1YJWF

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yjwF00
1K9MH 5FLXM 1VQ9F 3J80M 3MCAB 3NK7A 5DCVA 3FFMA 3CCQF 3CXCF 1GO0A 1X52A 5IT9M 3CG6A 1X7OA 3N4YA 1M1KH 1RA4A 2QI2A 3OW2F 2FC3A 2ALEA 2CZWA 2OTLF 3CCRF 3NVIB 1K8AH 4X3MA 1VQKF 2KTUA 3AGKA 3CC7F 1W42A 2OHWA 3GYQA 3I56F 3J7AR 1YJWF 3ON1A 3HJWC 1RLGA 1DT9A 2VGMA 1SDSA 1Q82H 3LWQC 1IPAA 2OZBA 1VQ8F 3OBYA 5G4VC 3CMAF 1VQ5F 5FJ4C 3CCUF 5GAPK 3VI6A 3SIUA 3CMEF 3CCJF 1YJ9F 1KQSF 1VQPF 1VQNF 2KTVA 1W2BF 1M90H 3CC4F 3CCSF 1Q7YH 2QA4F 3V7EA 3PLAC 3LFOA 4BW0B 1YI2F 5EO3A 4X3LA 3LWOC 2I6DA 1XBIA 4TZZA 3CPWF 1QVFF 1N8RH 3G4SF 1ZWZA 3RA6A 3SIVA 1QVGF 1YHQF 3N4ZA 1VQ7F 3LWVC 1YITF 3JAMM 3NK6A 1VQ6F 5G4UC 3CCEF 3RA5A 5GANK 1S72F 2VGNA 1H7MA 1VQ4F 3E1YA 3G71F 1CK2A 2HVYD 3V7QA 2WALA 3PAFA 3E20B 1E7KA 2AIFA 3CCMF 3WXMB 1JJ2F 3CCVF 5GIPC 3LWRC 1VQLF 3CCLF 1VQOF 3J81M 5A2QM 1X7PA 2QEXF 2BO1A 1W40A 2LBXA 3VMFB 3LWPC 1W41A 1Q86H 1CN7A 1PXWA 3IR9A 1GO1A 3CC2F 2LBWA 5GIOC 3JCMM 1YJNF 5EWRA 1W3EX 3CPQA 4BY9D 4NUTA 1T0KB 3HAXD 1YIJF 1KC8H 2JNBA 2OTJF 5GINC 3O85A 3CD6F 1GZ0A 3NMUC 3G6EF 1NJIH 3OBWA 1KD1H 4LCKA 3I55F 1VQMF 3NVKE 1K73H 1Q81H 4C4WC 1NMUB 2KG4A
chains in the Genus database with same CATH superfamily
1K9MH 2PHNA 3KJJA 2G9IA 3J80M 2HP0A 3JASA 3MCAB 1W5FA 3VOAA 5DCVA 3WGNA 3CCQF 4KWEA 2R751 3CXCF 1X52A 5MN4A 2EWCA 4B46A 3JAKA 3JATB 2FC3A 4C8EA 4ZHYB 3RYIB 3KE1A 4BT6A 2N48A 4O4LA 2KTUA 4BVTA 2PMPA 5LYJB 4ZHQB 5KX5B 3ZP7A 3HJWC 2CWJA 3MQWA 5MN6A 3RYFA 1SA0A 3ESJA 3WGLA 1W57A 2L26A 2BTQB 3IEWA 1U40A 1FFXA 1VQ5F 5FJ4C 3CCUF 4G4YA 3SIUA 4O4JA 2Q1XA 5JCOA 1YJ9F 3T80A 2KTVA 3ZP4A 3CYPB 4EB6B 2DT4A 3VTIC 2H6LA 3E22B 5FNVA 2V9YA 4BT4A 3I7TA 4B5CA 3M84A 1PF5A 2YXZA 4B62A 3F0GA 1KNJA 3C9TA 3V4DA 5LOVB 1VH8A 2YYEA 5EB0A 5LOVA 4RQOA 3SIVA 3CYQA 1QVGF 2ZODA 1JY8A 2IQQA 3LWVC 3CB2A 3JAMM 1VQ6F 3JALB 2ZVZA 5G4UC 4WBNA 3S0HA 3G71F 5JVDA 4O2BA 3V7QA 4U39A 2HRUA 3N2KB 5JH7B 3N2KA 3CCMF 5ITZA 3C9RA 4ZOLB 1IV4A 1COMA 4LNUA 3RYIA 3HKBB 1Z5WA 1H47A 2VAMA 3JAWB 1IV1A 5LP6C 5HXUA 1YGYA 4I50B 2GVIA 3LWPC 