5MN6A

S. aureus ftsz 12-316 f138a gdp closed form (3fcm)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
296
Chain Sequence
TLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSAEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLILDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title A Polymerization-Associated Structural Switch in FtsZ That Enables Treadmilling of Model Filaments.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 94
structure length 296
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5mn6A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5mn6A01
1RQ7A 5M7EA 3JAKB 4B46A 3HKDB 5IYZB 4B45A 5IJ9A 3JALB 1FFXA 5MN6A 4YJ2A 4O4JA 1W5FA 4X1IA 4ZI7A 5KMGA 4FFBB 4EB6A 4IIJA 4WBNA 5CB4A 4U3JB 5J2TB 2RHOA 1TVKB 4X20A 3ZIDA 2VAPA 4TUYA 5LA6A 4ZHQB 3HKBA 4EB6B 5CA1A 5JVDA 4TV9A 4WBNB 5IJ0A 1W5AA 4I55A 3RYHA 4YJ3A 3JASB 3HKBB 5LOVA 5JVDB 5ITZB 5JCOC 2BTQA 4U39A 3WGMA 5KX5B 5J2UB 4TV8A 4O4IB 5FNVA 1SA0A 5LOVB 1Z5VA 2VAMA 1TUBA 3E22B 4TV8B 5FNVB 3M8KA 4LNUA 1SA0B 3WGKA 5LP6B 4EI8A 2BTOA 4O4HB 3JATB 1TUBB 5GONA 4I4TA 5JQGA 5IJ9B 3JARA 4X1KA 3CB2A 1FFXB 1JFFA 3JAWA 4O4JB 4YJ2B 4X1IB 4ZI7B 5KMGB 3N2GA 4EI7A 4IIJB 3N2KA 3UT5A 5CB4B 4X1YA 5JCOA 4X1KB 3RYIA 4ZOLA 4X20B 5JH7A 3M89A 4TUYB 5LA6B 3ZBQA 5LYJA 2GVIA 4IHJB 5CA1B 4TV9B 5IJ0B 3N2KB 3UT5B 5LXTA 3VOAA 4I55B 3RYHB 5C8YA 2RHHA 2RHJA 4F6RA 3WGJA 4YJ3B 5LP6C 3VO9A 5EYPA 3ZBPA 1RLUA 2BTQB 4HNAA 3RYFA 4I50A 5EZYA 5CA0A 4O4LA 2VXYA 4DXDA 3RYCA 1FSZA 4E6EA 3R4VA 4LNUB 2R751 5MN4A 2RHLA 3WGLA 1W59A 5GONB 4I4TB 2R6R1 2Q1YA 3HKEA 4O2AA 4IHJA 5JQGB 3JARB 1JFFB 3C8LA 3JAWB 3HKDA 5IYZA 4XCQA 3N2GB 3JALA 2Q1XA 4O2AB 4KWEA 5BMVA 4X1YB 4FFBA 4ZOLB 3RYIB 4DRXA 5JH7B 2XKBA 4U3JA 5LYJB 5EIBC 5J2TA 3WGNA 1W5BA 1TVKA 5BMVB 5LXTB 4ZHQA 5C8YB 1OFUA 1Z5WA 4DRXB 4F6RB 3HKCA 4O2BA 3VPAA 5EYPB 3RB8A 2VAWA 4HNAB 3V3TA 3JASA 3RYFB 1W5EA 4I50B 3HKCB 4M8IA 4O2BB 5EZYB 5CA0B 5ITZA 2XKAA 4O4LB 5KX5A 5J2UA 3RYCB 4EI9A 1RQ2A 4O4IA 5EIBD 5MN5A 1W581 3VOBA 3E22A 3JAKA 5LP6A 3HKEB 4O4HA 3JATA 3VO8A
chains in the Genus database with same CATH superfamily
1NMSA 3BEDA 4LISA 4QKQA 3NNNA 2OP1A 3GXOA 1KEVA 3ZZUA 2HJHA 5CPFA 4Q4AA 3FOZA 1LNQA 2FNAA 2GHIA 1TJ4A 2XCIA 3MTJA 3QPBA 4Z9BA 5HKBA 1Z29A 2Q5EA 3FCCA 4IIJF 4OHUA 3LDTA 4YVFA 1MC4A 5A6SA 2B4RO 2Z8ZA 3H2SA 2WJHA 2CVOA 2X8LA 3NIFB 4MQFB 4ZFNA 1CZKA 4JI2B 3X0DA 3EOAI 3ZD9A 4BP9A 3EGDA 3OJFA 2CXTA 4U7JA 3KV1A 2X8WA 2I1VB 1QFZA 1XMXA 3F5SA 3MINA 2V5AA 4EABA 4HYYA 2O1EA 2HT6A 5LD2B 1XYVA 4IFTA 1NVEA 3ROTA 1U9JA 1UT8A 2OHFA 3PHBE 1BCSA 1QCZA 1TJ3A 1TIPA 2JIZA 4UNIA 5TPWA 2V6JA 3TNLA 3DMTA 4UZFA 1H3EA 1CY4A 1UPBA 4WX2B 4R8LA 4EL5A 4ZYVA 4C7MA 2D62A 3TZEA 2N9UA 2V0CA 2XRZA 4J8PA 1Y3DE 3OM1A 2P9GA 1GA4A 2D1RA 2PWAA 3IBGA 4RHYA 5I5GA 3ZP7A 3U7HB 1R6UA 3ZOKA 1FFCA 1YUBA 3JQBA 2SKDA 2C3MA 2Y1GA 2R1VB 2IV3A 4HX2A 3PDIB 2PUGA 2UVQA 1D8AA 3VO2A 3W78A 1XPOA 3P9ZA 3MQ2A 1P7WA 1DAEA 1Z8NA 2UYNB 5PGMA 2WTBA 3V34A 3WMWA 3HWSA 3ZU4A 3O9VA 4PICA 1CE8A 1N2IA 3RSGA 1OVMA 4C04A 2B21A 3RS5A 5D3ZA 2R66A 1QK5A 4OK3A 4PC7A 1P6XA 2HWKA 3IEIA 2JA2A 3RYHB 1Z4QA 1YVUA 2JLSA 2RHHA 2P40A 2QE7D 1E4EA 1S2DA 2FZWA 2IZ0A 2XPCA 2YL2A 4PG5A 4ZEVA 1JDPA 1CQIA 5L3VA 4ARIA 3O8LA 2DBRA 3FLAA 5LVAA 4GS5A 2ZF8A 1NVXQ 3O38A 1G21B 1ZXLA 2BLLA 5FLYA 2YFHA 2QQGA 3VI4B 3RYTC 3VDNB 2AE2A 1TVMA 3JQGB 2QVGA 4HNTA 1IBMB 3K7EA 2ZTSA 2XB2A 1U40A 3UOGA 2BGGA 1VB5A 1TIKA 2Y0DA 1MG0A 3HJGA 3UGKA 4IEEA 3TW6A 1UPUA 4YRNA 1POWA 2QPLA 4LJYA 4EGCB 1J2TA 3WB1A 1LBQA 2R5NA 4RQUA 5JYDA 3OLCX 3UC5A 1YQQA 2DP4E 2EF0A 4K87A 4LF7B 1J06A 3MFYA 1PSWA 4K5QA 3V7WA 2FN8A 3A9RA 1XIVA 1GAQA 2BV3A 4NECA 4KO3S 2CLCX 2YHAA 4LZWA 4P32A 3MJ4A 4U9UA 4FUTA 4XGIA 5AKIA 4ZZ1A 1YGPA 2XV1A 3T06B 2C31A 5LYJB 3AV3A 4CLHA 2O8NA 1ZGCA 1COWA 3O1LA 4OOEA 1PUIA 3HB1A 1KI2A 1T0HB 2W9XA 2UZ3A 1G8GA 1SVIA 4LDNA 5BWBA 2J5XA 2WICA 3F5FA 3IAM6 5JWRA 3S6JA 1K08A 3BXHA 4PRYA 4LY9A 3BMOB 3QHDA 3RRZA 1NI4B 2P2NA 1DJLA 3EZ9A 4MW4A 4GKKB 2I33A 1EFCA 3FYDA 4UU0A 1K0FA 2PUWA 2HV9A 4LE0A 4AX4A 1PR6A 5EHZA 3MWYW 3TRJA 1ZGZA 3FWNA 5KO2A 1DCMA 1TU3A 3ZNNA 1HG1A 1XBTA 2O20A 2XQVA 3OP1A 5DSTA 3KB1A 4C14A 3NX4A 3JD4A 2OB1A 4YAEA 5L3ZA 4DC9A 2PIDA 3C6MA 2IU3A 5KOIA 5LMNB 2DXIA 3ST7A 2NAFA 2NO4A 3KUXA 5WRFA 1YR2A 1CJUC 4JLBA 4MVJF 2V4UA 