2P6YA

X-ray structure of the protein q9km02_vibch from vibrio cholerae at the resolution 1.63 a. northeast structural genomics consortium target vcr80.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
131
Chain Sequence
MIHLIALRLTRGMDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVSTLQVSAPFEILSLSGTLTYQHCHLHIAVADAQGRVWGGHLLEGNLINTAELMIHHYPQHHFTREFDPNTGYSELVVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein VCA0587
publication title X-ray structure of the protein Q9KM02_VIBCH from Vibrio cholerae at the resolution 1.63 A.
rcsb
source organism Vibrio cholerae
total genus 28
structure length 131
sequence length 132
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2p6yA00
1XV2A 2P6YA 4BT3A 2DT4A 4BT4A 4BT6A 4BT5A 2HX0A 2NMUA 3HWUA 2H6LA 4BT2A 4BT7A 3HTNA
chains in the Genus database with same CATH superfamily
5BMVB 3WPXA 5J2TB 3OBWA 3VYTC 5IJ9A 1W57A 5CB4A 3RYIA 1YQNA 2UZHA 1KNKA 5LA6A 2BO1A 5JH7B 3ZP7A 3ON1A 1J7HA 2KG4A 2R6R1 4G88A 3TD4A 3MBMA 3VYSC 1RQ2A 4XCQA 5IJ9B 5CB4B 1NQ3A 3RYFA 3U0OA 3RYIB 1CN7A 3FD5A 4B5CA 4BT6A 1SA0A 5LA6B 4ZHQA 5KMGA 2OTMA 1CLIA 3OBYA 3S0WA 3GHZA 3D01A 1RA4A 1GZ0A 4NUTA 3NVIB 2DT4A 1IV2A 1K9MH 3WGJA 5J2UB 3SIVA 1U3PA 4X1KA 2BTOA 3L7QA 1T0AA 4O2BA 4O4LA 3S02A 1Q8RA 1VQLF 3F0EA 3RYFB 2AIZP 1SA0B 4ZHQB 3D54A 2BTQB 4I4TA 5KMGB 3NK6A 3CMEF 5HY2A 4ZHWA 3FFMA 1FNKA 2B33A 5ITZA 2H8CA 4C81A 4O2BB 1VQMF 4O4LB 2HS0A 4DRXA 1XV2A 5CA1A 2VGMA 1JD1A 2YXZA 3JASA 1W5EA 3MCQA 3WJQA 3VOBA 3FD6A 3HKCA 2V9YA 4BT3A 2VAPA 4BT5A 3IKEA 1YIJF 2AMTA 4C4WC 5ITZB 1UI9A 5EIBC 3CPWF 2UYNA 4DRXB 3JATA 5CA1B 1KD1H 5MN6A 3NVKE 1UFYA 1VQ9F 3JASB 2HP0B 2L26A 2QTPA 1IV1A 1Z5WA 1QD9A 2CZWA 1RQ7A 1OAPA 3HKCB 1JY8A 2ZODA 3WGKA 3DDNA 5HP7A 2VXYA 5HXUA 5LXTA 3G71F 2UYNB 1QVGF 1Q82H 3JATB 5EAZA 4BW0B 4E6EA 1XBIA 1TUBA 4BVSA 1TVKA 2ALEA 4YJ2A 4KWEA 3VCZA 5EIBD 2I6DA 5LXTB 3GYQA 2KGWA 3E1YA 2IG8A 3CYQA 1W59A 2CW4A 2ZVYA 3P10A 3CCEF 