2QTPA

Crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
147
Chain Sequence
KIRKIAVFIEETRIEAGREISPPTRKAVAVAVIENPFAGRYVEDLTELMDTGAELGALLGERCVQALGIRPEQAESYGKSAMVGENGELEHAAAILHPKLLVPSSKKMGSPGQVLDVPLGHFDGIEVRLNDAPRANEIMVAVAVTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Structures of the first representatives of Pfam family PF06684 (DUF1185) reveal a novel variant of the Bacillus chorismate mutase fold and suggest a role in amino-acid metabolism.
pubmed doi rcsb
source organism Silicibacter pomeroyi dss-3
total genus 33
structure length 147
sequence length 169
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06684 AA_synth Amino acid synthesis
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.110 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; BB2672 2qtpA00
3BYQA 2QTPA
chains in the Genus database with same CATH superfamily
5LYJA 1Q86H 3QTYA 4C81A 4I55B 4YJ3B 1RLGA 3AGKA 3L7QA 2R751 4O2BB 5CA1B 2HRUA 3O85A 1W59A 5HY2A 1JN1A 1FNJA 2BO1A 2RB9A 2KTUA 3BYQA 4X1IA 3N2GB 4EI9A 5GIOC 3MCQA 5GONB 2HRYA 1W2BF 4I4TB 2NMUA 3OW2F 5J2TA 2LBXA 2V9YA 1NJIH 4ZHQA 1RQ7A 2HQSC 3V4DA 4TV8A 3K2XA 1FFXB 4FFBA 3R0PA 3RYHB 1VQPF 1DBFA 1W41A 5CA0A 1VQLF 1VQNF 2YYEA 2RHHA 5EAZA 2ALEA 5KMGA 5IJ0A 3KE1A 3OONA 3RYIB 2N48A 2VGNA 1TVKB 1YITF 3WGNA 2ZOVA 3MQWA 3M1XA 4B5CA 3CMEF 4U3JB 3C9TA 4BVTA 3CCSF 2L26A 3TD5A 4C4WC 3V3TA 2VAMA 1YHQF 5EYPB 3C9UA 5GANK 4ZOLA 3ZP4A 2H6LA 4I55A 4YJ3A 5J2UB 1KNKA 3SIUA 1U40A 5CA1A 1XBIA 5LP6B 1W55A 3NK6A 3LWQC 3F6MA 1OFUA 1XRGA 4XCQA 5JH7B 3RA5A 3CC4F 3K12A 5GONA 3ERNA 1PXWA 4G4VA 3WGKA 3ZO8A 2OHWA 3GYQA 4X20B 1ONIA 2RHLA 5FLXM 5JCOA 1TUBA 3CG6A 1VQOF 1JJ2F 5HP7A 1FFXA 3LMEA 3HWUA 5LYJB 5ITZB 1FNKA 1H48A 3QUWA 3RYHA 2PMPA 1YJWF 3CYQA 5AVMA 2GZLA 3ESJA 3LDTA 3CD6F 3CXCF 3CCEF 2KG4A 4E6EA 4ZHWA 1S72F 2GLZA 3E20B 4TUYB 2ZF8A 4BT4A 4DRXB 1XHOA 3V7QA 4C8GA 4ZHQB 1VQ9F 5JCOC 3VYSC 3QHDA 5MN5A 1KC8H 4NWOB 4BVSA 1W5EA 4FFBB 3KIZA 4EB6A 2DYYA 3JAKB 3CCVF 1JD1A 5G4VC 1KD1H 5CA0B 2Z01A 3M84A 5MN6A 4G88A 4RQOA 1K8AH 3LWVC 2OTMA 3WPXA 5J2UA 2H8EA 3FPIA 5IJ0B 3B6NA 2Z1EA 2ZVYA 3F0FA 5LP6A 2BTOA 3HKDB 3E22B 3HKCA 3IEQA 3G6EF 2R6R1 4X20A 1W42A 3WGLA 2IAFA 2UYPA 2KGWA 1FSZA 1QU9A 4U39A 5JVDB 4ZOLB 1U3LA 5ITZA 3ZOPA 4EI8A 2Q1XA 2ZAUA 3JALB 3VMFB 3VOAA 4TZZA 2ZODA 4X1YB 1SA0A 1VQVA 3OBWA 2H8CA 4TUYA 1CN7A 2HP3A 1KQSF 1VQ6F 2Z1UA 2WALA 2W8BC 4O2AA 4DRXA 3HAXD 3CC2F 2FGYA 3LWOC 1VQMF 2ZVZA 3ON1A 1TUBB 2IQQA 4HNAB 1T0KB 1VH8A 3CPQA 2CHSA 5C8YA 3CCQF 1JY8A 1W581 4O4HB 3JAKA 2DT4A 3JCMM 3GHZA 1W5BA 1Q7YH 1W3EX 5HWEA 4B45A 3HTNA 3PAFA 5A2QM 1IV3A 1JFFB 1QAHA 3N4ZA 2LBTA 3HJWC 3HKDA 4BT5A 2JNBA 5BMVB 5LA6A 1U43A 3E22A 2CHTA 1CK2A 3CCRF 5IT9M 1X7PA 2VXYA 3CYPB 3ELCA 2QEXF 1X52A 2HS0A 4X3MA 4BT2A 3JVHA 4F6RB 4EB6B 3CB2A 3D00A 4LNUA 5JVDA 2AMTA 1Q81H 2HS3A 3VYUC 4TV9B 3P10A 2UZHA 4C8EA 2K1SA 3JALA 2FC3A 1T0AA 4BW0B 1VQ5F 2OZBA 4X1YA 2VAPA 2CWJA 1COMA 3F0DA 3S06A 2HVYD 1IV1A 2HS4A 1KNJA 2Q1YA 2VAWA 3HKCB 3NMUC 3U0OA 3DC2A 3VYTC 1K73H 1VHAA 1J7HA 1PF5A 3D54A 2AIZP 1UI9A 4O4LB 1GZ0A 4HNAA 1Q8RA 1VQ7F 1YQNA 3KHNA 4O4HA 1W57A 1W40A 5KX5B 1DT9A 3JATB 1VK3A 4G4YA 4C8IA 3JAMM 1W5FA 3D01A 5LOVA 4BT3A 3F0GA 1SA0B 3C8LA 4IHJB 2F9ZC 5LXTA 4ERHA 5HXZA 1JFFA 3RYFB 5GAPK 3S0HA 2I6DA 4DXDA 4O2AB 5BMVA 3PLAC 3CCMF 2RHOA 3UT5A 5G4UC 3N2KB 3WJQA 4G4WA 2GVIA 3VIUA 5C8YB 1ODEA 1UFYA 3IEWA 4F6RA 2OTJF 4X3LA 4BVRA 3DDNA 3IMPA 2QTPA 3S0YA 2P6YA 3J80M 3ZP7A 4TV9A 5HXUA 1N8RH 3C9SA 3I55F 2KTVA 3RE3A 2Z1FA 2RHJA 4B62A 3S02A 3JARA 4EI7A 4RHAA 3WJPA 4BVQA 1YIJF 1SDSA 5LA6B 3LYBA 3JAWB 5FJ4C 3J81M 3C9RA 2BTUA 3VI6A 1Q82H 3TD3A 5IJ9B 3VCZA 3HKBB 1YGYA 4O4LA 4LNUB 3RYCB 3HKEA 2MQEA 3G71F 3J7AR 5KX5A 4C82A 2LCAA 3JATA 3CCUF 3GTZA 4YJ2B 5LP6C 2Z1TA 2BTQB 4IHJA 3MBMA 2AIFA 1IV2A 3RYFA 3WPWA 4ZHVA 2VGMA 5MN4A 3FD6A 3FBAA 4NUTA 3M4SA 5IYZB 1QVFF 3N2KA 5EWRA 2UYJA 3MCAB 4IIJA 5CB4B 1VQ8F 4NQ3A 3N4YA 2CW4A 3KJJA 3V7EA 3P0ZA 1E7KA 4O4JB 3NK7A 5HY4A 1Z5WA 3NVKE 1YI2F 3RA6A 3EORA 3S0WA 5LOVB 1K9MH 4ZI7A 2PHNA 5GIPC 5LXTB 2CVLA 4PWTA 1Z5VA 4I50A 3NVIB 2CSLA 2HX0A 3UT5B 1NQ3A 3JAWA 3VO8A 3FD5A 3WGJA 3WGMA 5IJ9A 3CPWF 3HKBA 3KJKA 3G4SF 3JASB 3MDOA 3RYCA 2OTLF 3IKEA 3P4EA 4X1KB 4O4IB 4WBNA 5GINC 2UYKA 2G9IA 1M90H 1VQ4F 4YJ2A 1YJ9F 1H7MA 1VQKF 1GX1A 2IG8A 3VOBA 3JARB 5EIBD 3FFMA 3I3FA 3CMAF 2QI2A 1X7OA 4R40B 1ZWZA 2HP0B 5IYZA 3E1YA 3OBYA 4G4ZA 4LCKA 5CB4A 5JQGB 1R1MA 4O2BA 3HKEB 3Q8HA 4O4JA 3LWPC 2UYNB 1M1KH 1CLIA 5EZYB 3N2GA 1RLUA 5EIBC 3K0TA 4I4TA 2LBWA 1GO1A 5HY0A 2EWCA 3CC7F 5EB0A 2I6RA 1XV2A 5FNVB 4IIJB 3WXMB 3IR9A 4BT7A 3VTIC 1QD9A 3SIVA 