1W41A 1H48A 1CN7A 1IV3A 3IR9A 1JFFB 3CC2F 3L7QA 5CA0B 3VO8A 4TV9A 4O4HA 2HRYA 3JAWA 4F6RA 3LMEA 5LYJA 3VCZA 3IKFA 5HWEA 1IV2A 3F0FA 1Q81H 1NMUB 3BYQA 3E22A 5FNVB 4ERHA 4BVQA 3IKEA 4C82A 1NQ3A 1U43A 5IT9M 2VAWA 2Z1UA 4X1KA 1M1KH 3OW2F 2ALEA 1TVKB 4O2AA 3CCRF 3LYBA 1RLUA 5IYZA 1K8AH 1VQKF 4C8IA 3N2GA 4ZHVA 5HXZA 2UYNA 1W42A 3MBMA 5KMGB 4YJ2A 3RYCA 3I56F 3J7AR 3WPXA 2R6R1 1YJWF 2OZBA 4YJ3A 3OBYA 1SZQA 1U3LA 3D01A 3K2XA 3JVHA 4R40B 3VI6A 1JD1A 1KNKA 1CLIA 3CCJF 1KQSF 4I4TA 1VQNF 5EIBC 4PWTA 4X1IA 4I4TB 1W2BF 1M90H 5EAZA 5HP7A 4G4XA 5IJ0B 3CC4F 3VOBA 3ZO8A 5LXTA 3LFOA 1YQNA 5EO3A 3JARA 1QU9A 4X3LA 4TV9B 3ERNA 5C8YA 1SA0B 3Q8HA 3MCQA 3JARB 4I55B 3WJQA 3K14A 4TV8B 3EORA 1FFXB 1N8RH 3RA6A 1QAHA 3QHDA 4I50A 1YITF 2CHSA 3NK6A 4IHJB 1UFYA 3CCEF 5J2UA 3WGKA 5GANK 1S72F 1CK2A 2HVYD 5GONB 2WALA 3HKDB 2CHTA 3P4EA 2AIFA 4U3JA 4DRXB 5LA6B 2Z1TA 5CA1A 1XV2A 4F6RB 5GIPC 5HY2A 1VQOF 4NWOB 5A2QM 2UYNB 4G4WA 1W40A 2IAFA 2LCAA 3RYCB 1W55A 2RHHA 3QTYA 1Q86H 1PXWA 5LA6A 3ELCA 2CVLA 2LBWA 1W5EA 2HX0A 3HKEA 3HAXD 3CPQA 4NUTA 3TD5A 3UT5A 1YIJF 5IYZB 1KC8H 1U3PA 5ITZB 5GINC 4X1YB 2RHJA 3JATA 3FPIA 4X1YA 3VYSC 4IIJA 5JQGB 4C8GA 2KG4A 3HKCB 3D00A 1TUBB 2VXYA 3JALA 1VQ9F 4EI8A 4BVSA 5B8FA 1QD9A 2HS4A 3U0OA 5C8YB 2MQEA 3HTNA 1X7OA 3N4YA 5CA0A 1Z5VA 1W59A 2HS0A 2Z1EA 2QI2A 2CZWA 3M4SA 3S0WA 2ZVYA 5CB4B 1Q8RA 1XHOA 1UI9A 2HS3A 3RYHB 3WJRA 5IJ0A 5MN5A 1J7HA 5HY4A 3CC7F 5LXTB 2RHLA 3RYFB 4ZHQA 1RQ2A 1DT9A 3S02A 4EI7A 5GONA 2VGMA 1Q82H 1IPAA 3JAKB 3K12A 4U3JB 1VQ8F 3VYUC 4NQ3A 5G4VC 3CMAF 5JCOC 3OONA 3RYHA 3S06A 2BTOA 3WGJA 4O4IB 5IJ9B 3CMEF 2H8CA 1VQPF 3V3TA 1FNKA 2HQSC 5J2UB 2QA4F 4BT2A 1X25A 4DRXA 5CA1B 3HKEB 5EB1B 4BW0B 2IG8A 3HWUA 2NMUA 3FD6A 2I6DA 1XBIA 4FFBA 5IJ9A 2CW4A 2K1SA 2F9ZC 3CPWF 3G4SF 1ZWZA 2H8EA 1W581 4LNUB 4EB6A 3WGMA 3FD5A 1W5AA 1T0AA 4X1IB 3RA5A 4G4VA 4WBNB 5LP6B 3PAFA 2RHOA 5JVDB 2HP3A 4ZHWA 4O2BB 1E7KA 1FSZA 3C8LA 4YJ3B 3WXMB 2Q1YA 3D54A 5BMVA 3CCVF 3GTZA 2DYYA 4O4LB 2UZHA 3TD3A 1X7PA 2BO1A 2GZLA 4BT7A 1TUBA 2LBXA 3R0PA 5KX5A 4E6EA 1JFFA 1OFUA 