GZ0A 1GO0A 3J80M 3CPWF 3WXMB 2I6DA 2BO1A 3I56F 1VQ9F 3E20B 2HVYD 1SDSA 3CPQA 1YJNF 2OTJF 5GIOC 3AGKA 3PLAC 5FJ4C 5GAPK 3E1YA 2OZBA 4X3MA 3CCLF 3CCMF 3VMFB 1YI2F 1VQ4F 3CCUF 3I55F 3LFOA 2KTUA 3N4YA 3J7AR 1VQ6F 2AIFA 1VQNF 3LWQC 2CZWA 3NK7A 3LWRC 4BY9D 3CC4F 3OBYA 3CXCF 3JCMM 3RA6A 1IPAA 2QA4F 1N8RH 3RA5A 4X3LA 3LWOC 1VQMF 3LWPC 5EO3A 1YJWF 3PAFA 3HJWC 1Q81H 1VQ5F 2KG4A
chains in the Genus database with same CATH superfamily
1H7MA 3RE3A 5KMGB 5BMVA 3HAXD 5DCVA 1ONIA 5JH7A 4O4LB 3C9RA 3D54A 5JVDB 3V7QA 3T80A 4FFBA 1RQ2A 4O4JB 2FGYA 3CMAF 2DYYA 3I7TA 4YJ2B 3RYHA 5LP6B 1OAPA 1W3EX 3QTYA 1W2BF 1W5EA 2ZF8A 4XCQA 1YHQF 1IV3A 4U3JB 1VK3A 4ZOLB 2GVIA 3TD5A 2VAMA 2H8EA 3VOAA 4G88A 3JAKB 5JCOC 5J2TB 1JJ2F 3F0GA 3FD6A 2HP0B 5GONB 4I4TB 3NVIB 2LBTA 5C8YB 4HNAB 4C8GA 3FBAA 2G9IA 5JQGB 2P6YA 2AIZP 5GIPC 1W40A 3CCEF 3CD6F 3C9TA 4O2AB 1COMA 2RHJA 4RHAA 3CC2F 2HS0A 2QTPA 5ITZB 4BT7A 2GLZA 4EI7A 3JASB 3V7EA 4O4IB 5HY1A 4PWTA 2Z1FA 3F0EA 1FNJA 4BW0B 1W41A 3WGMA 1QVGF 5HP8A 1JN1A 3CCRF 4TV9B 2BTOA 5LXTB 1VQVA 3HTNA 1VQPF 3VI6A 3IR9A 5IJ0B 1ODEA 3M4SA 5EIBD 3MBMA 3VOBA 3HKDB 3K12A 3WXMB 3M84A 2I6DA 1IV2A 3LYBA 4TV8A 2Z01A 3QUWA 3E20B 4EB6B 2CW4A 1UFYA 4BVQA 5HXUA 5KX5B 3WGNA 4YJ3A 4C82A 5FJ4C 5GAPK 4U39A 5CB4B 2R6R1 4B45A 5B8FA 2BTQB 4G4ZA 4B62A 1OFUA 3RYCA 3VMFB 4LNUA 3VCZA 4M8IA 5AVMA 4ZHYB 1W5AA 1TUBB 1JFFB 3I55F 2KTUA 3N4YA 1IV4A 4DRXB 3S02A 5IYZA 1TVKB 3IMPA 1SZQA 3RA6A 4WBNA 2LCAA 4I50B 4X3LA 4O2BA 3WGKA 3F0FA 1VQMF 2RHOA 1Q81H 3K2XA 1U40A 3JALA 4X1YB 5A2QM 1T0KB 2WALA 1CLIA 3GYQA 5HY4A 1UI9A 1XV2A 5EIBC 3JATA 3IEQA 2B33A 5HY2A 1QAHA 5LYJA 3NVKE 1S72F 3N2KB 3RYIA 1CK2A 4X1KB 1PXWA 2I6RA 3S06A 1M90H 5IT9M 2UYJA 2UZHA 4C8IA 3WGJA 2VGNA 1X25A 3ERNA 5EYPA 4O4HB 1W59A 2MQEA 4KWEA 1VQ8F 3MQWA 2AMTA 2ZVYA 3N2GB 3C9SA 2QEXF 1Q7YH 5LOVB 5LA6B 3F6MA 4E6EA 4IIJA 2ZVZA 1VQOF 2IQQA 3ZOPA 4RQOA 4X20B 4BVSA 3SIUA 5CA1B 4G4VA 3RYFA 3FPIA 3CYPB 4ZHQB 5J2UA 3E22B 3KHNA 