2QTPA

Crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
147
Chain Sequence
KIRKIAVFIEETRIEAGREISPPTRKAVAVAVIENPFAGRYVEDLTELMDTGAELGALLGERCVQALGIRPEQAESYGKSAMVGENGELEHAAAILHPKLLVPSSKKMGSPGQVLDVPLGHFDGIEVRLNDAPRANEIMVAVAVTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structures of the first representatives of Pfam family PF06684 (DUF1185) reveal a novel variant of the Bacillus chorismate mutase fold and suggest a role in amino-acid metabolism.
pubmed doi rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Unknown function
total genus 33
structure length 147
sequence length 169
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06684 AA_synth Amino acid synthesis
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.110 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; BB2672 2qtpA00
3BYQA 2QTPA
chains in the Genus database with same CATH superfamily
4O4IA 4O2BA 3S0HA 5CA1B 1ONIA 5LYJB 3LDTA 3LYBA 2QTPA 1W5BA 4O4LB 4O4HB 3V3TA 4X1IB 1VHAA 5JVDA 4I4TB 4TZZA 4TV9A 2WALA 3CCLF 4ZI7A 1SA0B 4RHAA 3VCZA 2GLZA 3GHZA 2OHWA 3CCMF 4O4JB 2Z1FA 5IYZB 3MDOA 4DRXB 3HKBA 3WGKA 5FLXM 3LWVC 1YITF 5LP6B 1KNJA 3HKEB 1UFYA 4G4XA 2H8EA 3UT5B 1SDSA 1W581 1U3PA 1W5AA 3Q8HA 1Z5VA 3C9UA 5FNVA 4B45A 3J80M 1YHQF 1RLGA 5MN4A 5BMVB 4ZHWA 2Z01A 3FFMA 1SZQA 2B33A 3MBMA 2L26A 3C8LA 5ITZB 2KGWA 3F0DA 3JASB 3VYUC 3V7EA 4LNUA 4B5CA 1VQOF 2LCAA 3JATB 2YXZA 5JQGA 4IIJB 3G4SF 2W8BC 2GZLA 4EI8A 2PMPA 3CMEF 4TUYB 4G4ZA 1U3LA 1JN1A 3RE3A 3WJRA 4E6EA 3EORA 4I55B 3ZO8A 2RHJA 2F9ZC 3N2KA 4BT2A 1NJIH 1DBFA 5J2UA 1W55A 3N4ZA 4XCQA 3CPWF 5JH7A 3KIZA 4X1YA 4HNAA 3WGNA 3CCQF 1QAHA 3T80A 5GONA 1M90H 3MQWA 2H6LA 3K2XA 3RYHA 4YJ2A 1CN7A 4B46A 1QD9A 3JAWA 3LWQC 1IPAA 4O2AA 2I6RA 3LFOA 2MQEA 2ZVYA 3ELCA 3VYTC 5IJ0B 2HS0A 4G4YA 2Z1TA 2HP3A 5C8YA 2YYEA 3U0OA 3C9TA 3CYPB 2CSLA 4X20A 1K8AH 3JALA 3BYQA 3HKDA 4TV9B 1Q81H 3CCJF 1NQ3A 3RA5A 1FNKA 1XV2A 4ZK7A 3RYFA 2UYJA 1H48A 5CA0A 3CC4F 1Z5WA 3KE1A 4WBNA 2CHTA 1W3EX 1W40A 4M8IA 4BT3A 1JFFB 1QVFF 3WJPA 3WGJA 2HS3A 3JAMM 4C8IA 3ON1A 4R40B 5HY0A 4F6RB 3V7QA 2LBWA 4ZOLB 3J7AR 3E22B 1X7OA 3FBAA 3K14A 5LA6B 5IJ9A 2I6DA 3E20B 1DT9A 4BVTA 3I55F 1W57A 3N4YA 1OFUA 4TV8B 1FNJA 2KG4A 5J2TA 5EZYA 1QVGF 3K12A 3RA6A 5JQGB 1K73H 2Z1UA 1YJWF 1Q8RA 4I50A 1FFXA 