1FFXA 1XNHA 3KYIB 1ZNQO 1NQUA 2ATIA 4MYTA 3WY9A 5A4KA 2B0JA 1NVDA 1THTA 2GXAA 4Y6RA 3HZHA 1K73H 3LMKA 4BWFB 1GFSA 3RASA 1OFIA 3D7KA 4WXHA 4FT4A 4NYMR 3E58A 4QPZA 4BFCA 4F45A 4J1TA 3E7XA 3TE6A 3ILVA 1URPA 2IYSA 1P3DA 2GZMA 1M1NB 1IM8A 3PRYA 2BFAA 4FFDA 4JGGA 2I7DA 2WJ3A 2P3LA 3ZJVA 4LF9B 1RRPA 4LVOA 1UJ5A 2GHQA 2B8WA 3B3AA 4ENVA 1E2FA 2AT1A 3ORRA 3DMDA 1BVHA 3RU3A 1Q44A 5FOQA 3P2YA 1ZOSA 4IIYA 4GX5A 4KE8A 1K8AH 3F9RA 1XLWA 1ZOLA 4MKHA 3M82A 1F2DA 1M5UA 1EUCB 1G64A 1GVHA 2ET6A 2ZJYA 3UATA 3UB3A 4R31A 3CE9A 3MA0A 4C0XA 5JNUA 1PT5A 2AJLI 3TPFA 7MHTA 2ZYSA 1DQNA 2OM6A 2JFZA 2HLNA 2NAPA 3AB3A 3IOYA 1RKVA 3I42A 3DAPA 2E18A 3KJFA 1V43A 1J24A 1T0JB 1U2EA 2ONYA 4L6IA 4UXHA 1J1ZA 2EZ8A 3CZ9A 4DIMA 4J0JA 4Q00A 3RG8A 1NP6A 2QX9A 3B6KA 4GEKA 1SCAA 3V2HA 4B3IA 4DQKA 1ACLA 3U6BA 1WBDA 3TW4A 3T4PA 1RWMA 2Y8EA 4V0OA 1GAEO 3WMXA 2Q49A 5BN4A 1WOYA 5JI3E 3IIJA 2J7PA 4XFDA 1A69A 5KVAA 2O0MA 5EL0A 4OJMX 1F6WA 3Q3HA 2XUOA 4BVLA 3TD4A 3EBLA 2Z2JA 3LUCA 4HUQB 5AVOA 2H6EA 1NF3A 1G2QA 3ZE6A 4M0UA 2I6UA 4R83A 1Y4SA 3EEIA 1WMFA 2YV2A 4BO5A 4ZN6A 5CLGA 3ZZNA 4G86A 4U7TB 3GCDA 4W5OA 5GVRA 1YU9A 1JXOA 2IYXA 5LDHA 2XMCA 3NVDA 4LJ5A 3OLXA 1NR1A 4ZHWA 2IW3A 4OFXA 4CDGA 2C0CA 4GD3Q 4LC0A 5CNJA 4YV2A 3K70C 4H7FA 2BM8A 2NWQA 2Z4SA 1ZD1A 3DYVA 3VC2A 5IJAA 4B6PA 1CLEA 4OF4A 1GUDA 1QP8A 2PTGA 2YWEA 4WEQA 4TYWA 4BT6A 3W6NA 1PGOA 3QWIA 3EXHC 3MWGA 2R5WA 2BDTA 2YC2C 3B13B 3MUNA 4FKMA 4HLQB 5BOVA 3UK0A 1JG2A 2G72A 5K3CA 3B9PA 3STWA 3C5HA 3A2MA 3SLRA 1JSLA 2DY0A 4DS3A 3QOFA 2I4IA 2IYAA 3C0KA 1UKYA 3ZDYB 2FX2A 1SCJA 1M2VB 2WT8A 3CNLA 3GVPA 5JPCA 1JJIA 1KXJA 3ZWMA 1DLIA 1TEVA 4KU4A 1SUBA 4CM7A 3Q6NA 4HWGA 2PT7A 2ZULA 3HVHA 3RUFA 3VNQA 1WCIB 3NVMB 1K6EA 1DDIA 2HWXA 1YC2A 3CF2A 1GZSA 1HZZA 2A0XA 2XOKA 3H11B 3K1ZA 4ZCLA 5J43A 5JRJA 4Y30A 3KYJB 4AECA 1NJGA 1L1RA 4G1EB 2FWPA 3AHDA 3EEBA 3KVRA 5KAMA 3SHTA 2Q99A 3YASA 3F7NA 3RR2A 1KFCB 1HBJA 3ZGNA 1NUSA 1NW8A 1R4ZA 5I7UA 1J2RA 1KMNA 5KNBH 5L7WA 3D4LA 4RXTA 1BD4A 3IIKA 1TEZA 4F11A 1W5FA 2UYNA 3EVTA 4HK4A 3PF9A 4DZTA 3JW8A 1N8NA 4G37A 3UWPA 4ND2A 4EOGA 5B7NA 4DSNA 2AMYA 1JU3A 1QLWA 4HLUC 5C32A 3CN7A 3RVOA 1RWVA 3HM2A 3MT7A 4BT2A 2B1JA 2R4TA 1M8KA 1CUFA 1U6JA 1DIHA 1PS9A 1XZFA 3RYHA 2DWCA 1ZNXA 2HREA 2NTJA 3PDIA 1R1MA 3Q0TA 4NWIA 4B4VA 4YRGA 5JH7F 4JITA 4BQQA 2HCJB 4CL0A 2W42A 2PK3A 4TTJA 1ADJA 3KUDA 5TMEA 4DUZB 1G21A 5KJ1A 1Q92A 4ZK7A 1RAAA 2AKYA 1PG0A 1I1NA 1ZN7A 2H0AA 2LVBA 3JQGA 5FI1B 4JXZA 4ONEA 4IEFB 2VT7A 4GICA 1XX6A 4N5DA 4XX0A 2GERA 4FHGA 2TSYB 3I5UA 4C1NA 5A4FS 1J2EA 2HS3A 5IM4A 4U8GA 3GO4A 2ERCA 1QBKC 3H84A 1Y7IA 1NU6A 4TLMB 4ANFA 3DH0A 3VIUA 2VP9A 4ZVTA 4EITA 1A88A 1TQHA 2EKLA 5CCEA 2UZ1B 4NH4A 1ZIXA 1NBIA 1OY1A 2X8BA 3IQFA 1E1RD 4G0QA 5EPOA 1T29A 4OUDB 4BJ1A 4B7AA 3AYZB 4DIUA 1EVZA 1R0BA 3ZKAA 5JMOA 5LYJA 4D8WA 4PO3X 2Y05A 3A7DA 3ZY5A 1VKJA 2CSLA 2B8JA 1LSJA 1I3KA 2ZBGA 3QOYA 2R1TB 2YINC 4MEJA 4EFNA 1BW9B 5SZKB 2OHGA 5AI6A 3BMOA 3QX9A 4TTQA 3PRHA 5EP1A 3VJLA 1NI4A 4Z6KA 1DO0A 1T8PA 1Z39A 2EFGA 2JFUA 1TEHA 3EQ2A 4ZV9A 1XDZA 2OMKA 2MCFA 3R6DA 1I0IA 4F5ZA 3R6WA 4XIIA 4EBFA 2X6QA 3CXUA 1E64A 4J0DA 5HHTA 5HZMA 1XG5A 3M3DA 1GKKA 1V48A 1J33A 3AJDA 2LV8A 3Q88A 4JFAA 1JXAA 4KN8A 4OJQA 3UH1A 1ZXBA 4MVWA 4M38A 5L3QB 5JZVA 3BXFA 4PU0A 4W6QA 2ZJ3A 3C3WA 1YCFA 1YFKA 2VTVA 4TWAA 1BDMA 5JBNA 1VL0A 1U0GA 3ITEA 1GTL1 1YBHA 2K6GA 4J7XA 2NX2A 4RDHA 5ABPA 3SR0A 1W5TA 2XA9A 4J0EA 4LOLA 2W2PA 3GLFB 4BFYA 2PFGA 3OX3A 3I01M 3T9CA 1O0CA 2M9MA 3R0JA 3W0LB 4ZHQF 1BQ3A 2PPLA 4YCLA 1SD2A 2P4QA 3CEHA 4NU6A 5DM1A 2Y0BA 5KTSA 1EK5A 4JODA 1VIYA 4D3DA 1GZHB 2XZDA 2X8JB 3GRZA 4HWKA 3SJAA 1M1NA 1G9TA 1QDUA 4KMMA 1ISPA 2BDUA 1OLSA 1QMPA 3II6X 1V5WA 5KB3A 2UYJA 3A4NA 3CKKA 4L27A 1RMYA 4TTAA 3O4VA 4YASA 4CL8A 1C29B 3V4VB 1NBWB 1WQ4A 4GDMA 4RVCA 4K9RA 2ZZMA 3G9XA 4RZSA 4CIVA 1Y6ZA 4PONA 3R3YA 3H65A 5JALA 1Q12A 1KMMA 3C98A 2ACEA 1I2BA 3JWIA 2P41A 3DT9A 1EUCA 1KEUA 4Q1DA 4GGMX 1U2TA 1VMDA 4B47A 2AHRA 4CLEA 1A4XA 4CIYA 3CUYA 1IEVA 4R69A 5EJEA 4FHDA 5H80A 5FV4A 3QQPA 1N6NA 2XXBA 4FDUA 4EZEA 1DKRA 3GLGB 1KYYA 2FETA 4PC1A 2YS6A 1OXXK 5JCPA 4RPGA 5LSAA 1BMQA 1XZKA 4MUNA 2WLSA 3IP8A 5E2AA 4ZMBA 2AUMA 2EHDA 3A9UA 1XF1A 4DR5B 2R4QA 2ZB7A 3DXZA 4G5XA 13PKA 2G9ZA 4UTNA 5EPUA 1OREA 4J2HA 3TLBA 4PHFA 4BVFA 2NUPB 3DZBA 5FA5A 4AYXA 1E9SA 3TL3A 3T41A 4PIMA 