1PF5A 3S03A 2H6LA 1VQLF 2OTMA 3CB2A 5IJ9A 4X1IB 3CCQF 1M1KH 1YQNA 5GANK 4I55A 3CYQA 3FFMA 3QHDA 4NUTA 1XRGA 2UYNB 4B5CA 5FLXM 3HKCA 1KNKA 3CC7F 5G4VC 4ZHVA 3VO8A 3VYSC 2IG8A 1RA4A 2F9ZC 3G6EF 4BT6A 3V4DA 2Z1TA 3J80M 1IV1A 3CPWF 4IHJA 2NMUA 3L7QA 4ZI7A 2BO1A 3I56F 2H8CA 4F6RB 2ZODA 2EWCA 4DXDA 5CA0B 1VQ9F 4YJ3B 3CPQA 4G4WA 5EZYB 3E1YA 3LMEA 3S0HA 2OZBA 5KMGA 4X3MA 3HKBB 3CCLF 1W57A 3LDTA 1YI2F 4O4LA 5JVDA 3C8LA 3LFOA 3M1XA 3J7AR 5MN6A 5IYZB 2AIFA 1VQNF 3BYQA 1QD9A 1W5FA 3KE1A 3UT5B 2VXYA 3JCMM 4WBNB 4YJ2A 1SA0A 3RA5A 1FFXB 3FD5A 4ZK7A 2CHTA 3GTZA 3P0ZA 4ZOLA 4C8EA 1YJWF 1Z5WA 5HWEA 1W5BA 1YITF 2RHHA 3JAKA 3JAMM 2HQSC 5GONA 4I4TA 5C8YA 4HNAA 4C81A 2N48A 4EI9A 1QU9A 4ZHWA 3WPXA 1X7OA 5HXZA 2BTUA 1RLGA 1J7HA 3OW2F 2YYEA 5ITZA 2ZOVA 1Q82H 3ZO8A 2RHLA 4O4IA 3D00A 2RB9A 2CHSA 3JARA 2JNBA 1RQ7A 5BMVB 1VH8A 3KJJA 3IEWA 3MDOA 1QVFF 3B6NA 1VHAA 4TV9A 5LXTA 5JH7B 4IIJB 4BT4A 2DT4A 2LBWA 2QI2A 5EAZA 4FFBB 5EB0A 3V3TA 3GHZA 1XHOA 3VYUC 3HKDA 3WJQA 1KD1H 2Z1EA 1KC8H 2CSLA 3RYHB 3WJRA 3JVHA 3KIZA 3OBWA 3G4SF 4EB6A 2Q1YA 1Q86H 2VAPA 1X52A 5KX5A 4R40B 5MN4A 1CN7A 4BVTA 5CB4A 3J81M 1YGYA 5JCOA 1YIJF 4C4WC 1XBIA 5G4UC 1H48A 1TUBA 1JFFA 5EWRA 1K73H 5FNVA 3D01A 4DRXA 5EB1B 5MN5A 1W42A 3MCAB 1Q8RA 1TVKA 3CCJF 1U3PA 2UYKA 4ZI7B 3K14A 3IKFA 3HKEA 3MCQA 4I50A 2YXZA 2HVYD 1FNKA 4TUYA 1YJNF 2L26A 4BVRA 3AGKA 3PLAC 3JAWA 3F0DA 4X1YA 1H47A 2HS4A 4BT5A 1W581 3HJWC 4BT3A 1RLUA 1VQ4F 1U43A 1GX1A 3LWRC 4BY9D 3HWUA 2UYPA 3N2KA 4TV8B 1SA0B 1IPAA 1T0AA 4X1KA 3IKEA 1N8RH 1JY8A 1JD1A 2VAWA 3C9UA 3DDNA 2Q1XA 2PMPA 4O4HA 2KG4A 3N4ZA 5HY0A 3O85A 4EI8A 4TZZA 1KQSF 1FSZA 3ZP7A 3RYCB 2OHWA 4LNUB 3N2GA 1K9MH 3WJPA 3S0WA 3NMUC 1K8AH 1X7PA 5LOVA 3Q8HA 5LA6A 2VGMA 2OTLF 5GINC 2ZAUA 4X20A 1E7KA 3OONA 5CA1A 3S0YA 3SIVA 4O4JA 4ZHQA 3WGLA 3E22A 2Z1UA 5LP6A 4O2BB 3TD3A 1Z5VA 2KTVA 2LBXA 3JARB 4U3JA 3LWVC 3JALB 4X1IA 3DC2A 1DT9A 5J2TA 2UYNA 3JATB 4NQ3A 1ZWZA 2HP0A 3NK6A 2ALEA 1NMUB 3CMEF 