3RYCB 1KC8H 2K1SA 3VMFB 3R0PA 5CB4B 3D00A 1JJ2F 3CCRF 3I3FA 1TVKB 2R6R1 1W59A 3HKCB 3HWUA 4KWEA 1T0KB 3QTYA 3IR9A 3WPXA 3S03A 4X1YB 4YJ3B 4BVQA 2CZWA 1JY8A 3N2GA 5JCOC 3VO8A 3D01A 4U3JA 3CD6F 3JCMM 1VQKF 3RYIA 3TD5A 5HY2A 1ODEA 4FFBA 1RQ2A 5G4UC 3JAKA 3G6EF 3P0ZA 1ZWZA 2KTUA 4ERHA 1YI2F 1VQ6F 2DT4A 3KJJA 3NMUC 5KX5B 1VQVA 4C8EA 2VGMA 5MN6A 5MN5A 2UYNB 5HP7A 3HTNA 3KJKA 1KQSF 1YGYA 5B8FA 3CB2A 2HP0A 1UI9A 3TD3A 4X20B 3WGLA 3C9RA 1W5FA 3PLAC 3DC2A 5EIBD 2G9IA 5EO3A 4C81A 4EB6B 5KMGB 1YIJF 2PHNA 5CA1A 1TUBB 5GINC 1K9MH 1IV4A 5LYJA 5EYPB 3OBWA 4O4LA 4WBNB 4O4HA 3JARB 4X1IA 3VI6A 5AVMA 4BT5A 2OTMA 4I4TA 2HRYA 5GAPK 4DXDA 1SA0A 1VH8A 4ZHQB 2CWJA 2VAMA 4ZHYB 4IHJB 2VXYA 3WPWA 2BTQB 4BT4A 4O4JA 3HAXD 2HRUA 1IV1A 3F0GA 3I7TA 5IJ9B 5IYZA 4BVRA 4DRXA 4X1KA 5LOVB 5HY4A 5EAZA 3LMEA 4BT6A 5LXTA 1T0AA 1PF5A 4O4IB 4O2BB 3VTIC 5LP6A 5EZYB 4BT7A 3HKEA 3CC2F 3UT5A 2BTUA 5GIOC 2Q1XA 3SIVA 5JVDB 3NVIB 5BMVA 1W42A 5LP6C 3P10A 1COMA 4BY9D 4ZI7B 1R1MA 2CVLA 3LWOC 1VQNF 5ITZA 1H7MA 1S72F 3JASA 2HVYD 1CLIA 1W41A 1XBIA 2OTLF 3HJWC 3JATA 3LWRC 2BTOA 3HKBB 2QEXF 3CCVF 4IIJA 3IKFA 3FD5A 2JNBA 1Q7YH 1IV3A 5EB1B 2FC3A 4TUYA 4NUTA 1GX1A 1NMUB 2ALEA 1J7HA 5FNVB 1OAPA 3VYSC 2ZF8A 3PAFA 4I55A 3O85A 4FFBB 2DYYA 1H47A 1GZ0A 3CCUF 4C4WC 4LNUB 2ZODA 3NK7A 5G4VC 4C82A 3C9SA 1VQPF 1IV2A 1X25A 3QHDA 3IEWA 2AMTA 3M4SA 1VQMF 2IG8A 2HP0B 1E7KA 4EI7A 2CHSA 2AIFA 2ZVZA 2KTVA 2HQSC 5HXUA 5IJ0A 3ESJA 1W2BF 3N2KB 5JCOA 2VAWA 3GYQA 5J2UB 3CXCF 2VAPA 2P6YA 5HWEA 1FSZA 3B6NA 5JH7B 4G4WA 2HS4A 4B62A 4HNAB 3CC7F 3FPIA 5GONB 2BO1A 3D54A 3RYHB 4YJ2B 3KHNA 3TD4A 4G88A 5EWRA 1KNKA 3JAWB 2Q1YA 2NMUA 4O2AB 3K0TA 4X1KB 3P4EA 3DDNA 2UYPA 1JFFA 3VOAA 1GO1A 5LXTB 3V4DA 1YJ9F 2CW4A 1VQLF 5C8YB 2IQQA 3IEQA 1PXWA 4F6RA 1M1KH 2Z1EA 4ZOLA 2UZHA 1U43A 3E22A 3WJQA 3JALB 3HKDB 3AGKA 1W5EA 3IMPA 5LA6A 2RB9A 2LBXA 2H8CA 3RYFB 3S02A 3ZP4A 4TV8A 1VQ5F 1X52A 3E1YA 1VQ8F 5CA0B 2RHOA 1Q82H 1U40A 2V9YA 5EB0A 2AIZP 5IT9M 3QUWA 1X7PA 3NK6A 1GO0A 3MCQA 3RYCA 3ZOPA 2ZOVA 5FJ4C 3M84A 4LCKA 3I56F 2EWCA 2HX0A 5CB4A 1CK2A 3FD6A 4BVSA 3CCSF 2ZAUA 5HXZA 3IKEA 3OONA 5EIBC 2QA4F 1TVKA 5GANK 4NQ3A 3JVHA 3HKCA 2LBTA 1YJNF 5J2TB 4C8GA 4X3MA 3CPQA 4YJ3A 1RLUA 3ZP7A 4U39A 3GTZA 4EI9A 4I50B 2UYKA 1FFXB 3CYQA 2OTJF 3F0FA 3OW2F 3S0WA 1VQ9F 5DCVA 1VK3A 