2ZOVA 3KIZA 2W8BC 1GO1A 5BMVB 1GX1A 4ZOLA 4BY9D 5EWRA 4B45A 5CB4A 3CD6F 3O85A 2GLZA 3NMUC 3OBWA 5HY1A 2CSLA 4LCKA 3NVKE 3DC2A 4ZI7A 1VQVA 2UYPA 4M8IA 5FLXM 2QTPA 1ODEA 3QUWA 3I3FA 4XCQA 4YJ2B 3RE3A 4BT3A 1ONIA 3NK7A 3FFMA 4O4HB 3IMPA 2RB9A 1GO0A 1VK3A 3CG6A 3C9SA 4HNAB 1RA4A 4O4IA 4TUYA 2OTLF 3NVIB 3VIUA 2I6RA 4X3MA 3K0TA 2OTMA 3AGKA 1OAPA 4C81A 2OHWA 4IIJB 5JQGA 3GYQA 3LDTA 4ZK7A 2AMTA 3ON1A 3HKCA 5EZYA 3B6NA 1RLGA 4X1KB 1SDSA 3KJKA 3LWQC 5JH7A 3M1XA 4TUYB 5HP8A 3C9UA 3TD4A 3S0YA 5GAPK 3DDNA 4I55A 3N2GB 3GHZA 4G88A 3WPWA 5KMGA 3FBAA 5HY0A 2AIZP 5EZYB 2LBTA 3CCSF 1DBFA 3ZOPA 1Q7YH 5LP6A 1R1MA 3F0EA 3V7EA 3PLAC 3VYTC 3F0DA 4RHAA 1YI2F 2ZF8A 3LWOC 4DXDA 1XRGA 3P0ZA 4TZZA 1QVFF 3S03A 3HKBA 1W5BA 5J2TB 4O4JB 1YHQF 4IHJA 3N4ZA 2Z01A 2UYKA 5EIBD 1RQ7A 1VQ7F 3MDOA 5AVMA 2VAPA 3KHNA 2VGNA 1H7MA 1VQ4F 3E1YA 4TV8A 3E20B 1FNJA 5EYPA 1JJ2F 1TVKA 4O2AB 3IEQA 3LWRC 1VQLF 5J2TA 3P10A 3CCLF 2BTUA 3J81M 4ZI7B 2QEXF 1VHAA 2UYJA 3VMFB 2P6YA 2FGYA 4BT5A 3HKDA 5EYPB 2Z1FA 2ZAUA 4HNAA 2HP0B 3JASB 3JCMM 3F6MA 4G4ZA 5GIOC 1W3EX 1YJNF 4X20A 1T0KB 4FFBB 2JNBA 4X20B 4EI9A 2OTJF 1JN1A 3UT5B 1GZ0A 3WJPA 3G6EF 2KGWA 1NJIH 1KD1H 3I55F 1VQMF 4BVRA 2B33A 1K73H 4C4WC
chains in the Genus database with same CATH topology
1K9MH 3D00A 5FLXM 1VQ9F 3J80M 4EI8A 4BVSA 4BVQA 4XCQA 3MCAB 3NK7A 5DCVA 3FFMA 3CCQF 3CXCF 1GO0A 1X52A 5IT9M 3CG6A 1X7OA 3N4YA 1M1KH 1RA4A 2QI2A 3OW2F 2FC3A 2ALEA 2CZWA 2OTLF 3CCRF 3NVIB 1K8AH 4X3MA 1VQKF 2KTUA 4BVTA 3AGKA 5HXZA 5HY4A 3CC7F 1W42A 2OHWA 3GYQA 3I56F 3J7AR 1YJWF 3ON1A 3HJWC 1RLGA 1DT9A 4EI7A 2VGMA 1SDSA 1Q82H 3LWQC 1IPAA 2OZBA 1VQ8F 3OBYA 4NQ3A 5G4VC 3CMAF 1VQ5F 5FJ4C 3CCUF 5GAPK 3VI6A 3SIUA 3CMEF 3CCJF 1YJ9F 1KQSF 1VQPF 3V3TA 1VQNF 2KTVA 5HY0A 1W2BF 1M90H 3CC4F 3CCSF 1Q7YH 2QA4F 3V7EA 3PLAC 3LFOA 4BW0B 1YI2F 5EO3A 4X3LA 3LWOC 2I6DA 1XBIA 4TZZA 2F9ZC 3CPWF 1QVFF 1N8RH 3G4SF 1ZWZA 3RA6A 3SIVA 1QVGF 1YHQF 3N4ZA 1VQ7F 3LWVC 1YITF 3JAMM 3NK6A 1VQ6F 5G4UC 3CCEF 3RA5A 5GANK 1S72F 2VGNA 1H7MA 1VQ4F 3E1YA 3G71F 1CK2A 2HVYD 3V7QA 2WALA 3PAFA 