3B6NA 1VHAA 1VQPF 3FBAA 3NK7A 1TVKB 2DYYA 3CXCF 1XRGA 1X52A 4IHJA 2RB9A 3G4SF 1VQ5F 1YJ9F 5EB0A 1VQOF 5G4UC 1VQNF 3CC4F 1YI2F 3JAMM 4ZI7A 2R751 1W40A 5A2QM 3N4ZA 2G9IA 3LWVC 1SDSA 1N8RH 3KHNA 1DBFA 1H7MA 1QU9A 4IHJB 4X1IA 3RA5A 2GZLA 2OHWA 2LBWA 2OTJF 5EB1B 3LWRC 3HKEA 5GONB 2QEXF 2QA4F 2ZAUA 2FGYA 4HNAA 5JCOC 2MQEA 4ZI7B 5IT9M 3QTYA 4M8IA 3CYPB 3VMFB 1H47A 3WGNA 1VK3A 5LP6C 5J2UA 3V7QA 3E20B 1VH8A 3FPIA 3CG6A 3CC2F 5IJ0A 4X1IB 1YGYA 3Q8HA 2Z1TA 1FFXA 3QHDA 5HY1A 3HKEB 3J81M 3T80A 3IKFA 4HNAB 3K2XA 4PWTA 2IAFA 3OONA 1W5AA 5IJ0B 1FFXB 2ZOVA 4G4WA 1YHQF 2LCAA 3K0TA 3RYCA 3IEWA 1CK2A 4RHAA 1W2BF 1GO1A 3JVHA 4BT2A 3M4SA 1YJNF 1JJ2F 1VQVA 1COMA 3VYUC 1OFUA 4O2AA 2F9ZC 2HP0A 2Z1FA 2GLZA 3LYBA 1Q81H 1RLUA 5GIOC 2LBTA 3LFOA 3RYCB 4EI8A 5HXZA 1U3LA 5LOVA 1GO0A 3N4YA 3S0HA 3N2GA 3UT5A 4C8GA 4YJ3A 4U3JB 4O4JA 4FFBB 3F0GA 4O2AB 2HRUA 2NMUA 4EB6A 3QUWA 4BVRA 3WXMB 3C9TA 3V3TA 3WGLA 1W5FA 5LOVB 3MDOA 2FC3A 4ZHYB 2CHSA 3N2GB 3UT5B 4YJ3B 1DT9A 4O4JB 3JAWA 4IIJA 3F6MA 4O4HA 4LNUA 5C8YA 3LWQC 1VQ4F 4EB6B 3K14A 1IV4A 2Q1XA 2Z1UA 3PAFA 2KTUA 3IEQA 4I50A 1U40A 1W3EX 5IYZA 3CCJF 2H8EA 3JAWB 4IIJB 5C8YB 4O4HB 4LNUB 4ZK7A 2Z01A 3KIZA 1VQ6F 2I6RA 4TV9A 3C9UA 3LMEA 5EZYA 4I50B 5IYZB 1W55A 5KX5A 3V4DA 4EI7A 1Q86H 2CVLA 3P0ZA 3WJPA 2KTVA 5GONA 3V7EA 1R1MA 5HWEA 3CCMF 4TV9B 2OZBA 3VOAA 5EZYB 3KJJA 2QI2A 3PLAC 1SZQA 3CB2A 3HTNA 2YYEA 3I7TA 5KX5B 3JALA 5EYPA 3I55F 2HQSC 3HKDA 1U43A 5FNVA 3JCMM 3ZO8A 4G4ZA 3ZP4A 5JVDA 1KNJA 4BY9D 3IR9A 2Q1YA 3TD3A 2EWCA 2N48A 4ZHVA 1X25A 2UYPA 4ERHA 1JN1A 3LWOC 2K1SA 3R0PA 2PHNA 3JALB 5EYPB 4TZZA 3HKDB 4NWOB 5FNVB 3J80M 3HAXD 2CHTA 5JVDB 5B8FA 2ZF8A 3VI6A 4C8EA 3CCRF 5GANK 3LWPC 5FJ4C 1ODEA 5HY4A 3RE3A 4X3LA 3CCSF 5G4VC 1KC8H 3C8LA 3NMUC 1K8AH 2HS4A 3LDTA 1W581 4BT7A 3VTIC 4TUYA 4G4YA 1X7PA 2Z1EA 3DC2A 2CSLA 2LBXA 1FSZA 3CC7F 1GX1A 3BYQA 5GIPC 3EORA 5JQGA 3CPQA 1W41A 3C9RA 3CCVF 3M84A 4U3JA 1XHOA 4B62A 1ONIA 4FFBA 4O4IA 1QVFF 3ELCA 1W42A 