3ERNA 2GVIA 3L7QA 3WXMB 5KX5A 4RQOA 3VIUA 3G71F 2UYNA 3F6MA 1QU9A 3CMAF 3M1XA 4X3LA 3S0YA 3VOBA 2FGYA 2IAFA 1XHOA 1RA4A 5KMGA 4EB6A 3MCAB 3N2GB 4NWOB 4U3JB 3RYIB 2RHLA 2RHHA 3F0EA 1TUBA 5GIPC 3SIUA 4ZHVA 3JAKB 5EYPA 1YQNA 3OBYA 3WGMA 3JARA 1RQ7A 1N8RH 5HP8A 3S06A 4G4VA 4PWTA 3LWPC 2VGNA 5HY1A 1KD1H 5A2QM 4ZHQA 3CG6A 1Q86H 2R751 1VQ7F 1JD1A 4IHJA 2N48A 3CCEF 2QI2A 5LOVA 1XRGA 4BW0B 3NVKE 1VQ4F 2OZBA 3J81M
chains in the Genus database with same CATH topology
3BYQA 2QTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BYQ A;  2QTP A; 
#chains in the Genus database with same CATH topology
 4O4I A;  4O2B A;  3S0H A;  5CA1 B;  1ONI A;  5LYJ B;  3LDT A;  3LYB A;  2QTP A;  1W5B A;  4O4L B;  4O4H B;  3V3T A;  4X1I B;  1VHA A;  5JVD A;  4I4T B;  4TZZ A;  4TV9 A;  2WAL A;  3CCL F;  4ZI7 A;  1SA0 B;  4RHA A;  3VCZ A;  2GLZ A;  3GHZ A;  2OHW A;  3CCM F;  4O4J B;  2Z1F A;  5IYZ B;  3MDO A;  4DRX B;  3HKB A;  3WGK A;  5FLX M;  3LWV C;  1YIT F;  5LP6 B;  1KNJ A;  3HKE B;  1UFY A;  4G4X A;  2H8E A;  3UT5 B;  1SDS A;  1W58 1;  1U3P A;  1W5A A;  3Q8H A;  1Z5V A;  3C9U A;  5FNV A;  4B45 A;  3J80 M;  1YHQ F;  1RLG A;  5MN4 A;  5BMV B;  4ZHW A;  2Z01 A;  3FFM A;  1SZQ A;  2B33 A;  3MBM A;  2L26 A;  3C8L A;  5ITZ B;  2KGW A;  3F0D A;  3JAS B;  3VYU C;  3V7E A;  4LNU A;  4B5C A;  1VQO F;  2LCA A;  3JAT B;  2YXZ A;  5JQG A;  4IIJ B;  3G4S F;  2W8B C;  2GZL A;  4EI8 A;  2PMP A;  3CME F;  4TUY B;  4G4Z A;  1U3L A;  1JN1 A;  3RE3 A;  3WJR A;  4E6E A;  3EOR A;  4I55 B;  3ZO8 A;  2RHJ A;  2F9Z C;  3N2K A;  4BT2 A;  1NJI H;  1DBF A;  5J2U A;  1W55 A;  3N4Z A;  4XCQ A;  3CPW F;  5JH7 A;  3KIZ A;  4X1Y A;  4HNA A;  3WGN A;  3CCQ F;  1QAH A;  3T80 A;  5GON A;  1M90 H;  3MQW A;  2H6L A;  3K2X A;  3RYH A;  4YJ2 A;  1CN7 A;  4B46 A;  1QD9 A;  3JAW A;  3LWQ C;  1IPA A;  4O2A A;  2I6R A;  3LFO A;  2MQE A;  2ZVY A;  3ELC A;  3VYT C;  5IJ0 B;  2HS0 A;  4G4Y A;  2Z1T A;  2HP3 A;  5C8Y A;  2YYE A;  3U0O A;  3C9T A;  3CYP B;  2CSL A;  4X20 A;  1K8A H;  3JAL A;  3BYQ A;  3HKD A;  4TV9 B;  1Q81 H;  3CCJ F;  1NQ3 A;  3RA5 A;  1FNK A;  1XV2 A;  4ZK7 A;  3RYF A;  2UYJ A;  1H48 A;  5CA0 A;  3CC4 F;  1Z5W A;  3KE1 A;  4WBN A;  2CHT A;  1W3E X;  1W40 A;  4M8I A;  4BT3 A;  1JFF B;  1QVF F;  3WJP A;  3WGJ A;  2HS3 A;  3JAM M;  4C8I A;  3ON1 A;  4R40 B;  5HY0 A;  4F6R B;  3V7Q A;  2LBW A;  4ZOL B;  3J7A R;  3E22 B;  1X7O A;  3FBA A;  3K14 A;  5LA6 B;  5IJ9 A;  2I6D A;  3E20 B;  1DT9 A;  4BVT A;  3I55 F;  1W57 A;  3N4Y A;  1OFU A;  4TV8 B;  1FNJ A;  2KG4 A;  5J2T A;  5EZY A;  1QVG F;  3K12 A;  3RA6 A;  5JQG B;  1K73 H;  2Z1U A;  1YJW F;  1Q8R A;  4I50 A;  1FFX A;  3RYC B;  1KC8 H;  2K1S A;  3VMF B;  3R0P A;  5CB4 B;  3D00 A;  1JJ2 F;  3CCR F;  3I3F A;  1TVK B;  2R6R 1;  1W59 A;  3HKC B;  3HWU A;  4KWE A;  1T0K B;  3QTY A;  3IR9 A;  3WPX A;  3S03 A;  4X1Y B;  4YJ3 B;  4BVQ A;  2CZW A;  1JY8 A;  3N2G A;  5JCO C;  3VO8 A;  3D01 A;  4U3J A;  3CD6 F;  3JCM M;  1VQK F;  3RYI A;  3TD5 A;  5HY2 A;  1ODE A;  4FFB A;  1RQ2 A;  5G4U C;  3JAK A;  3G6E F;  3P0Z A;  1ZWZ A;  2KTU A;  4ERH A;  1YI2 F;  1VQ6 F;  2DT4 A;  3KJJ A;  3NMU C;  5KX5 B;  1VQV A;  4C8E A;  2VGM A;  5MN6 A;  5MN5 A;  2UYN B;  5HP7 A;  3HTN A;  3KJK A;  1KQS F;  1YGY A;  5B8F A;  3CB2 A;  2HP0 A;  1UI9 A;  3TD3 A;  4X20 B;  3WGL A;  3C9R A;  1W5F A;  3PLA C;  3DC2 A;  5EIB D;  2G9I A;  5EO3 A;  4C81 A;  4EB6 B;  5KMG B;  1YIJ F;  2PHN A;  5CA1 A;  1TUB B;  5GIN C;  1K9M H;  1IV4 A;  5LYJ A;  5EYP B;  3OBW A;  4O4L A;  4WBN B;  4O4H A;  3JAR B;  4X1I A;  3VI6 A;  5AVM A;  4BT5 A;  2OTM A;  4I4T A;  2HRY A;  5GAP K;  4DXD A;  1SA0 A;  1VH8 A;  4ZHQ B;  2CWJ A;  2VAM A;  4ZHY B;  4IHJ B;  2VXY A;  3WPW A;  2BTQ B;  4BT4 A;  4O4J A;  3HAX D;  2HRU A;  1IV1 A;  3F0G A;  3I7T A;  5IJ9 B;  5IYZ A;  4BVR A;  4DRX A;  4X1K A;  5LOV B;  5HY4 A;  5EAZ A;  3LME A;  4BT6 A;  5LXT A;  1T0A A;  1PF5 A;  4O4I B;  4O2B B;  3VTI C;  5LP6 A;  5EZY B;  4BT7 A;  3HKE A;  3CC2 F;  3UT5 A;  2BTU A;  5GIO C;  2Q1X A;  3SIV A;  5JVD B;  3NVI B;  5BMV A;  1W42 A;  5LP6 C;  3P10 A;  1COM A;  4BY9 D;  4ZI7 B;  1R1M A;  2CVL A;  3LWO C;  1VQN F;  5ITZ A;  1H7M A;  1S72 F;  3JAS A;  2HVY D;  1CLI A;  1W41 A;  1XBI A;  2OTL F;  3HJW C;  3JAT A;  3LWR C;  2BTO A;  3HKB B;  2QEX F;  3CCV F;  4IIJ A;  3IKF A;  3FD5 A;  2JNB A;  1Q7Y H;  1IV3 A;  5EB1 B;  2FC3 A;  4TUY A;  4NUT A;  1GX1 A;  1NMU B;  2ALE A;  1J7H A;  5FNV B;  1OAP A;  3VYS C;  2ZF8 A;  3PAF A;  4I55 A;  3O85 A;  4FFB B;  2DYY A;  1H47 A;  1GZ0 A;  3CCU F;  4C4W C;  