3E20B 1E7KA 2AIFA 3CCMF 3WXMB 1JJ2F 3CCVF 5GIPC 3LWRC 1VQLF 5HY2A 3CCLF 1VQOF 3J81M 5A2QM 1X7PA 2QEXF 2BO1A 1W40A 2LBXA 5HXUA 3VMFB 3LWPC 2FGYA 1W41A 1Q86H 1CN7A 1PXWA 3IR9A 1GO1A 3CC2F 2LBWA 3JCMM 5GIOC 1YJNF 5EWRA 1W3EX 3CPQA 4BY9D 4NUTA 1T0KB 3HAXD 1YIJF 1KC8H 2JNBA 4EI9A 2OTJF 5GINC 3O85A 2GLZA 1GZ0A 3CD6F 3NMUC 3G6EF 1NJIH 3OBWA 5HY1A 1KD1H 5HWEA 4LCKA 3I55F 1VQMF 4BVRA 3NVKE 1K73H 1Q81H 4C4WC 1NMUB 2KG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M H;  5FLX M;  1VQ9 F;  3J80 M;  3MCA B;  3NK7 A;  5DCV A;  3FFM A;  3CCQ F;  3CXC F;  1GO0 A;  1X52 A;  5IT9 M;  3CG6 A;  1X7O A;  3N4Y A;  1M1K H;  1RA4 A;  2QI2 A;  3OW2 F;  2FC3 A;  2ALE A;  2CZW A;  2OTL F;  3CCR F;  3NVI B;  1K8A H;  4X3M A;  1VQK F;  2KTU A;  3AGK A;  3CC7 F;  1W42 A;  2OHW A;  3GYQ A;  3I56 F;  3J7A R;  1YJW F;  3ON1 A;  3HJW C;  1RLG A;  1DT9 A;  2VGM A;  1SDS A;  1Q82 H;  3LWQ C;  1IPA A;  2OZB A;  1VQ8 F;  3OBY A;  5G4V C;  3CMA F;  1VQ5 F;  5FJ4 C;  3CCU F;  5GAP K;  3VI6 A;  3SIU A;  3CME F;  3CCJ F;  1YJ9 F;  1KQS F;  1VQP F;  1VQN F;  2KTV A;  1W2B F;  1M90 H;  3CC4 F;  3CCS F;  1Q7Y H;  2QA4 F;  3V7E A;  3PLA C;  3LFO A;  4BW0 B;  1YI2 F;  5EO3 A;  4X3L A;  3LWO C;  2I6D A;  1XBI A;  4TZZ A;  3CPW F;  1QVF F;  1N8R H;  3G4S F;  1ZWZ A;  3RA6 A;  3SIV A;  1QVG F;  1YHQ F;  3N4Z A;  1VQ7 F;  3LWV C;  1YIT F;  3JAM M;  3NK6 A;  1VQ6 F;  5G4U C;  3CCE F;  3RA5 A;  5GAN K;  1S72 F;  2VGN A;  1H7M A;  1VQ4 F;  3E1Y A;  3G71 F;  1CK2 A;  2HVY D;  3V7Q A;  2WAL A;  3PAF A;  3E20 B;  1E7K A;  2AIF A;  3CCM F;  3WXM B;  1JJ2 F;  3CCV F;  5GIP C;  3LWR C;  1VQL F;  3CCL F;  1VQO F;  3J81 M;  5A2Q M;  1X7P A;  2QEX F;  2BO1 A;  1W40 A;  2LBX A;  3VMF B;  3LWP C;  1W41 A;  1Q86 H;  1CN7 A;  1PXW A;  3IR9 A;  1GO1 A;  3CC2 F;  2LBW A;  5GIO C;  3JCM M;  1YJN F;  5EWR A;  1W3E X;  3CPQ A;  4BY9 D;  4NUT A;  1T0K B;  3HAX D;  1YIJ F;  1KC8 H;  2JNB A;  2OTJ F;  5GIN C;  3O85 A;  3CD6 F;  1GZ0 A;  3NMU C;  3G6E F;  1NJI H;  3OBW A;  1KD1 H;  4LCK A;  3I55 F;  1VQM F;  3NVK E;  1K73 H;  1Q81 H;  4C4W C;  1NMU B;  2KG4 A; 