3SICE 4NBNA 1PFWA 1XEAA 3TNYA 4BLUA 1JE1A 1PSDA 1AVTA 1JJ2F 1UBTS 1YRYE 5T6MA 4A2QA 2QDXA 4PFSA 1SVNA 3F8WA 2IIBA 4ZGBA 2YIMA 3S40A 2F3PA 1SIBE 1TQ2A 3OAAD 5KEIA 1HNZB 3AM5A 3ZGLA 4AKSA 2Y0CA 3QU9A 4EHBA 1BXKA 1QOQB 4BX9A 5AUNB 3IYLW 1Y81A 3QEMB 4QARA 5AVMA 1PFVA 4ZOBA 1MQ9A 2ZJ8A 5IKOA 3H4IA 2ZJZA 1OIWA 3RC1A 1X92A 2ZTHA 3GUYA 3L7OA 3V4OA 3PJGA 1U4SA 4PZPA 3RTBA 1QTIA 3G2PA 3OURA 5E4FA 1AZTA 1DAKA 4PGAA 4YXWA 3A4VA 1C2TA 5P21A 1P2GA 4E2XA 3B78A 4LJ6A 1I8TA 5D6NA 3IOMA 3BERA 2GK4A 3GRCA 1SVUA 5A5GA 2GCEA 1K8YB 2QENA 4R40A 1TCUA 2WIKA 2HR1A 2G83A 3FVWA 4H3HB 3B51X 1JN0A 1IBLB 4CODB 1BXGB 4V0SA 1WCIA 3BE6A 4KL8S 1WE2A 2F8LA 5BWCA 2PUAA 2BJWA 3CZCA 4MNTA 1L5RA 3H11A 4M0KA 4XFKA 3WQBA 3W3AD 2ZTLA 1PK7A 4P92A 3SGLA 1HE4A 3DDHA 1M1UA 1FDUA 2FF7A 2H7VA 1WV0A 2XKKA 1CWUA 1QH9A 1KO4A 5ICGA 3RHFA 3ZHRA 2AE1A 3NRCA 5C8ZA 2EG9A 3LC0A 3I04A 2PBFA 3SDSA 4F7DA 3IVMA 3GRAA 3D2BA 1GO1A 1XD2B 3Q9LA 3U4CA 2RHRA 1W3EX 1IRXA 2G1AA 1X3LA 3WGNA 1IEXA 2ZPAA 1X9IA 3C97A 3EG9B 4PLCA 1PFYA 2YWCA 1YS7A 4X8LA 3ZU5A 2E3JA 2Y2VA 3PCXA 4CV1A 4NATA 1FEZA 4V0ME 3K94A 4MQMA 1JHPA 1QAMA 3KFXA 3GHZA 3JYOA 3L92A 2UUAB 4H7KA 3I0ZA 4V2IA 7GPBA 3PG5A 4TL6A 1NRWA 4P58A 2HWWA 2WWTA 1PO7A 1ZSNA 2YJ6A 4MARA 5CW2A 4CTOA 3BVPA 2FPGB 3RYCB 2E5FA 1E2GA 3D1VA 3VVCA 4BLWA 1E7KA 2GJAA 3KL2A 5KNCD 2QT9A 5EIBD 3BCRA 3QEOA 2JLYA 4L5IA 4FQ8A 4DNPA 2J9FB 4AZ3B 3F9IA 4XYGA 3NCHA 3C1TA 3NEPX 4PSKA 4O4HF 4GH5A 1XKQA 1UZLA 2QUIA 2DPYA 2RB4A 4RJKA 1XRMA 3D4IA 1JHDA 5F35A 1TPYA 3FPJA 1JECA 3I9FA 4RKRA 1N2ZA 5JJIA 4DIFA 1J8DA 1PD1A 2O0LA 2UZ1A 3BMNA 3SOZA 3O90A 2JHPA 4QYWA 4MWOA 3UW1A 2AIZP 3HV2A 4OUDA 1UIRA 4RE6A 5EJ4A 1TVEA 1WW3A 4N12A 4Q4HB 5CU7A 3SFVA 2HP0A 5DCWA 3WAKA 3RK0A 5KJ6A 4IDNA 3PNSA 2DJIA 1GPAA 1OZHA 4MS1B 4WZZA 3ABRB 2R1TA 5HMLA 4UNNA 1BW9A 1ISIA 1U63A 2CBZA 3R44A 4QEZA 4B3RB 2C3OA 2OHIA 4ID9A 2BELA 5C80A 3LCMA 1DFGA 4FMPA 4DCTA 3NP9A 3ER9A 4H18A 1Z07A 2QRPA 3KV3O 3WVNA 1USIA 1Z5VA 1N75A 3U5TA 1FQKA 2ZB2A 4EI2A 3SNHA 1W9MA 1RLJA 1UT6A 1FNBA 2V9ZA 4LCJA 4K3UA 4KO1S 5TMDA 4HEA6 3RIMA 3M84A 4EEZA 5L3QA 2W37A 2C2MA 2F67A 2PWZA 4ICIA 5DT2A 3ZH2A 4A0QA 3ESDA 2PNFA 3RC3A 1N5JA 1JRLA 4D8YA 2F3RA 2IXBA 5IJ9B 2A88A 2VHYA 2WVJA 2INGX 1K97A 1XK7A 3DE2X 4FSDA 3L43A 3MJVA 2VS1A 4GPZA 4IYJA 5IVIA 3HDJA 4ENUA 1GUFA 4R1MA 1Q14A 3GLFA 2PSEA 5EJMA 5AW6A 3H1TA 3O1HB 2WK1A 3LKVA 4L8VA 3GD5A 2P2SA 1NBMA 5DMHA 4JK3A 5TVKA 2FTKE 3NT2A 3STVA 2A0KA 3WL3A 2X8JA 1HUQA 2CMHA 3G59A 4PBRA 4AN0A 1U0RA 2FR8A 2HBQA 3DM9B 2PJDA 3PDUA 4Y98A 2QJFA 3ZIUA 3TE7A 4ZP1A 2IXTA 2MU1A 3SZRA 4N3GA 3L04A 4BQRA 1US8B 4EAAA 1N8KA 1X7GA 3NP7A 2JK0A 4U00A 1CB7A 4XTCS 3GK3A 1I5EA 4JUAA 1WW2A 3GJQA 3KQSA 3T3EA 1LTHR 4BZPA 1IK4A 2Z1DA 1K9VF 5HKLA 3KAQA 1CY6A 5EQTA 4D5GA 2HSEA 3PEUA 1O95D 4F4IA 5IG2A 1GRNA 5JSFA 3S2ZA 1ANKA 3N70A 4WLFA 4C30A 3FDXA 3WAGA 1OAOA 4Q3AA 3PQEA 3ZXUB 3ZCSA 3KETA 3GLGA 3RVPA 1J56A 1X7XB 1HE5A 3DE7X 4TT3A 3LA6A 1RWXA 4U2EA 1VPLA 2BBSA 4R1SA 5EB1B 5CFZA 3KYDB 2ZJ0A 3RKUA 3K9NA 3IBTA 1VHDA 1P9LA 2KQUA 3O8DA 3T0GA 4DJEC 2Z2YA 1TU4A 3KSUA 3CONA 5CFPA 2NUPA 1KFKB 2FQ1A 1IHPA 3BC1A 5I7EA 5KYGA 2D7JA 3CNHA 4GX0A 4HAWA 2HMYB 4KE7A 2YN2A 3U80A 2G28A 3PCTA 5MDHA 1LPOA 5CGZA 3BJZA 1KF0A 2QLFA 2X6RA 2OSBA 4ARZB 2I71A 2PMCA 2W2LA 3ZDFA 1AV6A 3T3DA 2A33A 2BR3A 1ID8A 3HCBA 3JR7A 2Y66A 4WESB 2C92A 4RY9A 4UAUA 2WV7A 3GPBA 4DCGA 1VYHA 1GLNA 1QG0A 1D2HA 5AVRA 3QEMA 2VHWA 3VZBA 4XYLA 1KKLA 4JLDA 3PENA 3UXMA 4HWOA 2ZI7A 2GXSA 1T5BA 2PDAA 1S7CA 2H8GA 3FX2A 5CJPA 4IDAA 4BT5A 4PRLA 3CCUF 1M90H 3UWKA 4BMZA 3JWPA 4QSHA 2PWPA 5J47A 4HDRB 3P2EA 2C9MA 5F1YA 4ASUA 2GCOB 1W2GA 2L19A 1P7VA 4KQHA 2NZUG 3IPRA 4F4HA 2AYYA 3CF0A 3U48A 1LCIA 4Q6WA 4MO9A 2CZCA 4HQFA 3E0XA 3HUEA 2PUVA 1HDRA 2HDOA 1G291 2CBXA 2H1IA 3AFIA 3IJPA 2OCGA 4M37A 5DHQA 4BUJA 2XGJA 3T52A 2IA5A 5FORA 4Q7MB 3ICCA 4E7OA 3G1TA 2X9NA 1X7WB 3LQ2A 5DHAA 1E0KA 3FDIA 4R81A 5FPPA 2XCTB 2BL4A 5AJVB 2HA7A 1GU7A 2CLSA 2QZJA 3C7CB 1AK2A 2VXOA 1FJHA 2CXPA 5TNXA 3F46A 1EFPB 3KHKA 4JJGA 1H0HA 5EIEA 1LGYA 2Y1LA 4RK6A 2V4ZA 4LRSB 1XD2A 4HNQA 1K7XB 1DKPA 2KM1A 2YY7A 2IIVA 2YYSA 2NTNA 3R9IA 2JCVA 3RRBA 1CRQA 1L7VC 3ZDQA 5CVVA 1YJXA 2ZBEA 3EG9A 3QI2A 3V7NA 3JQ8B 3W2HA 3DL0A 3B12A 3WX0A 5HP7A 3X3HA 1V35A 3E9CA 4WGFA 1ZSVA 4DFDA 2QR2A 4GRAA 3HJRA 4D9HA 4IIGA 3ME5A 4HJRA 4UPVA 