5JQGA 3I3FA 5LYJB 1VQ7F 3RYIB 3CCSF 4O2AA 1NJIH 2GZLA 2K1SA 4B46A 4F6RA 3ON1A 5CA0A 4G4XA 1GO1A 3P4EA 3JASA 5EYPB 3U0OA 5EZYA 4LCKA 2HRUA 1VQKF 2FC3A 1YJ9F 1W55A 3VYTC 3K0TA 3HKBA 3G71F 5HP7A 5FNVB 3R0PA 3ZP4A 2IAFA 3CCVF 2W8BC 5IJ0A 1KNJA 3TD4A 3CG6A 2CVLA 1U3LA 3RYFB 1GZ0A 3HKEB 1GO0A 2R751 4NWOB 5J2UB 4G4YA 3UT5A 2HRYA 5LP6C 2HX0A 2HS3A 1R1MA 2KGWA 4TUYB 1FFXA 1SDSA 2PHNA 5IJ9B 2OTJF 5GIOC 1DBFA 3JAWB 4I55B 3VIUA 2CWJA 2HP3A 3CCMF 1NQ3A 4BT2A 3HKCB 3CCUF 1VQ6F 3LWQC 2CZWA 3NK7A 3ELCA 3VTIC 3CC4F 3OBYA 3WPWA 3CXCF 4IHJB 4ERHA 3P10A 2QA4F 3LWOC 3EORA 5EO3A 3LWPC 3ESJA 3PAFA 3KJKA 2V9YA 1VQ5F
chains in the Genus database with same CATH topology
3N4ZA 5HY0A 1YITF 3O85A 1H7MA 5A2QM 4EI8A 4TZZA 1KQSF 3HAXD 1T0KB 2WALA 5DCVA 2OHWA 3JAMM 3GYQA 5HY4A 1K9MH 3NMUC 1K8AH 1X7PA 2VGMA 2OTLF 3V7QA 4EI9A 5GINC 5HY2A 3NVKE 1S72F 1E7KA 1X7OA 5HXZA 2FGYA 1CK2A 3CMAF 3SIVA 1RLGA 1PXWA 5IT9M 3OW2F 1M90H 1W3EX 1W2BF 1Q82H 2KTVA 2VGNA 4XCQA 1YHQF 2LBXA 3D00A 3LWVC 2JNBA 1VQ8F 1QVFF 1DT9A 1JJ2F 2QEXF 3NVIB 1Q7YH 4NQ3A 1ZWZA 3NK6A 2LBWA 1VQOF 2ALEA 2QI2A 1NMUB 3CMEF 5GIPC 1W40A 1VQ7F 3CCEF 3CD6F 4BVSA 3SIUA 3V3TA 1KD1H 3CCSF 1KC8H 1NJIH 3CC2F 3OBWA 2GLZA 3ON1A 4EI7A 3G4SF 1VQLF 1GO1A 3V7EA 1Q86H 5HY1A 4LCKA 4BW0B 1X52A 1VQKF 1W41A 2FC3A 1QVGF 3CCQF 1YJ9F 1M1KH 1CN7A 4BVTA 5GANK 3J81M 3FFMA 3CCRF 4NUTA 1YIJF 3G71F 1XBIA 5FLXM 1VQPF 4C4WC 3VI6A 5G4UC 3IR9A 3CC7F 5EWRA 3CCVF 1K73H 5G4VC 1W42A 3MCAB 3CG6A 1RA4A 2F9ZC 3G6EF 3CCJF 1GZ0A 1GO0A 3J80M 3CPWF 3WXMB 2I6DA 2BO1A 3I56F 1VQ9F 3E20B 4BVQA 1SDSA 3CPQA 5HXUA 2HVYD 1YJNF 2OTJF 5GIOC 4BVRA 3AGKA 3PLAC 5FJ4C 5GAPK 3E1YA 2OZBA 4X3MA 3CCLF 3CCMF 3VMFB 1YI2F 1VQ4F 3CCUF 3I55F 3LFOA 2KTUA 3N4YA 3J7AR 1VQ6F 2AIFA 1VQNF 3LWQC 2CZWA 3NK7A 3LWRC 4BY9D 3CC4F 3OBYA 3CXCF 3JCMM 3RA6A 1IPAA 2QA4F 1N8RH 3RA5A 4X3LA 3LWOC 1VQMF 3LWPC 5EO3A 1YJWF 3PAFA 3HJWC 5HWEA 1Q81H 1VQ5F 2KG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Z