#chains in the Genus database with same CATH topology
 1K9M H;  2PHN A;  3KJJ A;  2G9I A;  3J80 M;  2HP0 A;  3JAS A;  3MCA B;  1W5F A;  3VOA A;  5DCV A;  3WGN A;  3CCQ F;  4KWE A;  2R75 1;  3CXC F;  1X52 A;  5MN4 A;  2EWC A;  4B46 A;  3JAK A;  3JAT B;  2FC3 A;  4C8E A;  4ZHY B;  3RYI B;  3KE1 A;  4BT6 A;  2N48 A;  4O4L A;  2KTU A;  4BVT A;  2PMP A;  5LYJ B;  4ZHQ B;  5KX5 B;  3ZP7 A;  3HJW C;  2CWJ A;  3MQW A;  5MN6 A;  3RYF A;  1SA0 A;  3ESJ A;  3WGL A;  1W57 A;  2L26 A;  2BTQ B;  3IEW A;  1U40 A;  1FFX A;  1VQ5 F;  5FJ4 C;  3CCU F;  4G4Y A;  3SIU A;  4O4J A;  2Q1X A;  5JCO A;  1YJ9 F;  3T80 A;  2KTV A;  3ZP4 A;  3CYP B;  4EB6 B;  2DT4 A;  3VTI C;  2H6L A;  3E22 B;  5FNV A;  2V9Y A;  4BT4 A;  3I7T A;  4B5C A;  3M84 A;  1PF5 A;  2YXZ A;  4B62 A;  3F0G A;  1KNJ A;  3C9T A;  3V4D A;  5LOV B;  1VH8 A;  2YYE A;  5EB0 A;  5LOV A;  4RQO A;  3SIV A;  3CYQ A;  1QVG F;  2ZOD A;  1JY8 A;  2IQQ A;  3LWV C;  3CB2 A;  3JAM M;  1VQ6 F;  3JAL B;  2ZVZ A;  5G4U C;  4WBN A;  3S0H A;  3G71 F;  5JVD A;  4O2B A;  3V7Q A;  4U39 A;  2HRU A;  3N2K B;  5JH7 B;  3N2K A;  3CCM F;  5ITZ A;  3C9R A;  4ZOL B;  1IV4 A;  1COM A;  4LNU A;  3RYI A;  3HKB B;  1Z5W A;  1H47 A;  2VAM A;  3JAW B;  1IV1 A;  5LP6 C;  5HXU A;  1YGY A;  4I50 B;  2GVI A;  3LWP C;  1W41 A;  1H48 A;  1CN7 A;  1IV3 A;  3IR9 A;  1JFF B;  3CC2 F;  3L7Q A;  5CA0 B;  3VO8 A;  4TV9 A;  4O4H A;  2HRY A;  3JAW A;  4F6R A;  3LME A;  5LYJ A;  3VCZ A;  3IKF A;  5HWE A;  1IV2 A;  3F0F A;  1Q81 H;  1NMU B;  3BYQ A;  3E22 A;  5FNV B;  4ERH A;  4BVQ A;  3IKE A;  4C82 A;  1NQ3 A;  1U43 A;  5IT9 M;  2VAW A;  2Z1U A;  4X1K A;  1M1K H;  3OW2 F;  2ALE A;  1TVK B;  4O2A A;  3CCR F;  3LYB A;  1RLU A;  5IYZ A;  1K8A H;  1VQK F;  4C8I A;  3N2G A;  4ZHV A;  5HXZ A;  2UYN A;  1W42 A;  3MBM A;  5KMG B;  4YJ2 A;  3RYC A;  3I56 F;  3J7A R;  3WPX A;  2R6R 1;  1YJW F;  2OZB A;  4YJ3 A;  3OBY A;  1SZQ A;  1U3L A;  3D01 A;  3K2X A;  3JVH A;  4R40 B;  