3JASA 3I56F 3CCLF 3TD4A 3LFOA 3RYIA 4ZI7B 4X1IB 4X1KA 4O4IA 1TVKA 1OAPA 1GO0A 1U3PA 1YJNF 4G4XA 4I50B 4U3JA 5J2TB 4M8IA 5HY1A 4TV8B 3S03A 3F0EA 3K14A 5B8FA 4B46A 4BY9D 1IV4A 2HP0A 5EYPA 4ZHYB 5JQGA 1W5AA 5EB1B 5KMGB 1H47A 5DCVA 2UYNA 3I7TA 4WBNB 4KWEA 5EO3A 1NMUB 1IPAA 1SZQA 5EZYA 1X25A 3T80A 1QVGF 5JH7A 3WJRA 3LWRC 2CZWA 3IKFA 1RA4A 1RQ2A 4ZK7A 2B33A 5HP8A 4BT6A 2QA4F 2YXZA 3CCJF 5FNVA
chains in the Genus database with same CATH topology
3BYQA 2QTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BYQ A;  2QTP A; 
#chains in the Genus database with same CATH topology
 5LYJ A;  1Q86 H;  3QTY A;  4C81 A;  4I55 B;  4YJ3 B;  1RLG A;  3AGK A;  3L7Q A;  2R75 1;  4O2B B;  5CA1 B;  2HRU A;  3O85 A;  1W59 A;  5HY2 A;  1JN1 A;  1FNJ A;  2BO1 A;  2RB9 A;  2KTU A;  3BYQ A;  4X1I A;  3N2G B;  4EI9 A;  5GIO C;  3MCQ A;  5GON B;  2HRY A;  1W2B F;  4I4T B;  2NMU A;  3OW2 F;  5J2T A;  2LBX A;  2V9Y A;  1NJI H;  4ZHQ A;  1RQ7 A;  2HQS C;  3V4D A;  4TV8 A;  3K2X A;  1FFX B;  4FFB A;  3R0P A;  3RYH B;  1VQP F;  1DBF A;  1W41 A;  5CA0 A;  1VQL F;  1VQN F;  2YYE A;  2RHH A;  5EAZ A;  2ALE A;  5KMG A;  5IJ0 A;  3KE1 A;  3OON A;  3RYI B;  2N48 A;  2VGN A;  1TVK B;  1YIT F;  3WGN A;  2ZOV A;  3MQW A;  3M1X A;  4B5C A;  3CME F;  4U3J B;  3C9T A;  4BVT A;  3CCS F;  2L26 A;  3TD5 A;  4C4W C;  3V3T A;  2VAM A;  1YHQ F;  5EYP B;  3C9U A;  5GAN K;  4ZOL A;  3ZP4 A;  2H6L A;  4I55 A;  4YJ3 A;  5J2U B;  1KNK A;  3SIU A;  1U40 A;  5CA1 A;  1XBI A;  5LP6 B;  1W55 A;  3NK6 A;  3LWQ C;  3F6M A;  1OFU A;  1XRG A;  4XCQ A;  5JH7 B;  3RA5 A;  3CC4 F;  3K12 A;  5GON A;  3ERN A;  1PXW A;  4G4V A;  3WGK A;  3ZO8 A;  2OHW A;  3GYQ A;  4X20 B;  1ONI A;  2RHL A;  5FLX M;  5JCO A;  1TUB A;  3CG6 A;  1VQO F;  1JJ2 F;  5HP7 A;  1FFX A;  3LME A;  3HWU A;  5LYJ B;  5ITZ B;  1FNK A;  1H48 A;  3QUW A;  3RYH A;  2PMP A;  1YJW F;  3CYQ A;  5AVM A;  2GZL A;  3ESJ A;  3LDT A;  3CD6 F;  3CXC F;  3CCE F;  2KG4 A;  4E6E A;  4ZHW A;  1S72 F;  2GLZ A;  3E20 B;  4TUY B;  2ZF8 A;  4BT4 A;  4DRX B;  1XHO A;  3V7Q A;  4C8G A;  4ZHQ B;  1VQ9 F;  5JCO C;  3VYS C;  3QHD A;  5MN5 A;  1KC8 H;  4NWO B;  4BVS A;  1W5E A;  4FFB B;  3KIZ A;  4EB6 A;  2DYY A;  3JAK B;  3CCV F;  1JD1 A;  5G4V C;  1KD1 H;  5CA0 B;  2Z01 