2QTPA

Crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
169
structure length
147
Chain Sequence
KIRKIAVFIEETRIEAGREISPPTRKAVAVAVIENPFAGRYVEDLTELMDTGAELGALLGERCVQALGIRPEQAESYGKSAMVGENGELEHAAAILHPKLLVPSSKKMGSPGQVLDVPLGHFDGIEVRLNDAPRANEIMVAVAVTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structures of the first representatives of Pfam family PF06684 (DUF1185) reveal a novel variant of the Bacillus chorismate mutase fold and suggest a role in amino-acid metabolism.
pubmed doi rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Unknown function
total genus 33
structure length 147
sequence length 169
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06684 AA_synth Amino acid synthesis
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.110 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; BB2672 2qtpA00
2QTPA 3BYQA
chains in the Genus database with same CATH superfamily
1W5FA 1TUBB 3MQWA 3C9SA 4YJ3A 2BO1A 2ZODA 3CYQA 1JJ2F 3C8LA 2H8CA 2JNBA 3HJWC 1K73H 1T0AA 3V7QA 3LWVC 1XHOA 3WJQA 3CCJF 1YHQF 2UYNB 1FNJA 3K14A 1KD1H 2F9ZC 3DDNA 5J2UA 2RHOA 1UFYA 3LWOC 1ONIA 4ZK7A 3KE1A 2HS0A 3QTYA 4DRXB 2KGWA 3K2XA 1RQ2A 2UYJA 5CA1A 2RHLA 4EB6B 4X1IA 2BTOA 3IMPA 4C8EA 1VHAA 4YJ2A 3LMEA 4BVTA 3CC2F 5IYZA 2FGYA 3J7AR 3VTIC 4TZZA 5A2QM 1QD9A 1KNKA 2K1SA 1CLIA 2ALEA 1CN7A 5FNVA 3WJRA 2VGNA 3QUWA 2CHTA 3U0OA 4EI9A 5GIOC 4BVRA 1W40A 3RYFA 1IV1A 4TV9B 1RQ7A 5LXTA 2Z1EA 5EWRA 1X52A 3I7TA 3RYCA 1XBIA 4FFBA 1NQ3A 3SIUA 3LYBA 1U3LA 1DBFA 2UYKA 1M90H 2VAWA 3KJJA 3WPWA 2IG8A 1W3EX 3M1XA 4B62A 3M4SA 3VYSC 3S0WA 1JFFB 1DT9A 2VAPA 3ELCA 3CCUF 3VIUA 4C8GA 2Z1TA 3CPWF 2WALA 3KIZA 2UYPA 4BT7A 2ZAUA 4E6EA 3ERNA 5IJ0A 1TVKA 4LNUA 5LA6B 2DYYA 5EZYB 2B33A 3MCQA 5EIBC 1UI9A 4I4TA 3KJKA 3P0ZA 5HP8A 3NVIB 1VQ4F 4TUYA 3PLAC 5CA0B 2Z1FA 1W55A 3CD6F 4NWOB 3E22B 3CXCF 1Z5WA 4O4HB 4ZHQA 5BMVB 3FBAA 3JVHA 5HY2A 3RA5A 5JQGB 5HY4A 1W5AA 3N2KA 3MCAB 4HNAA 3HKDA 1GO1A 3JASB 4B45A 3JAKA 3NK7A 4BVQA 4BT5A 3HKBB 4X20B 1NMUB 2RHHA 4BVSA 4KWEA 2YYEA 1FFXB 1U3PA 3BYQA 3F0EA 2HP0A 1VQVA 3N4ZA 5JVDB 3CCLF 3E1YA 3RYIA 1NJIH 3LFOA 3S0HA 5LYJB 4IIJB 1YQNA 2HP3A 2I6DA 3B6NA 4O2AA 1OFUA 2PHNA 2RHJA 4BY9D 1CK2A 5GINC 5EYPB 5G4UC 2EWCA 1VQ6F 1GX1A 5GAPK 2H8EA 5IJ9A 1SA0B 4U3JA 5KMGA 5KX5B 4O2BA 1PXWA 