4LSWA 3BREA 5EJ5A 4RPKA 5EZ6B 4BTVA 1CQXA 4JYMA 2VYND 4MJLA 3DHVA 4JAVC 1EG2A 3RYCA 2FPGA 4N3NA 1RAIA 2VRCD 2VWHA 3D7MA 4W1PA 2I2XB 5DEIA 4CYMA 1HH4A 4B80A 3K31A 3D6UA 5AJYA 4DQLA 1K8QA 2GEDA 3CSDA 3NUZA 2B94A 3T1VA 5I51A 1U3GA 2OT3B 2Y68A 2J07A 2VHTA 4AZ3A 5B3JC 2II6A 4EPTA 1UOQA 6NULA 2ZVQX 3AR8A 1VYUA 2NXNA 2XUFA 4JOQA 5IXYA 2H5IA 2OHOA 3F6YA 4BMDA 3JTEA 2VIIA 1L5MA 1CRPA 5TDHA 3NMUF 2C00A 2I2DA 3JWGA 4XX1A 1YVRA 4DLRA 4FNAA 1OI2A 3THYB 1XCGB 5JSKA 2JZOA 2WWFA 1QFYA 1Y9AA 5JE8A 1WUTA 4Q4HA 4ZMRA 2OFPA 4UFPA 5KQLA 1HNWB 1RJDA 4B6SA 4I7EA 5BN3A 4MS1A 1WMBA 2RJOA 2XOXA 1N2CB 4QHSA 3G5MA 2Q41A 3FTNA 3MXTA 2B6NA 1RRGA 2EQBA 3ABIA 4P7KA 4A6EA 2BSQA 2GN1A 3QFHA 3PXXA 1RPAA 3ZWDA 4IG4A 3EMDA 1YS9A 3RC7A 1F48A 5FWXB 4F93B 2ZVZA 4ZO7A 1NSFA 1QV6A 2ZYTX 4HGZA 5HIJA 1YULA 3MWKA 3FWZA 1JB1A 2XMGA 3UG6A 1L4HA 3L46A 2I9KA 5IZCC 1UZAA 1RC1A 1HYBA 3IT2A 3PC8C 2WFLB 2RKOA 4NZOA 4JD5A 3UYKA 1XZIA 3MAAC 5IJ9A 1S9HA 3HYTA 4H77A 2WA1A 2O14A 4MPRA 2BLNA 2P90A 2QW8A 4MVJH 3ZUGA 4BEJA 4D9JA 5JS7A 5CB6A 4IHAA 4J3FA 2R9VA 2EVWX 3EHEA 4WNAA 1VRVA 2ZWAA 1G20E 5GADl 1U2QA 3AHCA 2C82A 4PW0A 3K2IA 3PR1A 5TEWA 1D4OA 2HA2A 4TGLA 4X6UA 4KPUB 1UC5B 2QL7A 2VYNA 3ZNPA 3S0YA 1KYVA 1OHHD 3IA7A 4FHCA 1P0CA 5KQPA 1VLVA 3HB0A 4QVGA 2R1UA 4UXJA 3RTGA 3BXGA 1V5FA 3QEJA 1N6OA 3WFZA 2BD0A 1ZK4A 4RHFA 5A1TA 3FUWA 3H9QA 5DBHX 4FLMA 4P1ZA 5D00A 4LBZA 1B7GO 3TOSA 5KVVA 1IHDA 3VNUA 4F2WA 1F06A 4R01A 2F55A 2ZPTX 2QW0X 2XR1A 4WQMA 2GZRA 5KNBA 3I83A 2VUSA 3IODA 3N86A 1PZGA 1US8A 3AXTA 4DLZA 3K96A 5C1IA 1LF5A 1VKHA 4BMCA 2FSSA 3EC1A 5I7AA 3Q3GE 3UJ9A 1GZ7A 2PMFA 4H4CA 3IQIX 3VH3A 3MQWA 2NZVG 4ZDJA 3UFBA 4KAFA 3KWMA 3SI7A 1T2FA 1GY8A 3HI6A 3ND7A 3ZU2A 4R8MA 4RW0A 4X1KB 2GF2A 1U9IC 3VHLB 1I33A 3VZSA 4LI3X 5LA6B 1X7XA 2V6GA 4M8NE 1H9CA 3V97A 4JI5B 2QVYX 2ZBVA 4MWDA 4YV7A 4NJMB 2H1HA 4EG7A 2A2ZA 2P79A 4WJZA 1E6MA 1SRRA 3KYDA 1ZY2A 5IJXA 3CNEA 3U3JA 3DFMA 3B36A 4EGFA 1OWLA 3E4DA 1WO8A 3E9QA 1TK3A 2IYFA 3IKEA 5AJUA 1J8VA 1OXUA 5DTIA 3P0JA 5H81A 4KHPB 5KYWB 4RH3A 5T41A 4EECA 5JFOA 3C41J 1F9AA 1R0LA 1NQVA 3OY2A 1U8EA 5EJ7A 2LWIA 1OBCA 1XZDA 3C8MA 3R5XA 4MLDA 4TMXA 2I8LA 1N5LA 4ENWA 3O94A 1MZVA 2FN7A 1WUIS 3GAFA 2CLHB 3FNHA 3VTIC 1ZIYA 3IQEA 1LVGA 3BGDA 5AQ1A 2YICA 4LAFA 4ZYXA 4LE1A 2F1OA 4GUAA 4WESA 3S4YA 4F38A 2ETXA 3M1AA 3S2FA 4B3CA 4NCBA 2YCLA 4YP0A 3HMQA 3NHRA 4NBRA 4ADSG 2GEUA 2O0JA 3WLNA 2VF8A 4J1QA 4IZIA 4M9ZA 3DOEA 4URZR 4E51A 1J7JA 4HT3B 3FWYA 1QHXA 1QOPB 3MPOA 2QQ5A 1PJSA 3CRW1 2Z3ZA 1CQZA 1ZVMA 4I5DA 3E20B 4WCFC 3JQDA 3H5OA 1J00A 1KETA 4HDRA 1E3IA 3LAWA 5IUJC 3ZD6A 4DZRA 1V8FA 3AFOA 3GFQA 2XNDD 2GCOA 5IF9A 1PZHA 2J5QA 2WJ6A 4QUIA 4QVKA 4G81A 2QMQA 5JAIA 4JP1A 2FZLA 4UDNA 4ZQGA 2ATVA 2AFRA 4DDWA 1TO2E 1MJ5A 1WKBA 4ISBA 1PWZA 1U3CA 4MGZR 4Z5XA 4W5TA 3IUBA 1RQPA 1TTTA 5C1PA 4IR7A 1ZCAA 2GPTA 1X7WA 5DK4A 1VBKA 4DGSA 1NRIA 1RQ7A 2JGRA 3ANLA 2X7HA 5GJVC 4G8BA 3IPAA 4Y8VA 2XD4A 4CDRA 2QY9A 2LGJA 1NL3A 1EQ2A 3IBSA 2I80A 1SXIA 5FBVB 1QTNA 3WL5A 1MIOB 1SQFA 4C05A 4X61A 1EE2A 4DDTA 1RI4A 4ENQA 2AN3A 3SIXA 5EVJA 2C4KA 4FUQA 1AQYA 3JQ8A 4B33A 3M83A 4G24A 1UPFA 2CY0A 3NYRA 2PX8A 2O54A 3LIPA 1A97A 3IAAA 5JNSA 1JDSA 1E2UA 4H1VA 2ZS9A 5EJ9A 1SWWA 3UKDA 3W04A 3THRA 3WKCA 2I6TA 4J0HA 1N32B 1P2UA 2WJIA 2Z6QA 2Q3FA 3GRPA 3SKXA 1VQLF 4PEVA 1WCV1 2X9GA 1NC1A 2JJ1D 3X2FA 4BEBA 4K9OA 5KTRA 1X74A 2V74B 3CJRA 2KTUA 4RSRA 1PL0A 2VSQA 4UD2A 5JISA 2XT6A 4MQUA 5EFZA 1OTYA 3H1PA 3HSSA 3CN9A 4QBFA 1B6SA 5CLJA 5LDDC 3RRNA 3THYA 3DEFA 5F4BA 5AO9A 3WRVA 3TMAA 3KJIA 4OQMA 1ZGHA 2CDCA 2XNDA 4TKVA 4LJ8A 4K9PA 1YASA 1R50A 3DOIA 4K7JA 2D5IA 2AUNA 4I5GA 3WLQA 4DYDA 1N2CA 3TSCA 4KLAA 4JP5A 4N6OA 2XYPA 1ZUNB 2LXNA 1SKAA 2IWRA 3GGSA 4FFOA 3NXKA 3EORA 1IZ7A 2Z57A 2MTBA 3QPVA 3PNQA 2W2VA 4P2BA 2PT5A 2QDKA 3TVTA 5BV8A 3G2MA 3ICEA 1MFPA 2ZI9A 3DO8A 3IUSA 3T1TA 1DMRA 5I8ZA 3GAZA 5JUWA 2HCTA 4W9NA 1Q6ZA 1L7NA 1LJLA 5FTJA 2B7CA 4BLOA 2HJRA 3LT5A 5FF9A 3WICA 4UUQA 1U94A 3CCFA 2WFLA 3AIIA 3G2HA 4BC1A 2IE0A 4LRTB 1N3LA 3BOSA 5K9ZA 3JD3A 2AZXA 1L9KA 1P5ZB 3VYWA 1RJ9B 3C5WP 4Q3KA 5DI9A 4EUNA 2YJGA 3DXYA 3P20A 1ODEA 3R5FA 4IS3A 1GPH1 3VH4A 4L8WB 5BMVB 3HSYA 2WIDA 3AI2A 3HYCA 3MUFA 4Y6OA 4M0LA 1TU0A 4KPUA 5TVGA 1ZH4A 5IVPA 5K20A 1NWCA 1OBHA 1DPGA 3NBQA 2J0VA 1EDEA 3L1UA 2Z56A 1F7VA 1YJWF 1YS2X 2OAGA 1YDWA 3LNTA 