4TUYB 3CCUF 2RHHA 3HWUA 5DCVA 3S03A 2BTUA 5JQGB 3MQWA 3TD5A 3KE1A 4C82A 2HRYA 4X1KB 5AVMA 3VO8A 1FNJA 3D00A 3F0FA 3RYHA 1VQ7F 4O4IB 3CCLF 2H6LA 4NQ3A 1JFFA 3CD6F 1T0KB 4I4TB 1X7OA 3HJWC 2WALA 5MN5A 2ZVZA 4G4VA 5GAPK 2UYKA 5CA0A 1Q7YH 1NMUB 5GINC 3CMAF 3RYHB 3GTZA 4B46A 2RHJA 3HKBA 1KQSF 5FLXM 4RQOA 1JFFB 4EI9A 2GVIA 1IPAA 4X1YA 3AGKA 3WGMA 3N2KA 3I3FA 1VQKF 2VAMA 3O85A 5EO3A 5CA0B 3E22A 3MCAB 3ERNA 4G4XA 3G6EF 5HP8A 2AIFA 3K12A 2P6YA 2PMPA 4X20A 4ZOLA 3WJRA 4BVQA 3HKBB 2OTLF 4R40B 3C9SA 4LCKA 3F0DA 3KJKA 4B45A 4I55A 4X1YB 3N2KB 4TV8A 2W8BC 4U39A 4BVTA 3E22B 4F6RA 2VGNA 3VIUA 1K73H 1M1KH 1S72F 3SIUA 3S0YA 2RHOA 1NJIH 4X20B 5MN4A 1E7KA 4ZOLB 1PXWA 5LYJA 1RLGA 3P4EA 4X3MA 2CWJA 4WBNA 3S06A 3JAKA 4I55B 1TUBB 3ZOPA 5EWRA 2JNBA 2VAWA 4TV8B 4F6RB 4DXDA 5JCOA 3J7AR 4YJ2B 5HY0A 1H48A 5LP6A 2HP3A 3JARA 1M90H 5BMVA 1PF5A 2HS3A 5J2TA 2HVYD 5LYJB 3RA6A 3WPWA 4WBNB 1W5BA 1VQ8F 3JAKB 3ESJA 1Z5VA 1YJWF 5JH7A 1ZWZA 2RHLA 3CCQF 1IV3A 1QAHA 4BT4A 2HX0A 3M1XA 3I56F 1YITF 4C8IA 5LP6B 2UYJA 3OW2F 3JARB 3IMPA 2IQQA
chains in the Genus database with same CATH topology
1XV2A 2P6YA 4BT3A 2DT4A 4BT4A 4BT6A 4BT5A 2HX0A 2NMUA 3HWUA 2H6LA 4BT2A 4BT7A 3HTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XV2 A;  2P6Y A;  4BT3 A;  2DT4 A;  4BT4 A;  4BT6 A;  4BT5 A;  2HX0 A;  2NMU A;  3HWU A;  2H6L A;  4BT2 A;  4BT7 A;  3HTN A; 
#chains in the Genus database with same CATH topology
 5BMV B;  3WPX A;  5J2T B;  3OBW A;  3VYT C;  5IJ9 A;  1W57 A;  5CB4 A;  3RYI A;  1YQN A;  2UZH A;  1KNK A;  5LA6 A;  2BO1 A;  5JH7 B;  3ZP7 A;  3ON1 A;  1J7H A;  2KG4 A;  2R6R 1;  4G88 A;  3TD4 A;  3MBM A;  3VYS C;  1RQ2 A;  4XCQ A;  5IJ9 B;  5CB4 B;  1NQ3 A;  3RYF A;  3U0O A;  3RYI B;  1CN7 A;  3FD5 A;  4B5C A;  4BT6 A;  1SA0 A;  5LA6 B;  4ZHQ A;  5KMG A;  2OTM A;  1CLI A;  3OBY A;  3S0W A;  3GHZ A;  3D01 A;  1RA4 A;  1GZ0 A;  4NUT A;  3NVI B;  2DT4 A;  1IV2 A;  1K9M H;  3WGJ A;  5J2U