A;  3M84 A;  5MN6 A;  4G88 A;  4RQO A;  1K8A H;  3LWV C;  2OTM A;  3WPX A;  5J2U A;  2H8E A;  3FPI A;  5IJ0 B;  3B6N A;  2Z1E A;  2ZVY A;  3F0F A;  5LP6 A;  2BTO A;  3HKD B;  3E22 B;  3HKC A;  3IEQ A;  3G6E F;  2R6R 1;  4X20 A;  1W42 A;  3WGL A;  2IAF A;  2UYP A;  2KGW A;  1FSZ A;  1QU9 A;  4U39 A;  5JVD B;  4ZOL B;  1U3L A;  5ITZ A;  3ZOP A;  4EI8 A;  2Q1X A;  2ZAU A;  3JAL B;  3VMF B;  3VOA A;  4TZZ A;  2ZOD A;  4X1Y B;  1SA0 A;  1VQV A;  3OBW A;  2H8C A;  4TUY A;  1CN7 A;  2HP3 A;  1KQS F;  1VQ6 F;  2Z1U A;  2WAL A;  2W8B C;  4O2A A;  4DRX A;  3HAX D;  3CC2 F;  2FGY A;  3LWO C;  1VQM F;  2ZVZ A;  3ON1 A;  1TUB B;  2IQQ A;  4HNA B;  1T0K B;  1VH8 A;  3CPQ A;  2CHS A;  5C8Y A;  3CCQ F;  1JY8 A;  1W58 1;  4O4H B;  3JAK A;  2DT4 A;  3JCM M;  3GHZ A;  1W5B A;  1Q7Y H;  1W3E X;  5HWE A;  4B45 A;  3HTN A;  3PAF A;  5A2Q M;  1IV3 A;  1JFF B;  1QAH A;  3N4Z A;  2LBT A;  3HJW C;  3HKD A;  4BT5 A;  2JNB A;  5BMV B;  5LA6 A;  1U43 A;  3E22 A;  2CHT A;  1CK2 A;  3CCR F;  5IT9 M;  1X7P A;  2VXY A;  3CYP B;  3ELC A;  2QEX F;  1X52 A;  2HS0 A;  4X3M A;  4BT2 A;  3JVH A;  4F6R B;  4EB6 B;  3CB2 A;  3D00 A;  4LNU A;  5JVD A;  2AMT A;  1Q81 H;  2HS3 A;  3VYU C;  4TV9 B;  3P10 A;  2UZH A;  4C8E A;  2K1S A;  3JAL A;  2FC3 A;  1T0A A;  4BW0 B;  1VQ5 F;  2OZB A;  4X1Y A;  2VAP A;  2CWJ A;  1COM A;  3F0D A;  3S06 A;  2HVY D;  1IV1 A;  2HS4 A;  1KNJ A;  2Q1Y A;  2VAW A;  3HKC B;  3NMU C;  3U0O A;  3DC2 A;  3VYT C;  1K73 H;  1VHA A;  1J7H A;  1PF5 A;  3D54 A;  2AIZ P;  1UI9 A;  4O4L B;  1GZ0 A;  4HNA A;  1Q8R A;  1VQ7 F;  1YQN A;  3KHN A;  4O4H A;  1W57 A;  1W40 A;  5KX5 B;  1DT9 A;  3JAT B;  1VK3 A;  4G4Y A;  4C8I A;  3JAM M;  1W5F A;  3D01 A;  5LOV A;  4BT3 A;  3F0G A;  1SA0 B;  3C8L A;  4IHJ B;  2F9Z C;  5LXT A;  4ERH A;  5HXZ A;  1JFF A;  3RYF B;  5GAP K;  3S0H A;  2I6D A;  4DXD A;  4O2A B;  5BMV A;  3PLA C;  3CCM F;  2RHO A;  3UT5 A;  5G4U C;  3N2K B;  3WJQ A;  4G4W A;  2GVI A;  3VIU A;  5C8Y B;  1ODE A;  1UFY A;  3IEW A;  4F6R A;  2OTJ F;  4X3L A;  4BVR A;  3DDN A;  3IMP A;  2QTP A;  3S0Y A;  2P6Y A;  3J80 M;  3ZP7 A;  4TV9 A;  5HXU A;  1N8R H;  3C9S A;  3I55 F;  2KTV A;  3RE3 A;  2Z1F A;  2RHJ A;  4B62 A;  3S02 A;  3JAR A;  4EI7 A;  4RHA A;  3WJP A;  4BVQ A;  1YIJ F;  1SDS A;  5LA6 B;  3LYB A;  3JAW B;  5FJ4 C;  3J81 M;  3C9R A;  2BTU A;  3VI6 A;  1Q82 H;  3TD3 A;  5IJ9 B;  3VCZ A;  3HKB B;  1YGY A;  4O4L A;  4LNU B;  3RYC B;  3HKE A;  2MQE A;  3G71 F;  3J7A R;  5KX5 A;  4C82 A;  2LCA A;  3JAT A;  3CCU F;  3GTZ A;  4YJ2 B;  5LP6 C;  2Z1T A;  2BTQ B;  4IHJ A;  3MBM A;  2AIF A;  1IV2 A;  3RYF A;  3WPW A;  4ZHV A;  2VGM A;  5MN4 A;  3FD6 A;  3FBA A;  4NUT A;  3M4S A;  5IYZ B;  1QVF F;  3N2K A;  5EWR A;  2UYJ A;  3MCA B;  4IIJ A;  5CB4 B;  1VQ8 F;  4NQ3 A;  3N4Y A;  2CW4 A;  3KJJ A;  3V7E A;  3P0Z A;  1E7K A;  4O4J B;  3NK7 A;  5HY4 A;  1Z5W A;  3NVK E;  1YI2 F;  3RA6 A;  3EOR A;  3S0W A;  5LOV B;  1K9M H;  4ZI7 A;  2PHN A;  5GIP C;  5LXT B;  2CVL A;  4PWT A;  1Z5V A;  4I50 A;  3NVI B;  2CSL A;  2HX0 A;  3UT5 B;  1NQ3 A;  3JAW A;  3VO8 A;  3FD5 A;  3WGJ A;  3WGM A;  5IJ9 A;  3CPW F;  3HKB A;  3KJK A;  3G4S F;  3JAS B;  3MDO A;  3RYC A;  2OTL F;  3IKE A;  3P4E A;  4X1K B;  4O4I B;  4WBN A;  5GIN C;  2UYK A;  2G9I A;  1M90 H;  1VQ4 F;  4YJ2 A;  1YJ9 F;  1H7M A;  1VQK F;  1GX1 A;  2IG8 A;  3VOB A;  3JAR B;  5EIB D;  3FFM A;  3I3F A;  3CMA F;  2QI2 A;  1X7O A;  4R40 B;  1ZWZ A;  2HP0 B;  5IYZ A;  3E1Y A;  3OBY A;  4G4Z A;  4LCK A;  5CB4 A;  5JQG B;  1R1M A;  4O2B A;  3HKE B;  3Q8H A;  4O4J A;  3LWP C;  2UYN B;  1M1K H;  1CLI A;  5EZY B;  3N2G A;  1RLU A;  5EIB C;  3K0T A;  4I4T A;  2LBW A;  1GO1 A;  5HY0 A;  2EWC A;  3CC7 F;  5EB0 A;  2I6R A;  1XV2 A;  5FNV B;  4IIJ B;  3WXM B;  3IR9 A;  4BT7 A;  3VTI C;  1QD9 A;  3SIV A;  3JAS A;  3I56 F;  3CCL F;  3TD4 A;  3LFO A;  3RYI A;  4ZI7 B;  4X1I B;  4X1K A;  4O4I A;  1TVK A;  1OAP A;  1GO0 A;  1U3P A;  1YJN F;  4G4X A;  4I50 B;  4U3J A;  5J2T B;  4M8I A;  5HY1 A;  4TV8 B;  3S03 A;  3F0E A;  3K14 A;  5B8F A;  4B46 A;  4BY9 D;  1IV4 A;  2HP0 A;  5EYP A;  4ZHY B;  5JQG A;  1W5A A;  5EB1 B;  5KMG B;  1H47 A;  5DCV A;  2UYN A;  3I7T A;  4WBN B;  4KWE A;  5EO3 A;  1NMU B;  1IPA A;  1SZQ A;  5EZY A;  1X25 A;  3T80 A;  1QVG F;  5JH7 A;  3WJR A;  3LWR C;  2CZW A;  3IKF A;  1RA4 A;  1RQ2 A;  4ZK7 A;  2B33 A;  5HP8 A;  4BT6 A;  2QA4 F;  2YXZ A;  3CCJ F;  5FNV A; 
#chains in the Genus database with same CATH homology
 3BYQ A;  2QTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...