1E7WA 5DDIP 3DE3X 3HXMA 4Y2VA 1JQEA 1N7IA 1LPMA 1SXJD 4P3OA 1RQ2A 1AUPA 1Y33E 2C83A 2GB4A 4UMDA 3ZN2A 5EJ6A 5GJCA 3PNLA 4EY3A 2RH8A 1WDKA 1SVKA 2WU0A 1LDGA 4TV8F 1JEQB 3ETJA 1VB3A 1WVIA 2REXB 2QRMA 5FKJA 4EPRA 4F21A 1RHKA 1S1MA 3Q2KA 1AQNA 3QLVA 1E6LA 1CNFA 3PNPA 5AW4A 3AX6A 3GP3A 4DY6A 2GX6A 2OR3A 4Q9HA 1YZYA 4US2R 5FEMA 1TQDA 5EC8A 3GYBA 2H4HA 1QIGA 1JDBB 2ZXFA 1K3TA 4JFRA 2R8PA 3PWTA 1L5WA 1AZSC 1BRMA 1OZ0A 1JHRA 3LY7A 1SCQA 4KGDA 3ROFA 3RSOA 4Z54A 5LA6A 4GM1A 2WSYB 3LWZA 3MHPA 3PVZA 5AKKA 4EW2A 4QX6A 2VDQB 5REQB 2PX5A 3CM0A 3U4AA 1QD9A 3F71A 2PZMA 4EJ6A 2DUNA 4QATA 3K71B 1H7MA 2DFLA 5FADA 4IWNA 5LQKA 4OY3A 3H2ZA 3VPXA 5BPHA 5D01A 4JLSA 1D5CA 2KS6A 3BICA 2A0FA 3GFBA 4X3CA 5BT9A 4BC0A 4MUIA 5KYWA 4OKIA 2V7QD 2P65A 2VYVD 3DFFA 2QRLA 2RAVA 2WU3A 4UD6A 5GM2A 1T9KA 2IPLA 5KSZA 1E2HA 1R74A 4YNBA 5H83A 5JSUA 2HXYA 3NYIA 2R79A 3E61A 3VKHA 1P81A 4A8JB 2FZKA 3GRFA 2PX6A 1IATA 1YR7A 4KODA 4DLKA 3FOAA 4E88A 2OZLB 4O8CA 2RD2A 1T0BA 3U56A 2NU8B 5A4IS 4K81B 3WRWA 4CUZA 4GQBA 1PJLA 2PUCA 2A84A 3SIPA 5LMZA 1VE6A 4XM2A 4DV2B 4LRXA 4ML3A 4I1IA 1DZIA 3E2IA 3AESB 3JRNA 1XNRB 1Y5MA 2HJ9A 3GL9A 2GTHA 4KJZA 1GQQA 1J8MF 4FCCA 2Y4NA 4JC8A 3TDNA 4EYEA 1X52A 3A04A 5BV7A 1J0CA 2R60A 1OASA 5TB5A 3LT0A 4K2AA 2LBPA 3JPYA 4Z9XA 5LBIA 5TJ9A 5TS2A 3ZU6A 1CR1A 4F46A 1NR5A 4Q1BA 3VNAA 1IV4A 4PX9A 5F2OA 1XI2A 3AY3A 3W79A 1VK3A 1PFGA 3D1LA 1UDXA 3VTKA 5TLSA 3H5RA 4TSRA 2R00A 2W6ZA 4BB5A 2OENG 3MDOA 1TT5B 5CIQA 5K0SA 3QMWA 5CITA 4XQEA 2DPMA 4JA2A 4U7WA 3TJRA 5BSKA 1FCJA 4UUOA 3ZYZA 3S3TA 1GGHA 2I34A 1VZ2A 1EU1A 2PS3A 5AKXA 3QFCA 5JS2A 4R9VA 5LNK1 3UT0A 4L5JA 4J4BA 1T2DA 2AI1A 3AUFA 3IALA 4DEYA 1GPUA 4RACA 1XRJA 3OTWA 4C0KA 1D09A 5CDYA 4Y2HA 2DEUA 4RVHA 3DNFA 1Y8CA 1CQJB 1XCLA 3R09A 5IK2A 2JEZA 2D74A 3HWX1 1N6HA 1ZIOA 1WLYA 4G8DA 2VEDA 5IUNC 1MIOA 3OO0A 1OJ7A 2ZANA 2ZYGA 2R5FA 5C8YB 1OFUA 2IZZA 2X23A 3OT1A 4BT7A 4HD8A 4ZVRA 2FQYA 2MYUA 3QA9A 4I2NA 5FBLB 2VYVA 1BDHA 1T0UA 2V6MA 2WZQA 3WLMA 1H66A 1TKRA 1JQAA 4PE5B 2IQQA 2VF2A 4D26A 2GZSA 3RIGA 1Y1RA 4AWBA 3O8BA 1D1TA 3UMCA 3QX3A 4PHHA 2GA8A 1I3MA 2Z2IA 4RTSA 2NYVA 3REGA 1UEXC 1NPYA 4LXHA 2C84A 2O1SA 4B84A 5FO1A 2Q2QA 4Q02A 2EATA 3FW1A 3D3EA 3G1WA 3OZAA 1R15A 4X97A 4D0LB 3SHVA 4DMKA 3FUVA 2J7KA 4E1AA 1YJ8A 1EK6A 1HOXA 4LA4A 3UB4A 1HYGA 1U2RA 3BL5A 3PXEA 4GMGA 4A8TA 3O8OB 4S12A 3ENNA 1G19A 1RXIA 2J08A 2YYEA 3ON1A 2HQRA 1G55A 3L93A 1B16A 4XQ9A 3RBAA 3ROEA 1JXQA 2QRJA 2FVYA 4OQFA 3WRXA 3HG7A 5GVSA 5IWCA 3EGCA 4CXMA 4XGNA 4G0PA 1KRHA 2OCIA 3MMXA 1SWVA 3NBAA 3Q8LA 2Z1MA 2ZUTA 5KSOA 2QYSA 1LBEA 2RAPA 1KHHA 4GP9A 4BFTA 3B82A 2XTMA 3E23A 1QKKA 3GGJA 4HAVA 4QGBA 5AMXA 1XWFA 4HB0A 4H4DA 4CMGA 1EYZA 2ORWA 4FB4A 5K0BA 1M66A 1V8PA 1XZAA 2OO3A 4A5SA 4Q12A 4NXMB 1VOTA 3I6IA 1W0KA 3V7UA 3VMMA 4BAGA 1ZUNA 5JIBA 1SCBA 4XVQA 3VPDA 3UJNA 3NYQA 4AMUA 2DLCX 1FSFA 4A2PA 1CULC 3S1SA 3DLTA 4MP6A 5LOVB 1U0NA 3H9CA 3C8ZA 1ONBA 4HADA 2I5PO 3LXXA 1BVRA 5BUZA 3OBBA 3RGWS 3R9KA 2VJPA 3R8FA 1C0KA 1NNUA 4R7GA 1AGXA 2VNIA 3M7IA 4GP7A 4P4NA 4DAOA 1MO4A 2QSJA 3GMTA 2J3DA 3PGLA 3U0BA 2G4LA 5KIAA 1JVNA 2BMJA 5KU7A 3D31A 4Y7CA 2ZIVB 4NZNA 1E60A 4R84A 3JYHA 1E6CA 4M1OA 4P22A 1A9ZA 1CZNA 2GPWA 1VJTA 4YRSA 1RJ9A 1UWCA 4RIHA 3KIZA 3NVKE 4HN9A 2E1RA 1Y82A 5CBKA 2MINB 1R0SA 1Q74A 3E7PA 3IAFA 5AVWA 1VQMF 1JA1A 5FBRB 4WFJA 3NVKI 1ZIPA 1Z74A 2NN3C 4DA9A 1SC9A 1JNXX 4L85A 1TF7A 2NMUA 2AX3A 4HGYA 4J0IA 1KL7A 4YRJA 3GVXA 4J3JA 4RMHA 2ZAIA 2QLMA 2E6UX 4FEEA 1M2OB 3TZLA 3ZZ0A 2GPBA 3L8GA 1W96A 3AM4A 4ILEA 4LOKA 5JLAA 1A7AA 1EZ4A 1FPQA 1Z2CA 3D6NB 3PT9A 3HCAA 1EWYA 4MPTA 2OHHA 4MVYA 2R751 4MV1A 2P6MA 4ZVOA 5HXAA 2Q50A 1M34A 4JKOA 2CNDA 5BOSB 1XZNA 1W87A 4NFLA 2ZUBA 3I9MA 2OC4A 3VTAA 3ZE8A 4ND4A 5KVCA 4ODIA 3SSNA 3W2EA 1PZNA 2ECKA 3GZTB 3HFSA 1IY0A 4K28A 4RL4A 3LVBA 4KRYA 4MS4B 4BJ5A 5IMBA 3PUIA 3TZCA 4P5DA 3RSZA 2G08A 4HLDA 1DE0A 2WJGA 3VSDA 5JH7B 1BO6A 1DAMA 2IS2A 4QXAA 3AFHA 1LUAA 3L06A 3ZW9A 2EFYA 2XUHA 1YA8A 1E1QA 2YW9A 3DP7A 1JIXA 2ZKIA 5IKPA 2HJWA 3OE4A 4LRWA 2WMDA 3NORA 1DKQA 3UJHA 1E3WB 4OHKA 4WZBE 2DY1A 5REQA 5EKDA 5KPDA 5E4JA 3I8SA 1D6NA 3QELB 4A36A 2XZPA 3IURA 4BECA 1RZRD 3B5IA 2P3OA 3BWDD 3RHTA 3K3PA 2WWWA 4UM7A 2BGKA 4EENA 4M0CA 2XDAA 3DP9A 3TECE 4IRXA 1O2DA 4LRQA 1D2NA 4MVXA 4PGFA 2ZYDA 1ZOIA 2YRWA 2ANBA 2PFKA 1AB6A 2ZK7A 2AC7A 3MILA 1MO6A 3QXXA 4JR0A 3U3RA 1KVUA 2C03A 2FMUA 2NLOA 2PBLA 2XCUA 4I1SA 1P1CA 4M1WA 1XEXB 3VHQA 1GP2A 2IKSA 4BMNA 5AUPB 4UVEA 2OZLA 1FSSA 3I5MA 4ZO4A 1GZ5A 2XMSA 5EP2A 3TXXA 4B79A 3LDFA 1KVQA 2NU8A 5I7SA 1RLGA 3G0GA 3IGFA 2OBYA 2VP6A 3LGSA 2OPBA 3KTOA 3W6UA 3BF8A 5CH8A 3GLRA 3AESA 3H8SA 1Z0AA 1SD1A 4I3HA 4Y9DA 1DG9A 4MVCA 3VX4A 4LKOA 3D9QX 3WWZA 1GCAA 1QPZA 2E5WA 2O3TA 1WD5A 3A3YA 3FFBA 4MI9A 4OX9Y 2O3RA 1E1DA 1M83A 2X9QA 1ZICA 2GMWA 3QKSB 1T5HX 3P9CA 2G09A 2IH2A 2W2OA 1B0PA 2SKCA 1SA0A 1TT5A 3STTA 4L50A 1MJGM 4JJZA 1XP8A 2B5WA 3EFHA 3K0EA 4O2LA 3ZV6A 2JFWA 2VZEA 3O5AA 2X0EA 8OHMA 4MVJA 1RQXA 2CMGA 4W5NA 3DR3A 4G9GA 4M1SA 3QHPA 2W6ID 1THGA 2GCGA 1NVVQ 2WHYA 1VLHA 3N7AA 3N2IA 1EZZA 2ZIEA 4G07A 3TUJC 2JFQA 1FRNA 2JLRA 3A0UA 3HDTA 4BZQA 3FPHA 1K3FA 3Q12A 1JMKC 2W0MA 4NNJA 4LX8A 5JC1A 4IH1A 1CQJA 1NW7A 4C4XA 1XKLA 3HJFA 4BBPA 3WLFA 1NRXA 2ODPA 2XW6A 2R8EA 3BK2A 3IERA 1RLIA 3LCRA 5E95A 4BNTA 4TZ0A 1I5RA 4R6XA 1RMQA 4Y67A 2QPTA 4FYVA 5G0VA 4AQ7A 1ZWZA 5ALKA 5C8YA 4KG7A 4Y2YA 1R3UA 2HPVA 1EESA 2I2CA 1KQ3A 4HP8A 1B2LA 1OE0A 2XBMA 4N5MA 4BE4A 3V1KA 1L4FA 4TM8A 4UTOA 2BMDA 3AFGA 4N9WA 1GPDG 1PUJA 3DWIA 2ES4A 2GK7A 2WWRA 3LT4A 2UAGA 2RE8A 3GVCA 2ODQA 5FI0B 5HJ5A 3OPNA 5IFKA 3NS7A 2P91A 4IOJA 4HAOA 3FYUC 1HE8B 3LRXA 5B7QA 1DIAA 4CM1A 5CUQA 4UM9B 1RC0A 1TTPB 1UKZA 3E6AA 2X0FA 2VQ6A 1D6MA 1QB8A 3IKJA 3O82A 5L6MB 4F8JA 2JPDA 2X0NA 1JPUA 3P19A 5ARCA 4QHTA 2CV1A 4H6WA 4HQNA 1GSIA 2IC5A 3UCEA 1JLRA 2OMEA 1XDWA 2GYVA 1E8MA 2R8RA 3FPFA 1LD3A 4MVJI 4Q05A 4IVNA 1R4MB 3QPWA 4L5AA 3W5VA 4PPFA 4TYYA 2YKGA 3GCXA 3IIEA 1CJTC 1G5RA 3ZVRA 4BGDA 2ZJ5A 3FJ1A 1T8YA 3NAQA 4J1SA 3O92A 1GPNA 1G8PA 2FWNA 2NO1A 2V7VA 2ZIZA 4P0TA 3TVDA 4PQEA 1T2EA 3RRFA 3ZHZA 1UBNA 2P8JA 3W9BA 1UFQA 1PTKA 1LSUA 3GUCA 3UMVA 4IZ6A 2R6JA 3H16A 4NEGA 1Y5LA 1X8KA 2Z8XA 4ACAA 1WBBA 4AXBA 5HCNA 4G65A 3CCBA 4RLFA 1TMKA 3THOA 2WWGA 2VQFB 4FZRA 3R40A 4R0VA 1IPHA 4V24A 2H00A 4TXLA 4I4IA 2ZIGA 1QDEA 3CCMF 1COMA 2CHSA 4M53A 2QMOA 2QRVA 4BMYA 1QLJA 5BSUA 2QI2A 3QYJA 4YAFA 2JLAA 1D4AA 2FSGA 3D4PA 3H9BA 1TEXA 3TZ6A 4BCDA 1G8JA 2OHVA 4WOKA 1DKUA 3WO1A 4YT4A 3THSA 3NALA 4P7GA 4L0MA 2MINA 3B3JA 2X2PA 2OLEA 1L7QA 2VTDA 1B2RA 2QN1A 4MAFA 3G0BA 3NFYA 4OAPA 4MPPA 3WWEA 1M1YE 3UM9A 1W4ZA 3A9TA 2FHPA 4P4TA 3RUCA 4URVR 2NO9A 5E3HA 4Z99A 5FWYB 3ROKA 5E1OA 4Z4GA 2R96A 2C2XA 1YJAA 4HV4A 4YRMA 4Q5IA 3FCEA 4B7UA 2B1GA 4EYQA 3QUAA 2WAAA 4BP1A 1UBMS 4R7ZA 3E5NA 4V03A 2IYZA 4D9BA 1GYQA 2H5LA 2PG3A 2Z9BA 3ZE1B 1F5NA 2I1QA 3PPXA 2NU9B 1GKUB 1OX4B 3UUFA 3VU8A 3BRCA 2ZR0A 3MIZA 1PLLA 1JTFA 3AM3A 3R7WB 4I4TF 3OQ1A 2FA9A 5HK8A 5BOSA 1EVLA 1RXVA 3L8YA 1FK8A 2IX9A 3FWPA 2VHVA 3A6JA 1FMTA 3WBKA 2QM7A 3GT4A 4MS4A 4P54A 2IEIA 1X1DA 1EB9A 1R1DA 4II7A 4W5JA 4WBSA 4KO2S 3U3OA 2QGZA 2P2LA 5ALWA 3EXAA 5JH7A 4HBGA 1AH2A 3L6EA 5ER6A 2A5DA 3EXG2 3VV3A 5DNCA 1C3EA 1XTSA 5C7OO 2UYGA 2HIMA 4N76A 5K03A 3CMAF 2GD1O 3COPA 3ENKA 3LIIA 4JL5A 2R6DA 3VO9A 1XQ9A 2HX0A 1BMTA 1E3WA 1VQ8F 1KGDA 2IXAA 2XF8A 3G88A 3PK0A 4HDAA 3VR5D 2VPQA 3QELA 4CMAA 6GPBA 1VFPA 4KR9A 1WNFA 3FTFA 3VPFA 4CIBA 3D8RA 4NI5A 5CG1A 1ZM2A 1E7YA 4YRFA 3EDCA 1YB5A 1Z36A 5AVTA 1FS6A 3EWAA 3G2OA 3JVUA 4F3YA 2AI2A 2XCRB 2JI7A 2QK4A 1CVIA 4PO9A 5L8VA 1ETUA 5FBHA 2RHLA 2P2ZA 4JLUA 5T8KA 4ZOEA 3W2TA 4EJSB 1T9ZA 2GD6A 3IDAA 3KFVA 3WFIA 1XEXA 2Y1CA 2ZITA 2X58A 2HGSA 3HL0A 1E3TA 1FS4A 5U4XA 4JI7B 5KZMB 4C0SA 1BKYA 2OK8A 3AETB 4GPTA 2UDPA 1NY6A 4IDOA 3QBJA 3T5GA 3UOWA 1IUKA 4KOAA 4X66B 1XZ8A 1B42A 3JYNA 3LZDA 4J03A 5H3HA 1B00A 2CHFA 4H7IA 1E0DA 3D8UA 4GIBA 4PANA 2JFHA 5K05A 2X5KO 1Z7BA 1W1WA 3D6MA 5CT5A 2IEDA 1FTGA 1CNEA 1WXIA 3BSWA 3MZ0A 4H17A 4NPHA 5JEDA 1E92A 4ZODA 3OQPA 3QYAA 1Q7YH 1P9OA 4MITA 3KIPA 3G5AA 4JHLA 3RVLA 1ECBA 1G98A 2Y3IA 3TMKA 4EH1A 2IHKA 2AMJA 5EZYB 2B5OA 4HGOA 3B6MA 1F2VA 3CCEF 1P17A 4MP3A 3U4DA 3QKSA 1X9HA 1B26A 3KHTA 1TQ6A 1EAMA 3PI6A 5BUCA 1DX9A 4Y0NA 3M34A 2HCRA 2FW0A 2RGXA 2FW7A 1Y7HA 3N75A 2V1XA 3DPIA 1VI5A 4FYJA 4OAQA 4EGQA 4PFJA 4R6WA 3F0EA 2QTGA 2VP2A 3PJEA 4Y9TA 1Q82H 3D54D 3DQPA 3ZGVA 5M7EA 3D5QA 2HIHA 1KERA 2P0AA 2FZVA 2DULA 3C8DA 4N6GA 1KQPA 2XB6A 1TAUA 3K8OE 4B6OA 4TN1A 4JV5B 3WJQA 3G6KA 2FJ0A 3LD9A 4WY5A 3CPEA 3WLHA 1T6YA 2HHCA 5CFOA 5LJIA 2BUCA 3GJZA 5AXBA 5HIMA 3PEYA 3MG9A 1NNLA 1V7PC 2F3UA 2YOFA 3CO5A 3ORYA 2UU9B 1H0RA 1PR2A 2NVWA 4TTSA 