B;  3SIV A;  1U3P A;  4X1K A;  2BTO A;  3L7Q A;  1T0A A;  4O2B A;  4O4L A;  3S02 A;  1Q8R A;  1VQL F;  3F0E A;  3RYF B;  2AIZ P;  1SA0 B;  4ZHQ B;  3D54 A;  2BTQ B;  4I4T A;  5KMG B;  3NK6 A;  3CME F;  5HY2 A;  4ZHW A;  3FFM A;  1FNK A;  2B33 A;  5ITZ A;  2H8C A;  4C81 A;  4O2B B;  1VQM F;  4O4L B;  2HS0 A;  4DRX A;  1XV2 A;  5CA1 A;  2VGM A;  1JD1 A;  2YXZ A;  3JAS A;  1W5E A;  3MCQ A;  3WJQ A;  3VOB A;  3FD6 A;  3HKC A;  2V9Y A;  4BT3 A;  2VAP A;  4BT5 A;  3IKE A;  1YIJ F;  2AMT A;  4C4W C;  5ITZ B;  1UI9 A;  5EIB C;  3CPW F;  2UYN A;  4DRX B;  3JAT A;  5CA1 B;  1KD1 H;  5MN6 A;  3NVK E;  1UFY A;  1VQ9 F;  3JAS B;  2HP0 B;  2L26 A;  2QTP A;  1IV1 A;  1Z5W A;  1QD9 A;  2CZW A;  1RQ7 A;  1OAP A;  3HKC B;  1JY8 A;  2ZOD A;  3WGK A;  3DDN A;  5HP7 A;  2VXY A;  5HXU A;  5LXT A;  3G71 F;  2UYN B;  1QVG F;  1Q82 H;  3JAT B;  5EAZ A;  4BW0 B;  4E6E A;  1XBI A;  1TUB A;  4BVS A;  1TVK A;  2ALE A;  4YJ2 A;  4KWE A;  3VCZ A;  5EIB D;  2I6D A;  5LXT B;  3GYQ A;  2KGW A;  3E1Y A;  2IG8 A;  3CYQ A;  1W59 A;  2CW4 A;  2ZVY A;  3P10 A;  3CCE F;  3B6N A;  1VHA A;  1VQP F;  3FBA A;  3NK7 A;  1TVK B;  2DYY A;  3CXC F;  1XRG A;  1X52 A;  4IHJ A;  2RB9 A;  3G4S F;  1VQ5 F;  1YJ9 F;  5EB0 A;  1VQO F;  5G4U C;  1VQN F;  3CC4 F;  1YI2 F;  3JAM M;  4ZI7 A;  2R75 1;  1W40 A;  5A2Q M;  3N4Z A;  2G9I A;  3LWV C;  1SDS A;  1N8R H;  3KHN A;  1DBF A;  1H7M A;  1QU9 A;  4IHJ B;  4X1I A;  3RA5 A;  2GZL A;  2OHW A;  2LBW A;  2OTJ F;  5EB1 B;  3LWR C;  3HKE A;  5GON B;  2QEX F;  2QA4 F;  2ZAU A;  2FGY A;  4HNA A;  5JCO C;  2MQE A;  4ZI7 B;  5IT9 M;  3QTY A;  4M8I A;  3CYP B;  3VMF B;  1H47 A;  3WGN A;  1VK3 A;  5LP6 C;  5J2U A;  3V7Q A;  3E20 B;  1VH8 A;  3FPI A;  3CG6 A;  3CC2 F;  5IJ0 A;  4X1I B;  1YGY A;  3Q8H A;  2Z1T A;  1FFX A;  3QHD A;  5HY1 A;  3HKE B;  3J81 M;  3T80 A;  3IKF A;  4HNA B;  3K2X A;  4PWT A;  2IAF A;  3OON A;  1W5A A;  5IJ0 B;  1FFX B;  2ZOV A;  