A;  1YIT F;  3O85 A;  1H7M A;  5A2Q M;  4TZZ A;  1KQS F;  3HAX D;  1T0K B;  2WAL A;  5DCV A;  2OHW A;  3JAM M;  3GYQ A;  1K9M H;  3NMU C;  1K8A H;  1X7P A;  2VGM A;  2OTL F;  3V7Q A;  5GIN C;  3NVK E;  1S72 F;  1E7K A;  1X7O A;  1CK2 A;  3CMA F;  3SIV A;  1RLG A;  1PXW A;  5IT9 M;  3OW2 F;  1M90 H;  1W3E X;  1W2B F;  1Q82 H;  2KTV A;  2VGN A;  1YHQ F;  2LBX A;  3LWV C;  2JNB A;  1VQ8 F;  1QVF F;  1DT9 A;  1JJ2 F;  2QEX F;  3NVI B;  1Q7Y H;  1ZWZ A;  3NK6 A;  2LBW A;  1VQO F;  2ALE A;  2QI2 A;  1NMU B;  3CME F;  5GIP C;  1W40 A;  1VQ7 F;  3CCE F;  3CD6 F;  3SIU A;  1KD1 H;  3CCS F;  1KC8 H;  1NJI H;  3CC2 F;  3OBW A;  3ON1 A;  3G4S F;  1VQL F;  1GO1 A;  3V7E A;  1Q86 H;  4LCK A;  4BW0 B;  1X52 A;  1VQK F;  1W41 A;  2FC3 A;  1QVG F;  3CCQ F;  1YJ9 F;  1M1K H;  1CN7 A;  5GAN K;  3J81 M;  3FFM A;  3CCR F;  4NUT A;  1YIJ F;  3G71 F;  1XBI A;  5FLX M;  1VQP F;  4C4W C;  3VI6 A;  5G4U C;  3IR9 A;  3CC7 F;  5EWR A;  3CCV F;  1K73 H;  5G4V C;  1W42 A;  3MCA B;  3CG6 A;  1RA4 A;  3G6E F;  3CCJ F;  1GZ0 A;  1GO0 A;  3J80 M;  3CPW F;  3WXM B;  2I6D A;  2BO1 A;  3I56 F;  1VQ9 F;  3E20 B;  2HVY D;  1SDS A;  3CPQ A;  1YJN F;  2OTJ F;  5GIO C;  3AGK A;  3PLA C;  5FJ4 C;  5GAP K;  3E1Y A;  2OZB A;  4X3M A;  3CCL F;  3CCM F;  3VMF B;  1YI2 F;  1VQ4 F;  3CCU F;  3I55 F;  3LFO A;  2KTU A;  3N4Y A;  3J7A R;  1VQ6 F;  2AIF A;  1VQN F;  3LWQ C;  2CZW A;  3NK7 A;  3LWR C;  4BY9 D;  3CC4 F;  3OBY A;  3CXC F;  3JCM M;  3RA6 A;  1IPA A;  2QA4 F;  1N8R H;  3RA5 A;  4X3L A;  3LWO C;  1VQM F;  3LWP C;  5EO3 A;  1YJW F;  3PAF A;  3HJW C;  1Q81 H;  1VQ5 F;  2KG4 A; 
#chains in the Genus database with same CATH topology
 1H7M A;  3RE3 A;  5KMG B;  5BMV A;  3HAX D;  5DCV A;  1ONI A;  5JH7 A;  4O4L B;  3C9R A;  3D54 A;  5JVD B;  3V7Q A;  3T80 A;  4FFB A;  1RQ2 A;  4O4J B;  2FGY A;  3CMA F;  2DYY A;  3I7T A;  4YJ2 B;  3RYH A;  5LP6 B;  1OAP A;  1W3E X;  3QTY A;  1W2B F;  1W5E A;  2ZF8 A;  4XCQ A;  1YHQ F;  1IV3 A;  4U3J B;  1VK3 A;  4ZOL B;  2GVI A;  3TD5 A;  2VAM A;  2H8E A;  3VOA A;  4G88 A;  3JAK B;  5JCO C;  5J2T B;  1JJ2 F;  3F0G A;  3FD6 A;  2HP0 B;  5GON B;  4I4T B;  3NVI B;  2LBT A;  5C8Y B;  4HNA B;  4C8G A;  3FBA A;  2G9I A;  5JQG B;  2P6Y A;  2AIZ P;  5GIP C;  1W40 A;  3CCE F;  3CD6 F;  3C9T A;  4O2A B;  1COM A;  2RHJ A;  4RHA A;  3CC2 F;  2HS0 A;  2QTP A;  5ITZ B;  4BT7 A;  2GLZ A;  4EI7 A;  3JAS B;  3V7E A;  4O4I B;  5HY1 A;  4PWT A;  2Z1F A;  3F0E A;  1FNJ A;  4BW0 B;  1W41 A;  3WGM A;  1QVG F;  5HP8 A;  1JN1 A;  3CCR F;  4TV9 B;  2BTO A;  5LXT B;  1VQV A;  3HTN A;  1VQP F;  3VI6 A;  3IR9 A;  5IJ0 B;  1ODE A;  3M4S A;  5EIB D;  3MBM A;  3VOB A;  3HKD B;  3K12 A;  3WXM B;  3M84 A;  2I6D A;  1IV2 A;  3LYB A;  4TV8 A;  2Z01 A;  3QUW A;  3E20 B;  4EB6 B;  2CW4 A;  1UFY A;  4BVQ A;  5HXU A;  5KX5 B;  3WGN A;  4YJ3 A;  4C82 A;  5FJ4 C;  5GAP K;  4U39 A;  5CB4 B;  2R6R 1;  4B45 A;  5B8F A;  2BTQ B;  4G4Z A;  4B62 A;  1OFU A;  3RYC A;  3VMF B;  4LNU A;  3VCZ A;  4M8I A;  5AVM A;  4ZHY B;  1W5A A;  1TUB B;  1JFF B;  3I55 F;  2KTU A;  3N4Y A;  1IV4 A;  4DRX B;  3S02 A;  5IYZ A;  1TVK B;  3IMP A;  1SZQ A;  3RA6 A;  4WBN A;  2LCA A;  4I50 B;  4X3L A;  4O2B A;  3WGK A;  3F0F A;  1VQM F;  2RHO A;  1Q81 H;  3K2X A;  1U40 A;  3JAL A;  4X1Y B;  5A2Q M;  1T0K B;  2WAL A;  1CLI A;  3GYQ A;  5HY4 A;  1UI9 A;  1XV2 A;  5EIB C;  3JAT A;  3IEQ A;  2B33 A;  5HY2 A;  1QAH A;  5LYJ A;  3NVK E;  1S72 F;  3N2K B;  3RYI A;  1CK2 A;  4X1K B;  1PXW A;  2I6R A;  3S06 A;  1M90 H;  5IT9 M;  2UYJ A;  2UZH A;  4C8I A;  3WGJ A;  2VGN A;  1X25 A;  3ERN A;  5EYP A;  4O4H B;  1W59 A;  2MQE A;  4KWE A;  1VQ8 F;  3MQW A;  2AMT A;  2ZVY A;  3N2G B;  3C9S A;  2QEX F;  1Q7Y H;  5LOV B;  5LA6 B;  3F6M A;  4E6E A;  4IIJ A;  2ZVZ A;  1VQO F;  2IQQ A;  3ZOP A;  4RQO A;  4X20 B;  4BVS A;  3SIU A;  5CA1 B;  4G4V A;  3RYF A;  3FPI A;  