1QU9A 2HVYD 3NMUC 3FD5A 3CB2A 1X7OA 3AGKA 5LP6B 3WPXA 5GIPC 2PMPA 3WXMB 1VQMF 3JARB 4LCKA 3PAFA 1Z5VA 3V3TA 3ZP4A 2DT4A 5MN5A 5J2TB 4ZI7A 5HXUA 3G6EF 3C9RA 3WGNA 1QVFF 3Q8HA 2Q1XA 4WBNA 3JAWA 4RQOA 2W8BC 4I55B 3RYHB 4R40B 2G9IA 1XV2A 1W2BF 2KG4A 5IT9M 1W41A 5EAZA 4C8IA 5FJ4C 1YITF 1N8RH 1SZQA 2V9YA 1IV3A 3HKCA 4TV8A 1TUBA 3WGMA 2QEXF 3D01A 3VMFB 4I50B 3CCSF 5HP7A 2GLZA 3ZP7A 2CSLA 3V7EA 1ZWZA 3OBWA 2RB9A 4X3MA 3F0FA 3SIVA 1W581 2UZHA 5HWEA 4EI7A 5JCOA 5JH7B 2UYNA 1VH8A 3ZO8A 2CZWA 1RLUA 2GVIA 1YI2F 5GONB 3FPIA 3FFMA 3HTNA 4EI8A 2QTPA 3J81M 3VYUC 2Z01A 3RA6A 2OZBA 4NUTA 4DRXA 4O4IB 1VQKF 2IQQA 4C82A 4EB6A 2YXZA 5C8YB 2BTUA 1IPAA 5G4VC 1QVGF 1IV4A 4G4YA 3I55F 1VQLF 3GTZA 2HQSC 3UT5B 3M84A 3CCEF 5MN6A 2MQEA 1FSZA 3S0YA 1W5BA 1W57A 3JALB 4G4VA 4G4ZA 5HY1A 2H6LA 5CB4B 4X1KB 4TV9A 5EO3A 3CCMF 1PF5A 1X25A 2L26A 1H47A 5FLXM 2QA4F 1YGYA 2VXYA 3OBYA 1ODEA 3C9UA 4F6RB 5AVMA 4O4LB 3R0PA 3J80M 4X1YB 3HWUA 3OW2F 2N48A 3MDOA 3N2GB 3IEWA 4ZOLB 1FNKA 1JFFA 2ZOVA 3CC4F 3JATB 2BTQB 5LOVB 1COMA 4IHJB 5ITZB 3F0GA 1Q82H 3WGJA 5EIBD 4B46A 4O4JB 5LA6A 5EZYA 1QAHA 3GYQA 3HKEB 3F0DA 1VQ7F 1W59A 2Z1UA 2HS4A 4YJ3B 2VGMA 3HAXD 5CA0A 3RE3A 1J7HA 3KHNA 3E22A 3GHZA 4O4HA 4PWTA 5BMVA 1YIJF 5JCOC 1VK3A 5JQGA 1U43A 1Q86H 4BT3A 3JASA 5J2UB 3VO8A 3N4YA 1VQOF 4BT4A 4G88A 3HKBA 4X3LA 4X20A 1RA4A 3DC2A 5CA1B 1FFXA 1M1KH 4X1IB 5JVDA 3P4EA 3O85A 2ZVZA 4YJ2B 3MBMA 3IKEA 5IYZB 5GANK 3VI6A 3ZOPA 1Q81H 5HY0A 5LYJA 4G4WA 2LBWA 3VCZA 3CCVF 1YJWF 2FC3A 4IIJA 4XCQA 2CHSA 5FNVB 3IKFA 3C9TA 1VQNF 3RYFB 3TD5A 5B8FA 3S06A 3K0TA 1OAPA 5EYPA 2OTJF 5LXTB 3IR9A 3L7QA 2I6RA 1KNJA 2OTLF 2KTVA 4DXDA 3RYCB 4BT2A 1JY8A 4FFBB 4C4WC 2HRUA 1U40A 1SA0A 1VQ9F 1VQ8F 5KX5A 2IAFA 4B5CA 1GZ0A 2HS3A 3S03A 2CVLA 3VOAA 5LP6A 1S72F 3VYTC 4BT6A 3LWRC 3JARA 1Q8RA 3ON1A 1JN1A 3WJPA 3CCRF 1KQSF 5J2TA 2LBXA 1W5EA 2AMTA 5DCVA 3LWQC 3T80A 1TVKB 5IJ0B 4LNUB 2ZVYA 4I55A 3RYHA 1VQPF 3CMAF 4I4TB 2AIZP 1E7KA 2OHWA 3CCQF 4TUYB 3LDTA 1K8AH 4ZHWA 3G4SF 3ESJA 4I50A 5EB0A 4ZHQB 2ZF8A 4U39A 1K9MH 3OONA 2R751 3N2KB 4HNAB 3HKDB 5JH7A 1X7PA 1XRGA 3VOBA 2HRYA 3JAKB 3TD4A 4C81A 1VQ5F 3CYPB 5GONA 2KTUA 2OTMA 2AIFA 2NMUA 1H7MA 3E20B 1YJ9F 2HP0B 2HX0A 2LCAA 4O4IA 3QHDA 1KC8H 3RYIB 1JD1A 3P10A 3S02A 5C8YA 2Q1YA 2CW4A 3CG6A 4M8IA 3UT5A 3IEQA 3NK6A 4O2AB 1T0KB 