4G4W A;  1YHQ F;  2LCA A;  3K0T A;  3RYC A;  3IEW A;  1CK2 A;  4RHA A;  1W2B F;  1GO1 A;  3JVH A;  4BT2 A;  3M4S A;  1YJN F;  1JJ2 F;  1VQV A;  1COM A;  3VYU C;  1OFU A;  4O2A A;  2F9Z C;  2HP0 A;  2Z1F A;  2GLZ A;  3LYB A;  1Q81 H;  1RLU A;  5GIO C;  2LBT A;  3LFO A;  3RYC B;  4EI8 A;  5HXZ A;  1U3L A;  5LOV A;  1GO0 A;  3N4Y A;  3S0H A;  3N2G A;  3UT5 A;  4C8G A;  4YJ3 A;  4U3J B;  4O4J A;  4FFB B;  3F0G A;  4O2A B;  2HRU A;  2NMU A;  4EB6 A;  3QUW A;  4BVR A;  3WXM B;  3C9T A;  3V3T A;  3WGL A;  1W5F A;  5LOV B;  3MDO A;  2FC3 A;  4ZHY B;  2CHS A;  3N2G B;  3UT5 B;  4YJ3 B;  1DT9 A;  4O4J B;  3JAW A;  4IIJ A;  3F6M A;  4O4H A;  4LNU A;  5C8Y A;  3LWQ C;  1VQ4 F;  4EB6 B;  3K14 A;  1IV4 A;  2Q1X A;  2Z1U A;  3PAF A;  2KTU A;  3IEQ A;  4I50 A;  1U40 A;  1W3E X;  5IYZ A;  3CCJ F;  2H8E A;  3JAW B;  4IIJ B;  5C8Y B;  4O4H B;  4LNU B;  4ZK7 A;  2Z01 A;  3KIZ A;  1VQ6 F;  2I6R A;  4TV9 A;  3C9U A;  3LME A;  5EZY A;  4I50 B;  5IYZ B;  1W55 A;  5KX5 A;  3V4D A;  4EI7 A;  1Q86 H;  2CVL A;  3P0Z A;  3WJP A;  2KTV A;  5GON A;  3V7E A;  1R1M A;  5HWE A;  3CCM F;  4TV9 B;  2OZB A;  3VOA A;  5EZY B;  3KJJ A;  2QI2 A;  3PLA C;  1SZQ A;  3CB2 A;  3HTN A;  2YYE A;  3I7T A;  5KX5 B;  3JAL A;  5EYP A;  3I55 F;  2HQS C;  3HKD A;  1U43 A;  5FNV A;  3JCM M;  3ZO8 A;  4G4Z A;  3ZP4 A;  5JVD A;  1KNJ A;  4BY9 D;  3IR9 A;  2Q1Y A;  3TD3 A;  2EWC A;  2N48 A;  4ZHV A;  1X25 A;  2UYP A;  4ERH A;  1JN1 A;  3LWO C;  2K1S A;  3R0P A;  2PHN A;  3JAL B;  5EYP B;  4TZZ A;  3HKD B;  4NWO B;  5FNV B;  3J80 M;  3HAX D;  2CHT A;  5JVD B;  5B8F A;  2ZF8 A;  3VI6 A;  4C8E A;  3CCR F;  5GAN K;  3LWP C;  5FJ4 C;  1ODE A;  5HY4 A;  3RE3 A;  4X3L A;  3CCS F;  5G4V C;  1KC8 H;  3C8L A;  3NMU C;  1K8A H;  2HS4 A;  3LDT A;  1W58 1;  4BT7 A;  3VTI C;  4TUY A;  4G4Y A;  1X7P A;  2Z1E A;  3DC2 A;  2CSL A;  2LBX A;  1FSZ A;  3CC7 F;  1GX1 A;  3BYQ A;  5GIP C;  3EOR A;  5JQG A;  