2VUUA 3NT4A 4D0GA 1YI0A 4OB7A 1M75A 4Q9JA 5LL6P 5DZSA 2R44A 5GAPK 1AQUA 3CTPA 4MICA 4E5MA 1NP3A 1GEEA 1QH8B 1U1GA 3W1EA 1CT9A 1JU9A 3IMPA 4CQMB 5F3WB 3RV4A 1MTOA 1QVAA 1U6KA 2OFXA 2WNHA 3O2QB 1KK3A 4R2WA 4A9AA 4AP9A 2FW8A 2Z9CA 4AYTA 2ADOA 2QI9C 4J6EA 3FFXA 2Z0MA 3RC9A 1M2NA 1YQWA 2XUZA 3DTTA 1DDOA 4FZJA 4KI7A 2JGDB 1R6VA 1GGEA 2OGUA 2GZHA 1II9A 3U1BA 3FKJA 5DNWA 1VPWA 1XZPA 2GUGA 4M49A 2BWJA 5F3DA 1PR9A 5KOJB 4KGVA 2PS9A 2WYVA 2OXFA 3PQ2A 1I9CA 4L28A 5JXWA 1Y0BA 4YONB 1N9GB 2ZRDA 3ZQ6A 4C88A 1KP3A 3IELA 5EG5A 4ZOLF 1G7SA 1I10A 4UQPA 1XHEA 2XB9A 4AULA 1CUVA 4MQ4A 4RY2A 4C43A 1R4MA 3OCXA 4HKTA 4XGQA 4ARUA 4HC4A 4ER7A 3SJUA 1CW2B 1SHUX 2HV8A 3KKNA 2AIFA 1GSAA 1PX2A 5ED4A 1PTJC 2OFFA 5KYNA 1L4UA 3Q87B 3QVLA 4QPPA 1ZL2A 3DOCA 1GQRA 4BNFA 4UC0A 3C85A 5AUOB 4CEHB 1H6BA 3A11A 4D25A 2FWAA 2WUWE 3TI9A 1EEXB 3GLFE 4BCCA 1HE3A 1O58A 1VCHA 1DKMA 1EQUA 5JG7A 3ZUPA 3BFPA 4XLZA 1IAQA 3U4MA 2QX6A 3GU3A 1MU0A 2ZIFA 4KACA 4AAYA 4D80A 1O0BA 3M70A 1GUYA 2O4UX 2OQ2A 4JX8A 4PG7A 2PUBA 3H75A 1JG1A 4DJTA 3ZJTA 2V7GA 2FFHA 3K09A 4KSBA 4ZK2A 1XD8A 4NHEA 1FTWA 1CP3A 3L7KA 4PYKA 2PZEA 5E9WA 2NZ8A 3P2KA 4HH3C 4BS9A 1QZ3A 4RJJA 3O4RA 1OLUB 2VDWB 1ZR4A 1JT2A 4FN5A 4BO4A 5EIBC 3PFKA 5EKSA 4B3TB 3BD6A 1NURA 3F1KA 1FXUA 1K6JA 1UJ2A 1W93A 2W7TA 3PTLA 5ALIA 3VVLA 4CCYB 4DVGA 5A02A 5CBPB 3W7BA 5I9LA 2CZGA 4PPNA 1ISGA 1XDSA 4UHBA 3SM3A 3ZI7A 1EWQA 4CM9D 1YIDA 4EFLA 3AKDA 3RBZA 4TVBA 5HUJA 1H65A 4UZEA 2ZKLA 5FWYA 1G8FA 2BHSA 4AQDA 3O4JA 4IXMA 5DEOA 3HXLA 1XTJA 5DNAA 1AT1A 3CCRF 5IULC 1Z5NA 1Y1QA 2VDVE 4KDFA 4RVUA 1GUZA 3SJZA 2LE0A 1YB6A 5BXYA 4BKPA 4D3FA 1J8FA 3PTZA 4X90A 2O1WA 4INAA 4GSLA 4CQLB 2NU9A 4RTNA 1U5BB 2KLBA 5ENZA 1DIRA 5F33A 3R7WA 1FDIA 3C5EA 3OESA 2GZ3A 1SBNE 1CY1A 2FKNA 1QIFA 2GESA 3EUWA 5A5FA 2H92A 1NC3A 3TEFA 1SUCA 1W85B 1DC4A 3ZGZA 4LBWA 4OK6A 4WLOA 1D2RA 2QJWA 4XD7D 2W4QA 3E5HA 3I2YX 4XFJA 4IIEA 3R7AA 1N34B 1QB7A 4JBWA 2EQAA 2FF5A 5EHQA 1OB5A 4TTRA 5ALFA 5HRUA 1ODLA 5K0LA 1ZR2A 1K2VN 4W82A 3O75A 3WSTA 2NPFA 2YN0A 1WSWA 1DADA 1TTQB 4PSUA 1DOZA 3C74A 4Z49A 2YJTD 5ALHA 3KHUA 4J0FA 2NUTB 2F7SA 3L0YA 4AKEA 5B8FA 4EF6A 4F6CA 2ZAOA 4IDGA 3DW3X 3SSOA 1BEEA 1CVLA 3E15A 1CIVA 3KSRA 3JQFA 4FEYA 4FWIB 1PLJA 1KZ6A 1PV1A 3T7EA 1BWQA 5EWJB 3F2VA 4YP1A 4EJSA 4B3JA 5H3CA 1XB2A 4KNYA 5BXQC 3TVYA 3L77A 3KEOA 4LZPA 2R8BA 4R1LA 4ZPXA 3TRFA 4YJ2B 1YXMA 4WERA 4AUKA 1XLTC 2WKSA 3C5CA 2I54A 2ID8A 1QYDA 3K9WA 1RLTA 2IHYA 1I6KA 2JB9A 3H13A 5T3UA 3G0IA 3HXKA 3M6MD 2UYHA 4JDPA 4GGPA 4ITVA 3WGYA 4F9GA 1H2RS 3BPSA 1E5DA 2CLFB 5DX0A 1WMAA 1AQ6A 4RHCA 3D1JA 4RIIA 1OZAA 1JHMA 5CVCA 2W2NA 3NV9A 5FOTA 1F6BA 1NM5C 1M6EX 1NOKA 5AHWA 4C4SA 4XUCA 2B4QA 2JHAA 1O95C 4OXNA 5ELLA 4O2BF 5EZYA 4Q39A 4WNCA 3M49A 1SQ6A 2XGGA 4ZCSA 1H5QA 1NOIA 1QO9A 2PX2A 4MEAA 1ZI9A 1L4LA 1AKYA 2NADA 4V38A 3TMYA 3UAWA 3L07A 4NBLA 3K9GA 4AN1A 2NO0A 1ACJA 2Z3WA 3MJCA 4JBYA 2A9QA 3D3JA 4OFBA 5K0NA 5A3JA 2OV4A 3SZGA 2GXUA 2O0KA 3O73A 3S2YA 5FJIA 2OE2A 4RE5A 2CSUA 2YY6A 2HPAA 1WQ3A 3AIKA 4BW0B 4GE0A 1VLLA 2NXEA 4ZQCB 3QVTA 2WUVA 5ALQA 3SWWA 4FTWA 1ABBA 1Q50A 1IPFA 4EQZA 2OTLF 2I2BA 5H9VA 3I2KA 5DCVA 3C3MA 1KJ8A 2V7XA 4X1YB 4M98A 3NXSA 5BV0A 4AUNA 4BNMA 3IPLA 3NETA 1Q91A 3SZUA 2ZI4A 3V7FA 4JCCA 4WK0B 3HXPA 1AKQA 1T3ZA 2Y0PA 4CKBB 1FU4A 1YIAA 3B8EA 3OHSX 1H2ZA 3MLBA 4FN4A 3ANMA 3DF9A 4R2MA 5BV2P 1MZPA 1N3BA 3TINA 1KQSF 3H19A 4N1AA 1IBSA 5ESWA 2Q6IA 5BUSA 1EFVA 2RH5A 3DYBA 3EVFA 1LEHA 4QRDA 5JEEA 5ALZA 3OOEA 2E4WA 1JF8A 1ORTA 1JYSA 1ST3A 1GTVA 2OZKA 3AUYA 2YUIA 5EJIA 5KDLA 5TT1A 2V9PA 1W34A 1QH8A 4XASA 4JJEA 4CQMA 2Q6TA 1JS1X 2ZRAA 3L5OA 3OETA 3P9IA 4G5YA 2XSZA 4FSHA 5IUKC 3KSAC 3K2XA 3DJYA 1E1MA 1I14A 5EFOA 3DUFB 1X1AA 4BX2A 1U6IA 1VYTA 2C1EA 1C0EA 5IARA 4LZLA 1W0JD 4MV9A 3S44A 4IGEA 5KWVA 1W36D 2JGDA 1NVWQ 1I2CA 1UPAA 2O52A 4V0KA 5TS3A 3H3XA 1QO7A 3D2LA 2CD7A 3DZHA 3M1LA 4LV5B 1NXSA 2HU5A 1UFVA 2RH4A 3PP8A 4PNHA 5AD1A 5KOJA 4NJOA 2D1TA 2GJ8A 4YCAA 4ZI7F 3N5KA 3Q40A 4KUHA 5AW3A 1A2OA 2AXEA 2HJGA 2ZW9A 1LDYA 1XMSA 2HX1A 3K9HA 1VBFA 2QN7A 3QVKA 2HN9A 3AIMA 2GK6A 3FG9A 3G49A 5IEJA 5JO0A 5FLXA 3KOWA 1CIPA 3ZTTA 2YQ5A 4D42A 3K0BA 4RKFA 2YYAA 1H2EA 1BGXT 1OC2A 4S1OA 2E48A 1ZD3A 4B3DA 3PUJA 2ZBFA 5JVDB 2RJ3A 4MJ7A 1P45A 1BHQ1 4N5IX 3TIFA 1PNTA 1JL3A 1PZMA 5HOEA 2EL9A 2IG8A 1MNAA 1SC4A 4TMZA 2WJWA 1PNQA 