3JALA 1SDSA 1R1MA 3D00A 3TD3A 4NQ3A 4ZHYB 2VAMA 5CB4A 4X1KA 2QI2A 3WGKA 4ERHA 1Q7YH 5IJ9B 3G71F 3K12A 3WGLA 1YJNF 3CMEF 4G4XA 2P6YA 4U3JB 5EB1B 1W42A 3FD6A 3JCMM 3CC7F 5KMGB 2GZLA 4O2BB 4F6RA 4O4LA 4RHAA 3I3FA 3LWPC 1H48A 3V4DA 1GO0A 4X1YA 2R6R1 5LP6C 5MN4A 3EORA 3F6MA 3D54A 3N2GA 4ZOLA 1RLGA 4ZI7B 4BW0B 3JATA 3JAMM 5LOVA 3I56F 4WBNB 2CWJA 4IHJA 3JAWB 5ITZA 3NVKE 4ZHVA 4O4JA 2LBTA 5HXZA 3CPQA 3HKEA 3HKCB 4TV8B 1IV2A
chains in the Genus database with same CATH topology
2QTPA 3BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTP A;  3BYQ A; 
#chains in the Genus database with same CATH topology
 1W5F A;  1TUB B;  3MQW A;  3C9S A;  4YJ3 A;  2BO1 A;  2ZOD A;  3CYQ A;  1JJ2 F;  3C8L A;  2H8C A;  2JNB A;  3HJW C;  1K73 H;  1T0A A;  3V7Q A;  3LWV C;  1XHO A;  3WJQ A;  3CCJ F;  1YHQ F;  2UYN B;  1FNJ A;  3K14 A;  1KD1 H;  2F9Z C;  3DDN A;  5J2U A;  2RHO A;  1UFY A;  3LWO C;  1ONI A;  4ZK7 A;  3KE1 A;  2HS0 A;  3QTY A;  4DRX B;  2KGW A;  3K2X A;  1RQ2 A;  2UYJ A;  5CA1 A;  2RHL A;  4EB6 B;  4X1I A;  2BTO A;  3IMP A;  4C8E A;  1VHA A;  4YJ2 A;  3LME A;  4BVT A;  3CC2 F;  5IYZ A;  2FGY A;  3J7A R;  3VTI C;  4TZZ A;  5A2Q M;  1QD9 A;  1KNK A;  2K1S A;  1CLI A;  2ALE A;  1CN7 A;  5FNV A;  3WJR A;  2VGN A;  3QUW A;  2CHT A;  3U0O A;  4EI9 A;  5GIO C;  4BVR A;  1W40 A;  3RYF A;  1IV1 A;  4TV9 B;  1RQ7 A;  5LXT A;  2Z1E A;  5EWR A;  1X52 A;  3I7T A;  3RYC A;  1XBI A;  4FFB A;  1NQ3 A;  3SIU A;  3LYB A;  1U3L A;  1DBF A;  2UYK A;  1M90 H;  2VAW A;  3KJJ A;  3WPW A;  2IG8 A;  1W3E X;  3M1X A;  4B62 A;  3M4S A;  3VYS C;  3S0W A;  1JFF B;  1DT9 A;  2VAP A;  3ELC A;  3CCU F;  3VIU A;  4C8G A;  2Z1T A;  3CPW F;  2WAL A;  3KIZ A;  2UYP A;  4BT7 A;  2ZAU A;  4E6E A;  3ERN A;  5IJ0 A;  1TVK A;  4LNU A;  5LA6 B;  2DYY A;  5EZY B;  2B33 A;  3MCQ A;  5EIB C;  1UI9 A;  4I4T A;  3KJK A;  3P0Z A;  5HP8 A;  3NVI B;  1VQ4 F;  4TUY A;  3PLA C;  5CA0 B;  2Z1F A;  1W55 A;  3CD6 F;  4NWO B;  3E22 B;  3CXC F;  1Z5W A;  4O4H B;  4ZHQ A;  5BMV B;  3FBA A;  3JVH A;  5HY2 A;  3RA5 A;  5JQG B;  5HY4 A;  1W5A A;  3N2K A;  3MCA B;  4HNA A;  3HKD A;  1GO1 A;  3JAS B;  4B45 A;  3JAK A;  3NK7 A;  4BVQ A;  4BT5 A;  3HKB B;  4X20 B;  1NMU B;  2RHH A;  4BVS A;  4KWE A;  2YYE A;  1FFX B;  1U3P A;  3BYQ A;  3F0E A;  2HP0 A;  1VQV A;  3N4Z A;  5JVD B;  3CCL F;  3E1Y A;  3RYI A;  1NJI H;  3LFO A;  3S0H A;  5LYJ B;  4IIJ B;  1YQN A;  2HP3 A;  2I6D A;  3B6N A;  4O2A A;  1OFU A;  2PHN A;  2RHJ A;  4BY9 D;  1CK2 A;  5GIN C;  5EYP B;  5G4U C;  2EWC A;  1VQ6 F;  1GX1 A;  5GAP K;  2H8E A;  5IJ9 A;  1SA0 B;  4U3J A;  5KMG A;  5KX5 B;  4O2B A;  1PXW A;  1QU9 A;  2HVY D;  3NMU C;  3FD5 A;  3CB2 A;  1X7O A;  3AGK A;  5LP6 B;  3WPX A;  5GIP C;  2PMP A;  3WXM B;  1VQM F;  3JAR B;  4LCK A;  3PAF A;  1Z5V A;  3V3T A;  3ZP4 A;  2DT4 A;  5MN5 A;  5J2T B;  4ZI7 A;  5HXU A;  3G6E F;  3C9R A;  3WGN A;  1QVF F;  3Q8H A;  2Q1X A;  4WBN A;  3JAW A;  4RQO A;  2W8B C;  4I55 B;  3RYH B;  4R40 B;  2G9I A;  1XV2 A;  1W2B F;  2KG4 A;  5IT9 M;  1W41 A;  5EAZ A;  4C8I A;  5FJ4 C;  1YIT F;  1N8R H;  1SZQ A;  2V9Y A;  1IV3 A;  3HKC A;  4TV8 A;  1TUB A;  3WGM A;  2QEX F;  3D01 A;  3VMF B;  4I50 B;  3CCS F;  5HP7 A;  2GLZ A;  3ZP7 A;  2CSL A;  3V7E A;  1ZWZ A;  3OBW A;  2RB9 A;  4X3M A;  3F0F A;  3SIV A;  1W58 1;  2UZH A;  5HWE A;  4EI7 A;  5JCO A;  5JH7 B;  2UYN A;  1VH8 A;  3ZO8 A;  2CZW A;  1RLU A;  2GVI A;  1YI2 F;  5GON B;  3FPI A;  3FFM A;  3HTN A;  4EI8 A;  2QTP A;  3J81 M;  3VYU C;  2Z01 A;  3RA6 A;  2OZB A;  4NUT A;  4DRX A;  4O4I B;  1VQK F;  2IQQ A;  4C82 A;  4EB6 A;  2YXZ A;  5C8Y B;  2BTU A;  1IPA A;  5G4V C;  1QVG F;  1IV4 A;  4G4Y A;  3I55 F;  1VQL F;  3GTZ A;  2HQS C;  3UT5 B;  3M84 A;  3CCE F;  5MN6 A;  2MQE A;  1FSZ A;  3S0Y A;  1W5B A;  1W57 A;  3JAL B;  4G4V A;  4G4Z A;  5HY1 A;  2H6L A;  5CB4 B;  4X1K B;  4TV9 A;  5EO3 A;  3CCM F;  1PF5 A;  1X25 A;  2L26 A;  1H47 A;  5FLX M;  2QA4 F;  1YGY A;  2VXY A;  3OBY A;  1ODE A;  3C9U A;  4F6R B;  5AVM A;  4O4L B;  3R0P A;  3J80 M;  4X1Y B;  3HWU A;  3OW2 F;  2N48 A;  3MDO A;  3N2G B;  3IEW A;  4ZOL B;  1FNK A;  1JFF A;  2ZOV A;  3CC4 F;  3JAT B;  2BTQ B;  5LOV B;  1COM A;  4IHJ B;  5ITZ B;  3F0G A;  1Q82 H;  3WGJ A;  5EIB D;  4B46 A;  4O4J B;  5LA6 A;  5EZY A;  1QAH A;  3GYQ A;  3HKE B;  3F0D A;  1VQ7 F;  1W59 A;  2Z1U A;  2HS4 A;  4YJ3 B;  2VGM A;  3HAX D;  5CA0 A;  3RE3 A;  1J7H A;  3KHN A;  3E22 A;  3GHZ A;  4O4H A;  4PWT A;  5BMV A;  1YIJ F;  5JCO C;  1VK3 A;  5JQG A;  1U43 A;  1Q86 H;  4BT3 A;  3JAS A;  5J2U B;  3VO8 A;  3N4Y