3VI6 A;  1JD1 A;  1KNK A;  1CLI A;  3CCJ F;  1KQS F;  4I4T A;  1VQN F;  5EIB C;  4PWT A;  4X1I A;  4I4T B;  1W2B F;  1M90 H;  5EAZ A;  5HP7 A;  4G4X A;  5IJ0 B;  3CC4 F;  3VOB A;  3ZO8 A;  5LXT A;  3LFO A;  1YQN A;  5EO3 A;  3JAR A;  1QU9 A;  4X3L A;  4TV9 B;  3ERN A;  5C8Y A;  1SA0 B;  3Q8H A;  3MCQ A;  3JAR B;  4I55 B;  3WJQ A;  3K14 A;  4TV8 B;  3EOR A;  1FFX B;  1N8R H;  3RA6 A;  1QAH A;  3QHD A;  4I50 A;  1YIT F;  2CHS A;  3NK6 A;  4IHJ B;  1UFY A;  3CCE F;  5J2U A;  3WGK A;  5GAN K;  1S72 F;  1CK2 A;  2HVY D;  5GON B;  2WAL A;  3HKD B;  2CHT A;  3P4E A;  2AIF A;  4U3J A;  4DRX B;  5LA6 B;  2Z1T A;  5CA1 A;  1XV2 A;  4F6R B;  5GIP C;  5HY2 A;  1VQO F;  4NWO B;  5A2Q M;  2UYN B;  4G4W A;  1W40 A;  2IAF A;  2LCA A;  3RYC B;  1W55 A;  2RHH A;  3QTY A;  1Q86 H;  1PXW A;  5LA6 A;  3ELC A;  2CVL A;  2LBW A;  1W5E A;  2HX0 A;  3HKE A;  3HAX D;  3CPQ A;  4NUT A;  3TD5 A;  3UT5 A;  1YIJ F;  5IYZ B;  1KC8 H;  1U3P A;  5ITZ B;  5GIN C;  4X1Y B;  2RHJ A;  3JAT A;  3FPI A;  4X1Y A;  3VYS C;  4IIJ A;  5JQG B;  4C8G A;  2KG4 A;  3HKC B;  3D00 A;  1TUB B;  2VXY A;  3JAL A;  1VQ9 F;  4EI8 A;  4BVS A;  5B8F A;  1QD9 A;  2HS4 A;  3U0O A;  5C8Y B;  2MQE A;  3HTN A;  1X7O A;  3N4Y A;  5CA0 A;  1Z5V A;  1W59 A;  2HS0 A;  2Z1E A;  2QI2 A;  2CZW A;  3M4S A;  3S0W A;  2ZVY A;  5CB4 B;  1Q8R A;  1XHO A;  1UI9 A;  2HS3 A;  3RYH B;  3WJR A;  5IJ0 A;  5MN5 A;  1J7H A;  5HY4 A;  3CC7 F;  5LXT B;  2RHL A;  3RYF B;  4ZHQ A;  1RQ2 A;  1DT9 A;  3S02 A;  4EI7 A;  5GON A;  2VGM A;  1Q82 H;  1IPA A;  3JAK B;  3K12 A;  4U3J B;  1VQ8 F;  3VYU C;  4NQ3 A;  5G4V C;  3CMA F;  5JCO C;  3OON A;  3RYH A;  3S06 A;  2BTO A;  3WGJ A;  4O4I B;  5IJ9 B;  3CME F;  2H8C A;  1VQP F;  3V3T A;  1FNK A;  2HQS C;  5J2U B;  2QA4 F;  4BT2 A;  1X25 A;  4DRX A;  5CA1 B;  3HKE B;  5EB1 B;  4BW0 B;  2IG8 A;  3HWU A;  2NMU A;  3FD6 A;  2I6D A;  1XBI A;  4FFB A;  5IJ9 A;  2CW4 A;  2K1S A;  2F9Z C;  3CPW F;  3G4S F;  1ZWZ A;  2H8E A;  1W58 1;  4LNU B;  4EB6 A;  3WGM A;  3FD5 A;  1W5A A;  