3CYP B;  4ZHQ B;  5J2U A;  3E22 B;  3KHN A;  1PF5 A;  3S03 A;  2H6L A;  1VQL F;  2OTM A;  3CB2 A;  5IJ9 A;  4X1I B;  3CCQ F;  1M1K H;  1YQN A;  5GAN K;  4I55 A;  3CYQ A;  3FFM A;  3QHD A;  4NUT A;  1XRG A;  2UYN B;  4B5C A;  5FLX M;  3HKC A;  1KNK A;  3CC7 F;  5G4V C;  4ZHV A;  3VO8 A;  3VYS C;  2IG8 A;  1RA4 A;  2F9Z C;  3G6E F;  4BT6 A;  3V4D A;  2Z1T A;  3J80 M;  1IV1 A;  3CPW F;  4IHJ A;  2NMU A;  3L7Q A;  4ZI7 A;  2BO1 A;  3I56 F;  2H8C A;  4F6R B;  2ZOD A;  2EWC A;  4DXD A;  5CA0 B;  1VQ9 F;  4YJ3 B;  3CPQ A;  4G4W A;  5EZY B;  3E1Y A;  3LME A;  3S0H A;  2OZB A;  5KMG A;  4X3M A;  3HKB B;  3CCL F;  1W57 A;  3LDT A;  1YI2 F;  4O4L A;  5JVD A;  3C8L A;  3LFO A;  3M1X A;  3J7A R;  5MN6 A;  5IYZ B;  2AIF A;  1VQN F;  3BYQ A;  1QD9 A;  1W5F A;  3KE1 A;  3UT5 B;  2VXY A;  3JCM M;  4WBN B;  4YJ2 A;  1SA0 A;  3RA5 A;  1FFX B;  3FD5 A;  4ZK7 A;  2CHT A;  3GTZ A;  3P0Z A;  4ZOL A;  4C8E A;  1YJW F;  1Z5W A;  5HWE A;  1W5B A;  1YIT F;  2RHH A;  3JAK A;  3JAM M;  2HQS C;  5GON A;  4I4T A;  5C8Y A;  4HNA A;  4C81 A;  2N48 A;  4EI9 A;  1QU9 A;  4ZHW A;  3WPX A;  1X7O A;  5HXZ A;  2BTU A;  1RLG A;  1J7H A;  3OW2 F;  2YYE A;  5ITZ A;  2ZOV A;  1Q82 H;  3ZO8 A;  2RHL A;  4O4I A;  3D00 A;  2RB9 A;  2CHS A;  3JAR A;  2JNB A;  1RQ7 A;  5BMV B;  1VH8 A;  3KJJ A;  3IEW A;  3MDO A;  1QVF F;  3B6N A;  1VHA A;  4TV9 A;  5LXT A;  5JH7 B;  4IIJ B;  4BT4 A;  2DT4 A;  2LBW A;  2QI2 A;  5EAZ A;  4FFB B;  5EB0 A;  3V3T A;  3GHZ A;  1XHO A;  3VYU C;  3HKD A;  3WJQ A;  1KD1 H;  2Z1E A;  1KC8 H;  2CSL A;  3RYH B;  3WJR A;  3JVH A;  3KIZ A;  3OBW A;  3G4S F;  4EB6 A;  2Q1Y A;  1Q86 H;  2VAP A;  1X52 A;  5KX5 A;  4R40 B;  5MN4 A;  1CN7 A;  4BVT A;  5CB4 A;  3J81 M;  1YGY A;  5JCO A;  1YIJ F;  4C4W C;  1XBI A;  5G4U C;  1H48 A;  1TUB A;  1JFF A;  5EWR A;  1K73 H;  5FNV A;  3D01 A;  4DRX A;  5EB1 B;  5MN5 A;  1W42 A;  3MCA B;  1Q8R A;  1TVK A;  3CCJ F;  1U3P A;  2UYK