A;  1VQO F;  4BT4 A;  4G88 A;  3HKB A;  4X3L A;  4X20 A;  1RA4 A;  3DC2 A;  5CA1 B;  1FFX A;  1M1K H;  4X1I B;  5JVD A;  3P4E A;  3O85 A;  2ZVZ A;  4YJ2 B;  3MBM A;  3IKE A;  5IYZ B;  5GAN K;  3VI6 A;  3ZOP A;  1Q81 H;  5HY0 A;  5LYJ A;  4G4W A;  2LBW A;  3VCZ A;  3CCV F;  1YJW F;  2FC3 A;  4IIJ A;  4XCQ A;  2CHS A;  5FNV B;  3IKF A;  3C9T A;  1VQN F;  3RYF B;  3TD5 A;  5B8F A;  3S06 A;  3K0T A;  1OAP A;  5EYP A;  2OTJ F;  5LXT B;  3IR9 A;  3L7Q A;  2I6R A;  1KNJ A;  2OTL F;  2KTV A;  4DXD A;  3RYC B;  4BT2 A;  1JY8 A;  4FFB B;  4C4W C;  2HRU A;  1U40 A;  1SA0 A;  1VQ9 F;  1VQ8 F;  5KX5 A;  2IAF A;  4B5C A;  1GZ0 A;  2HS3 A;  3S03 A;  2CVL A;  3VOA A;  5LP6 A;  1S72 F;  3VYT C;  4BT6 A;  3LWR C;  3JAR A;  1Q8R A;  3ON1 A;  1JN1 A;  3WJP A;  3CCR F;  1KQS F;  5J2T A;  2LBX A;  1W5E A;  2AMT A;  5DCV A;  3LWQ C;  3T80 A;  1TVK B;  5IJ0 B;  4LNU B;  2ZVY A;  4I55 A;  3RYH A;  1VQP F;  3CMA F;  4I4T B;  2AIZ P;  1E7K A;  2OHW A;  3CCQ F;  4TUY B;  3LDT A;  1K8A H;  4ZHW A;  3G4S F;  3ESJ A;  4I50 A;  5EB0 A;  4ZHQ B;  2ZF8 A;  4U39 A;  1K9M H;  3OON A;  2R75 1;  3N2K B;  4HNA B;  3HKD B;  5JH7 A;  1X7P A;  1XRG A;  3VOB A;  2HRY A;  3JAK B;  3TD4 A;  4C81 A;  1VQ5 F;  3CYP B;  5GON A;  2KTU A;  2OTM A;  2AIF A;  2NMU A;  1H7M A;  3E20 B;  1YJ9 F;  2HP0 B;  2HX0 A;  2LCA A;  4O4I A;  3QHD A;  1KC8 H;  3RYI B;  1JD1 A;  3P10 A;  3S02 A;  5C8Y A;  2Q1Y A;  2CW4 A;  3CG6 A;  4M8I A;  3UT5 A;  3IEQ A;  3NK6 A;  4O2A B;  1T0K B;  3JAL A;  1SDS A;  1R1M A;  3D00 A;  3TD3 A;  4NQ3 A;  4ZHY B;  2VAM A;  5CB4 A;  4X1K A;  2QI2 A;  3WGK A;  4ERH A;  1Q7Y H;  5IJ9 B;  3G71 F;  3K12 A;  3WGL A;  1YJN F;  3CME F;  4G4X A;  2P6Y A;  4U3J B;  5EB1 B;  1W42 A;  3FD6 A;  3JCM M;  3CC7 F;  5KMG B;  2GZL A;  4O2B B;  4F6R A;  4O4L A;  4RHA A;  3I3F A;  3LWP C;  1H48 A;  3V4D A;  1GO0 A;  4X1Y A;  2R6R 1;  5LP6 C;  5MN4 A;  3EOR A;  3F6M A;  3D54 A;  3N2G A;  4ZOL A;  1RLG A;  4ZI7 B;  4BW0 B;  3JAT A;  3JAM M;  5LOV A;  3I56 F;  4WBN B;  2CWJ A;  4IHJ A;  3JAW B;  5ITZ A;  3NVK E;  4ZHV A;  4O4J A;  2LBT A;  5HXZ A;  3CPQ A;  3HKE A;  3HKC B;  4TV8 B;  1IV2 A; 
#chains in the Genus database with same CATH homology
 2QTP A;  3BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...