1T0A A;  4X1I B;  3RA5 A;  4G4V A;  4WBN B;  5LP6 B;  3PAF A;  2RHO A;  5JVD B;  2HP3 A;  4ZHW A;  4O2B B;  1E7K A;  1FSZ A;  3C8L A;  4YJ3 B;  3WXM B;  2Q1Y A;  3D54 A;  5BMV A;  3CCV F;  3GTZ A;  2DYY A;  4O4L B;  2UZH A;  3TD3 A;  1X7P A;  2BO1 A;  2GZL A;  4BT7 A;  1TUB A;  2LBX A;  3R0P A;  5KX5 A;  4E6E A;  1JFF A;  1OFU A;  2ZOV A;  3KIZ A;  2W8B C;  1GO1 A;  5BMV B;  1GX1 A;  4ZOL A;  4BY9 D;  5EWR A;  4B45 A;  5CB4 A;  3CD6 F;  3O85 A;  2GLZ A;  3NMU C;  3OBW A;  5HY1 A;  2CSL A;  4LCK A;  3NVK E;  3DC2 A;  4ZI7 A;  1VQV A;  2UYP A;  4M8I A;  5FLX M;  2QTP A;  1ODE A;  3QUW A;  3I3F A;  4XCQ A;  4YJ2 B;  3RE3 A;  4BT3 A;  1ONI A;  3NK7 A;  3FFM A;  4O4H B;  3IMP A;  2RB9 A;  1GO0 A;  1VK3 A;  3CG6 A;  3C9S A;  4HNA B;  1RA4 A;  4O4I A;  4TUY A;  2OTL F;  3NVI B;  3VIU A;  2I6R A;  4X3M A;  3K0T A;  2OTM A;  3AGK A;  1OAP A;  4C81 A;  2OHW A;  4IIJ B;  5JQG A;  3GYQ A;  3LDT A;  4ZK7 A;  2AMT A;  3ON1 A;  3HKC A;  5EZY A;  3B6N A;  1RLG A;  4X1K B;  1SDS A;  3KJK A;  3LWQ C;  5JH7 A;  3M1X A;  4TUY B;  5HP8 A;  3C9U A;  3TD4 A;  3S0Y A;  5GAP K;  3DDN A;  4I55 A;  3N2G B;  3GHZ A;  4G88 A;  3WPW A;  5KMG A;  3FBA A;  5HY0 A;  2AIZ P;  5EZY B;  2LBT A;  3CCS F;  1DBF A;  3ZOP A;  1Q7Y H;  5LP6 A;  1R1M A;  3F0E A;  3V7E A;  3PLA C;  3VYT C;  3F0D A;  4RHA A;  1YI2 F;  2ZF8 A;  3LWO C;  4DXD A;  1XRG A;  3P0Z A;  4TZZ A;  1QVF F;  3S03 A;  3HKB A;  1W5B A;  5J2T B;  4O4J B;  1YHQ F;  4IHJ A;  3N4Z A;  2Z01 A;  2UYK A;  5EIB D;  1RQ7 A;  1VQ7 F;  3MDO A;  5AVM A;  2VAP A;  3KHN A;  2VGN A;  1H7M A;  1VQ4 F;  3E1Y A;  4TV8 A;  3E20 B;  1FNJ A;  5EYP A;  1JJ2 F;  1TVK A;  4O2A B;  3IEQ A;  3LWR C;  1VQL F;  5J2T A;  3P10 A;  3CCL F;  2BTU A;  3J81 M;  4ZI7 B;  2QEX F;  1VHA A;  2UYJ A;  3VMF B;  2P6Y A;  2FGY A;  4BT5 A;  3HKD A;  5EYP B;  2Z1F A;  2ZAU A;  4HNA A;  2HP0 B;  3JAS B;  3JCM M;  3F6M A;  4G4Z A;  5GIO C;  1W3E X;  1YJN F;  4X20 A;  1T0K B;  4FFB B;  2JNB A;  4X20 B;  4EI9 A;  2OTJ F;  1JN1 A;  3UT5 B;  1GZ0 A;  3WJP A;  3G6E F;  2KGW A;  1NJI H;  1KD1 H;  3I55 F;  1VQM F;  4BVR A;  2B33 A;  1K73 H;  4C4W C; 