3CPQ A;  1W41 A;  3C9R A;  3CCV F;  3M84 A;  4U3J A;  1XHO A;  4B62 A;  1ONI A;  4FFB A;  4O4I A;  1QVF F;  3ELC A;  1W42 A;  4TUY B;  3CCU F;  2RHH A;  3HWU A;  5DCV A;  3S03 A;  2BTU A;  5JQG B;  3MQW A;  3TD5 A;  3KE1 A;  4C82 A;  2HRY A;  4X1K B;  5AVM A;  3VO8 A;  1FNJ A;  3D00 A;  3F0F A;  3RYH A;  1VQ7 F;  4O4I B;  3CCL F;  2H6L A;  4NQ3 A;  1JFF A;  3CD6 F;  1T0K B;  4I4T B;  1X7O A;  3HJW C;  2WAL A;  5MN5 A;  2ZVZ A;  4G4V A;  5GAP K;  2UYK A;  5CA0 A;  1Q7Y H;  1NMU B;  5GIN C;  3CMA F;  3RYH B;  3GTZ A;  4B46 A;  2RHJ A;  3HKB A;  1KQS F;  5FLX M;  4RQO A;  1JFF B;  4EI9 A;  2GVI A;  1IPA A;  4X1Y A;  3AGK A;  3WGM A;  3N2K A;  3I3F A;  1VQK F;  2VAM A;  3O85 A;  5EO3 A;  5CA0 B;  3E22 A;  3MCA B;  3ERN A;  4G4X A;  3G6E F;  5HP8 A;  2AIF A;  3K12 A;  2P6Y A;  2PMP A;  4X20 A;  4ZOL A;  3WJR A;  4BVQ A;  3HKB B;  2OTL F;  4R40 B;  3C9S A;  4LCK A;  3F0D A;  3KJK A;  4B45 A;  4I55 A;  4X1Y B;  3N2K B;  4TV8 A;  2W8B C;  4U39 A;  4BVT A;  3E22 B;  4F6R A;  2VGN A;  3VIU A;  1K73 H;  1M1K H;  1S72 F;  3SIU A;  3S0Y A;  2RHO A;  1NJI H;  4X20 B;  5MN4 A;  1E7K A;  4ZOL B;  1PXW A;  5LYJ A;  1RLG A;  3P4E A;  4X3M A;  2CWJ A;  4WBN A;  3S06 A;  3JAK A;  4I55 B;  1TUB B;  3ZOP A;  5EWR A;  2JNB A;  2VAW A;  4TV8 B;  4F6R B;  4DXD A;  5JCO A;  3J7A R;  4YJ2 B;  5HY0 A;  1H48 A;  5LP6 A;  2HP3 A;  3JAR A;  1M90 H;  5BMV A;  1PF5 A;  2HS3 A;  5J2T A;  2HVY D;  5LYJ B;  3RA6 A;  3WPW A;  4WBN B;  1W5B A;  1VQ8 F;  3JAK B;  3ESJ A;  1Z5V A;  1YJW F;  5JH7 A;  1ZWZ A;  2RHL A;  3CCQ F;  1IV3 A;  1QAH A;  4BT4 A;  2HX0 A;  3M1X A;  3I56 F;  1YIT F;  4C8I A;  5LP6 B;  2UYJ A;  3OW2 F;  3JAR B;  3IMP A;  2IQQ A; 
#chains in the Genus database with same CATH homology
 1XV2 A;  2P6Y A;  4BT3 A;  2DT4 A;  4BT4 A;  4BT6 A;  4BT5 A;  2HX0 A;  2NMU A;  3HWU A;  2H6L A;  4BT2 A;  4BT7 A;  3HTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...