A;  4ZI7 B;  3K14 A;  3IKF A;  3HKE A;  3MCQ A;  4I50 A;  2YXZ A;  2HVY D;  1FNK A;  4TUY A;  1YJN F;  2L26 A;  4BVR A;  3AGK A;  3PLA C;  3JAW A;  3F0D A;  4X1Y A;  1H47 A;  2HS4 A;  4BT5 A;  1W58 1;  3HJW C;  4BT3 A;  1RLU A;  1VQ4 F;  1U43 A;  1GX1 A;  3LWR C;  4BY9 D;  3HWU A;  2UYP A;  3N2K A;  4TV8 B;  1SA0 B;  1IPA A;  1T0A A;  4X1K A;  3IKE A;  1N8R H;  1JY8 A;  1JD1 A;  2VAW A;  3C9U A;  3DDN A;  2Q1X A;  2PMP A;  4O4H A;  2KG4 A;  3N4Z A;  5HY0 A;  3O85 A;  4EI8 A;  4TZZ A;  1KQS F;  1FSZ A;  3ZP7 A;  3RYC B;  2OHW A;  4LNU B;  3N2G A;  1K9M H;  3WJP A;  3S0W A;  3NMU C;  1K8A H;  1X7P A;  5LOV A;  3Q8H A;  5LA6 A;  2VGM A;  2OTL F;  5GIN C;  2ZAU A;  4X20 A;  1E7K A;  3OON A;  5CA1 A;  3S0Y A;  3SIV A;  4O4J A;  4ZHQ A;  3WGL A;  3E22 A;  2Z1U A;  5LP6 A;  4O2B B;  3TD3 A;  1Z5V A;  2KTV A;  2LBX A;  3JAR B;  4U3J A;  3LWV C;  3JAL B;  4X1I A;  3DC2 A;  1DT9 A;  5J2T A;  2UYN A;  3JAT B;  4NQ3 A;  1ZWZ A;  2HP0 A;  3NK6 A;  2ALE A;  1NMU B;  3CME F;  5JQG A;  3I3F A;  5LYJ B;  1VQ7 F;  3RYI B;  3CCS F;  4O2A A;  1NJI H;  2GZL A;  2K1S A;  4B46 A;  4F6R A;  3ON1 A;  5CA0 A;  4G4X A;  1GO1 A;  3P4E A;  3JAS A;  5EYP B;  3U0O A;  5EZY A;  4LCK A;  2HRU A;  1VQK F;  2FC3 A;  1YJ9 F;  1W55 A;  3VYT C;  3K0T A;  3HKB A;  3G71 F;  5HP7 A;  5FNV B;  3R0P A;  3ZP4 A;  2IAF A;  3CCV F;  2W8B C;  5IJ0 A;  1KNJ A;  3TD4 A;  3CG6 A;  2CVL A;  1U3L A;  3RYF B;  1GZ0 A;  3HKE B;  1GO0 A;  2R75 1;  4NWO B;  5J2U B;  4G4Y A;  3UT5 A;  2HRY A;  5LP6 C;  2HX0 A;  2HS3 A;  1R1M A;  2KGW A;  4TUY B;  1FFX A;  1SDS A;  2PHN A;  5IJ9 B;  2OTJ F;  5GIO C;  1DBF A;  3JAW B;  4I55 B;  3VIU A;  2CWJ A;  2HP3 A;  3CCM F;  1NQ3 A;  4BT2 A;  3HKC B;  3CCU F;  1VQ6 F;  3LWQ C;  2CZW A;  3NK7 A;  3ELC A;  3VTI C;  3CC4 F;  3OBY A;  3WPW A;  3CXC F;  4IHJ B;  4ERH A;  3P10 A;  2QA4 F;  3LWO C;  3EOR A;  5EO3 A;  3LWP C;  3ESJ A;  3PAF A;  3KJK A;  2V9Y A;  1VQ5 F; 