#chains in the Genus database with same CATH homology
 1K9M H;  3D00 A;  5FLX M;  1VQ9 F;  3J80 M;  4EI8 A;  4BVS A;  4BVQ A;  4XCQ A;  3MCA B;  3NK7 A;  5DCV A;  3FFM A;  3CCQ F;  3CXC F;  1GO0 A;  1X52 A;  5IT9 M;  3CG6 A;  1X7O A;  3N4Y A;  1M1K H;  1RA4 A;  2QI2 A;  3OW2 F;  2FC3 A;  2ALE A;  2CZW A;  2OTL F;  3CCR F;  3NVI B;  1K8A H;  4X3M A;  1VQK F;  2KTU A;  4BVT A;  3AGK A;  5HXZ A;  5HY4 A;  3CC7 F;  1W42 A;  2OHW A;  3GYQ A;  3I56 F;  3J7A R;  1YJW F;  3ON1 A;  3HJW C;  1RLG A;  1DT9 A;  4EI7 A;  2VGM A;  1SDS A;  1Q82 H;  3LWQ C;  1IPA A;  2OZB A;  1VQ8 F;  3OBY A;  4NQ3 A;  5G4V C;  3CMA F;  1VQ5 F;  5FJ4 C;  3CCU F;  5GAP K;  3VI6 A;  3SIU A;  3CME F;  3CCJ F;  1YJ9 F;  1KQS F;  1VQP F;  3V3T A;  1VQN F;  2KTV A;  5HY0 A;  1W2B F;  1M90 H;  3CC4 F;  3CCS F;  1Q7Y H;  2QA4 F;  3V7E A;  3PLA C;  3LFO A;  4BW0 B;  1YI2 F;  5EO3 A;  4X3L A;  3LWO C;  2I6D A;  1XBI A;  4TZZ A;  2F9Z C;  3CPW F;  1QVF F;  1N8R H;  3G4S F;  1ZWZ A;  3RA6 A;  3SIV A;  1QVG F;  1YHQ F;  3N4Z A;  1VQ7 F;  3LWV C;  1YIT F;  3JAM M;  3NK6 A;  1VQ6 F;  5G4U C;  3CCE F;  3RA5 A;  5GAN K;  1S72 F;  2VGN A;  1H7M A;  1VQ4 F;  3E1Y A;  3G71 F;  1CK2 A;  2HVY D;  3V7Q A;  2WAL A;  3PAF A;  3E20 B;  1E7K A;  2AIF A;  3CCM F;  3WXM B;  1JJ2 F;  3CCV F;  5GIP C;  3LWR C;  1VQL F;  5HY2 A;  3CCL F;  1VQO F;  3J81 M;  5A2Q M;  1X7P A;  2QEX F;  2BO1 A;  1W40 A;  2LBX A;  5HXU A;  3VMF B;  3LWP C;  2FGY A;  1W41 A;  1Q86 H;  1CN7 A;  1PXW A;  3IR9 A;  1GO1 A;  3CC2 F;  2LBW A;  3JCM M;  5GIO C;  1YJN F;  5EWR A;  1W3E X;  3CPQ A;  4BY9 D;  4NUT A;  1T0K B;  3HAX D;  1YIJ F;  1KC8 H;  2JNB A;  4EI9 A;  2OTJ F;  5GIN C;  3O85 A;  2GLZ A;  1GZ0 A;  3CD6 F;  3NMU C;  3G6E F;  1NJI H;  3OBW A;  5HY1 A;  1KD1 H;  5HWE A;  4LCK A;  3I55 F;  1VQM F;  4BVR A;  3NVK E;  1K73 H;  1Q81 H;  4C4W C;  1NMU B;  2KG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...