4LNU B;  2ZOD A;  3NK7 A;  5G4V C;  4C82 A;  3C9S A;  1VQP F;  1IV2 A;  1X25 A;  3QHD A;  3IEW A;  2AMT A;  3M4S A;  1VQM F;  2IG8 A;  2HP0 B;  1E7K A;  4EI7 A;  2CHS A;  2AIF A;  2ZVZ A;  2KTV A;  2HQS C;  5HXU A;  5IJ0 A;  3ESJ A;  1W2B F;  3N2K B;  5JCO A;  2VAW A;  3GYQ A;  5J2U B;  3CXC F;  2VAP A;  2P6Y A;  5HWE A;  1FSZ A;  3B6N A;  5JH7 B;  4G4W A;  2HS4 A;  4B62 A;  4HNA B;  3CC7 F;  3FPI A;  5GON B;  2BO1 A;  3D54 A;  3RYH B;  4YJ2 B;  3KHN A;  3TD4 A;  4G88 A;  5EWR A;  1KNK A;  3JAW B;  2Q1Y A;  2NMU A;  4O2A B;  3K0T A;  4X1K B;  3P4E A;  3DDN A;  2UYP A;  1JFF A;  3VOA A;  1GO1 A;  5LXT B;  3V4D A;  1YJ9 F;  2CW4 A;  1VQL F;  5C8Y B;  2IQQ A;  3IEQ A;  1PXW A;  4F6R A;  1M1K H;  2Z1E A;  4ZOL A;  2UZH A;  1U43 A;  3E22 A;  3WJQ A;  3JAL B;  3HKD B;  3AGK A;  1W5E A;  3IMP A;  5LA6 A;  2RB9 A;  2LBX A;  2H8C A;  3RYF B;  3S02 A;  3ZP4 A;  4TV8 A;  1VQ5 F;  1X52 A;  3E1Y A;  1VQ8 F;  5CA0 B;  2RHO A;  1Q82 H;  1U40 A;  2V9Y A;  5EB0 A;  2AIZ P;  5IT9 M;  3QUW A;  1X7P A;  3NK6 A;  1GO0 A;  3MCQ A;  3RYC A;  3ZOP A;  2ZOV A;  5FJ4 C;  3M84 A;  4LCK A;  3I56 F;  2EWC A;  2HX0 A;  5CB4 A;  1CK2 A;  3FD6 A;  4BVS A;  3CCS F;  2ZAU A;  5HXZ A;  3IKE A;  3OON A;  5EIB C;  2QA4 F;  1TVK A;  5GAN K;  4NQ3 A;  3JVH A;  3HKC A;  2LBT A;  1YJN F;  5J2T B;  4C8G A;  4X3M A;  3CPQ A;  4YJ3 A;  1RLU A;  3ZP7 A;  4U39 A;  3GTZ A;  4EI9 A;  4I50 B;  2UYK A;  1FFX B;  3CYQ A;  2OTJ F;  3F0F A;  3OW2 F;  3S0W A;  1VQ9 F;  5DCV A;  1VK3 A;  3ERN A;  2GVI A;  3L7Q A;  3WXM B;  5KX5 A;  4RQO A;  3VIU A;  3G71 F;  2UYN A;  3F6M A;  1QU9 A;  3CMA F;  3M1X A;  4X3L A;  3S0Y A;  3VOB A;  2FGY A;  2IAF A;  1XHO A;  1RA4 A;  5KMG A;  4EB6 A;  3MCA B;  3N2G B;  4NWO B;  4U3J B;  3RYI B;  2RHL A;  2RHH A;  3F0E A;  1TUB A;  5GIP C;  3SIU A;  4ZHV A;  3JAK B;  5EYP A;  1YQN A;  3OBY A;  3WGM A;  3JAR A;  1RQ7 A;  1N8R H;  5HP8 A;  3S06 A;  4G4V A;  4PWT A;  3LWP C;  2VGN A;  5HY1 A;  1KD1 H;  5A2Q M;  4ZHQ A;  3CG6 A;  1Q86 H;  2R75 1;  1VQ7 F;  1JD1 A;  4IHJ A;  2N48 A;  3CCE F;  2QI2 A;  5LOV A;  1XRG A;  4BW0 B;  3NVK E;  1VQ4 F;  2OZB A;  3J81 M; 
#chains in the Genus database with same CATH homology
 3BYQ A;  2QTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...