#chains in the Genus database with same CATH homology
 3N4Z A;  5HY0 A;  1YIT F;  3O85 A;  1H7M A;  5A2Q M;  4EI8 A;  4TZZ A;  1KQS F;  3HAX D;  1T0K B;  2WAL A;  5DCV A;  2OHW A;  3JAM M;  3GYQ A;  5HY4 A;  1K9M H;  3NMU C;  1K8A H;  1X7P A;  2VGM A;  2OTL F;  3V7Q A;  4EI9 A;  5GIN C;  5HY2 A;  3NVK E;  1S72 F;  1E7K A;  1X7O A;  5HXZ A;  2FGY A;  1CK2 A;  3CMA F;  3SIV A;  1RLG A;  1PXW A;  5IT9 M;  3OW2 F;  1M90 H;  1W3E X;  1W2B F;  1Q82 H;  2KTV A;  2VGN A;  4XCQ A;  1YHQ F;  2LBX A;  3D00 A;  3LWV C;  2JNB A;  1VQ8 F;  1QVF F;  1DT9 A;  1JJ2 F;  2QEX F;  3NVI B;  1Q7Y H;  4NQ3 A;  1ZWZ A;  3NK6 A;  2LBW A;  1VQO F;  2ALE A;  2QI2 A;  1NMU B;  3CME F;  5GIP C;  1W40 A;  1VQ7 F;  3CCE F;  3CD6 F;  4BVS A;  3SIU A;  3V3T A;  1KD1 H;  3CCS F;  1KC8 H;  1NJI H;  3CC2 F;  3OBW A;  2GLZ A;  3ON1 A;  4EI7 A;  3G4S F;  1VQL F;  1GO1 A;  3V7E A;  1Q86 H;  5HY1 A;  4LCK A;  4BW0 B;  1X52 A;  1VQK F;  1W41 A;  2FC3 A;  1QVG F;  3CCQ F;  1YJ9 F;  1M1K H;  1CN7 A;  4BVT A;  5GAN K;  3J81 M;  3FFM A;  3CCR F;  4NUT A;  1YIJ F;  3G71 F;  1XBI A;  5FLX M;  1VQP F;  4C4W C;  3VI6 A;  5G4U C;  3IR9 A;  3CC7 F;  5EWR A;  3CCV F;  1K73 H;  5G4V C;  1W42 A;  3MCA B;  3CG6 A;  1RA4 A;  2F9Z C;  3G6E F;  3CCJ F;  1GZ0 A;  1GO0 A;  3J80 M;  3CPW F;  3WXM B;  2I6D A;  2BO1 A;  3I56 F;  1VQ9 F;  3E20 B;  4BVQ A;  1SDS A;  3CPQ A;  5HXU A;  2HVY D;  1YJN F;  2OTJ F;  5GIO C;  4BVR A;  3AGK A;  3PLA C;  5FJ4 C;  5GAP K;  3E1Y A;  2OZB A;  4X3M A;  3CCL F;  3CCM F;  3VMF B;  1YI2 F;  1VQ4 F;  3CCU F;  3I55 F;  3LFO A;  2KTU A;  3N4Y A;  3J7A R;  1VQ6 F;  2AIF A;  1VQN F;  3LWQ C;  2CZW A;  3NK7 A;  3LWR C;  4BY9 D;  3CC4 F;  3OBY A;  3CXC F;  3JCM M;  3RA6 A;  1IPA A;  2QA4 F;  1N8R H;  3RA5 A;  4X3L A;  3LWO C;  1VQM F;  3LWP C;  5EO3 A;  1YJW F;  3PAF A;  3HJW C;  5HWE A;  1Q81 H;  1VQ5 F;  2KG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...