4KPFC 4D46A 3C3PA 5FX2A 5K4GA 5KINB 1T1SA 2GLXA 3HFJA 2HHHB 3ANNA 4MCHA 4B3BA 4OLAA 4ZV7A 3LG2A 4IV5A 1VHTA 1TZKA 2R6CA 1IHXA 3NANA 3GVIA 2FPMA 3QKRB 5BR4A 1OI3A 4Y6LA 4A8HA 1DX4A 3T3NA 3PRKE 4DWJA 1D1SA 1YGYA 3F49S 3P0RA 1W6UA 4QJBA 4PZ9A 1PU2A 4YO7A 2C8LA 3O3MB 1DTSA 2GKSA 1PR3A 1BROA 2O2XA 2ZIUB 4TRRA 4ZCTA 2LCAA 3P5SA 1L3CA 1JR2A 3QBDA 3GHHA 4TPKA 4X60A 3UOAB 4R1QA 3W9YA 4V39A 1ZNYA 5ITSA 1OLUA 1P9WA 2VDWA 3E3MA 1V8DA 1VSBA 3BXPA 2YV3A 4FGSA 3F4BA 4CCYA 4CHGA 4ZQEA 2PZLA 1YFZA 5CBPA 2DR3A 3NJ4A 3HJAA 1VTKA 4GOND 3FNEA 1IBRA 2NXWA 1FS5A 1GHTA 2R62A 2Z2ZA 1N7HA 4E4RA 1SKYB 1X1SA 3H17A 2AFIE 2GZAA 1U1CA 3RVQA 3QU7A 2FPPB 5KCMA 1NW9B 1WKVA 3Q1LA 2NVUB 3JV7A 4MIYA 4Z51A 3AHJA 4BKQA 3GUZA 3TD5A 2RB9A 4BHTA 1T9BA 2B8NA 3D02A 2GTPA 3IMGA 4ND5A 5GY7A 4PTYA 4CQLA 4CBVA 1U5BA 1P29A 4JI0B 4F71A 2BF4A 2DPLA 3H2JA 4KDCA 1QFXA 4BVKA 4TL7A 4J29A 4H31A 3P2MA 2WABA 4CMIA 3D4NA 5FQOA 2DE0X 4ZT7A 3OE5A 2ZUEA 5DV9A 3RS7A 5FL7D 4D4KA 4DCUA 1JQLB 3PFWO 4RTOA 3JS5A 4MJ3A 1Y4AE 4EHNA 1W85A 1KFBB 3GEEA 3QA3E 4RF4A 5BV1A 2A5LA 4M3NA 3LDUA 1UCFA 4OIMA 5DB4A 4YCCA 1TJPB 5GGXA 3HKCA 3BIJA 3QVJA 4URWR 5AI4A 2JASA 1FFGA 5EKXA 5HCUA 2JLCA 4RH1A 5TQ0B 3BD7A 1PQ4A 1JQDA 3F90A 2OESA 1SZCA 2QAIA 4ARBA 4B9EA 2UZIR 5KX5F 4I6GA 2PV7A 2OQVA 3OE7D 3OWXA 3NHSA 4GWGA 5K2MA 2RIPA 4WCVA 1L7OA 3B3GA 4S0ZA 1XKXA 8LDHA 4Y2RA 2NUTA 3I52A 1E66A 1E79A 3FHCB 3I76A 4M36A 2W90A 4PWZA 5CCBA 3GLIB 3ZV5A 1TCBA 1FFHA 4E46A 2EHJA 1STOA 4EKEA 1JQKA 4DABA 1O7JA 3KZ1E 3Q9SA 3RK1A 4WZ6A 5EWJA 3LS2A 1JDTA 4YLGA 5A0FA 1I7PA 5CJJA 4JKYA 1FYWA 3L6UA 2QIPA 1O6BA 2QSUA 2XDWA 4PG4A 1WHTA 4YJ2A 4NS1A 3TTXA 3UAZA 4BLRA 5LQJA 4EUHA 1E96A 5C4IA 1FP6A 4IS2A 3KALA 1HTWA 1HEIA 2A1IA 1FU8A 1ZA1A 3OX2A 3QUBA 3ZIDA 1T10A 4MRPA 4X71A 1PZXA 2V3CC 1ZRNA 1BYUA 2A59A 1W5AA 1X13A 3MJDA 1CUGA 2M32A 2EFJA 3O8QB 4MMZB 2ZETA 3K8YA 4MV6A 1U0BB 1CR6A 3HA3A 1Z6YA 3MRXA 3ELWA 3TGWA 1KH1A 4ZZ3A 4DR7B 3AVUA 2AA3A 2A3NA 2EU8A 4QOFA 3KHSA 5THQA 2I7XA 3J81A 1RHUA 3BZBA 3EF3A 4HXEB 2IBTA 2CFRA 1JKXA 4DV0B 2H4XA 2R2GA 1Q83A 1U81A 2IP1A 3IH5A 4N8EA 3TQFA 3GI1A 2H4FA 4HY3A 5BO5A 1N2XA 2W2MA 2FCAA 2XY4A 1MOPA 5H02A 3SF8B 3PPYA 1ZU4A 3GRRA 3WKDA 4IKEA 3L1JA 1USUA 1GKYA 2NZ2A 4HS9A 4WTOA 4AMBA 2BM1A 4ZT5A 3T9DA 1W29A 1HXHA 3OZTA 4RX1A 2H2GA 5P8WA 1HPLA 3WDLA 3P0ZA 3W7AA 1Y89A 1KNQA 2PGNA 4H3SA 2G5CA 4TS1A 1A2BA 1WPQA 1Y63A 1MR3F 4X1YA 1P2VA 2H18A 3CKMA 2H2DA 2PL9A 4OBWA 4OKNA 1SKQA 3OZCA 4RGQA 3SLGA 5KYYB 1ISFA 1Y3AA 3NWJA 4MHSA 1X25A 3Q7PA 4DJ5X 1B14A 4CKBA 3PKIA 4BPBA 1YITF 3I9LA 1J0DA 3FGOA 3HLKA 3LI2A 2I4LA 1TADA 2FZEA 2XDQB 3ESCA 1C9KA 4XKJA 1I0ZA 4BZXA 2RK4A 3QPCA 5EAIA 2XWQA 3ET4A 3NWOA 5ECGC 2QZPA 4DQDA 4F3RA 1G59A 4GXRA 4PSAA 3OA2A 1JVSA 2OD9A 3Q4GA 3I32A 3WGQA 3Q15C 5F52A 1PR5A 1MF7A 4H15A 4BMSA 1DWQA 4AJPA 3DUFA 1IQUA 1QZXA 3K0TA 3JQCA 3AR4A 5CM2Z 3ROZA 1C41A 4I6JA 2YWDA 5CT6A 3ZYCA 4F72A 4EO7A 3MFQA 2R6R1 6Q21A 1AA6A 1YKFA 3VAZA 1EFRA 4YROA 5GQSA 2XQFA 1E2IA 1C9MA 1WZ2A 2VPTA 1HORA 2YJ4A 3KRTA 3A4LA 3URMA 1AS0A 2QUJA 1FMJA 2B36A 4IUDS 4NZPA 4UDYX 3I6QA 1E7SA 1JFRA 4CQNA 2G9IA 2NZWA 1I5OA 1P4HA 2HMTA 4I5EA 4PQGA 3CLVA 4HQ6A 4K6HA 2BGJA 2W6JD 4WAUA 2XVZA 2HK9A 5A7HA 1YB1A 2EL7A 4GQAA 4CTJA 3ETLA 3W3ZB 4L4XA 3VKFA 4JBGA 2A5JA 4DCCA 4F9TA 4F3TA 3RYFB 5TQ2B 1NF9A 4PM4A 4MV5A 1R66A 3N8DA 1ZO8A 3VU3A 3VVMA 4TKZA 2A30A 4GAEA 4A4DA 4CDNA 3K12A 2IS1A 4JWKA 1ORVA 1KGSA 3LHFA 2BEKA 5BYAA 3H3FA 4LMBA 5MN5A 1L8QA 1PLKA 4V3CA 3NH9A 5K3AA 8GPBA 3GRYA 3MNFA 3F2IA 1Y1SA 2W4MA 3GIWA 3JY6A 1X0XA 2IWHA 5KI6A 3ANYB 2F64A 5AW0A 1FYEA 1F9EA 3U7RA 1XCMA 2H07A 1UWVA 2OORC 4P86A 4YT5A 2TMKA 3ZLTA 2FRXA 4CCSA 1P7PA 2WKRA 3CPJB 4K9NA 1CYDA 4ZALA 1QTQA 3KKOA 4LXTA 3ZS9A 1XUOA 4WACA 1P2FA 2PLRA 1K92A 3ZY2A 5F7XA 3FF4A 2X1HA 4QXRA 4UBOA 2HK6A 4JQYA 2P9TA 1IXZA 4QBIA 5CX1B 2OO5A 3JYQA 3O9ZA 1G4UR 3ZY4A 3E03A 5FP0A 5HY4A 4Z4EA 3B3FA 5G1PA 5IAKA 3FSJX 3QWBA 1G5TA 4PXSA 1AX9A 2JA1A 2VQ3A 1DAGA 1Q0UA 2OGWA 2LUOA 3GGGA 3C3JA 1FQJA 2IYTA 1PJ8A 2NU7B 2VZ8A 1GTZA 2D1YA 3V1NA 1Z7GA 1M6YA 2AIRA 1NMEA 1KNJA 4NG5A 1E98A 4BNWA 2IP4A 4YUXA 2YY5A 2HA3A 4JROA 1LC3A 4YREA 1MLDA 2FPPA 1LLDA 2PFSA 2NVUA 4MZDA 2M6SA 5HTOA 4U5XA 2BR5A 1E4YA 4OHCA 4Q0MA 3DV9A 4MA4A 3K5IA 3H6HA 5AOAA 5F3RA 3ZR4B 1LX6A 4QUJA 3JAMA 3K0FB 5AKEA 5EKTA 3N8NA 1F4VA 2NP6A 2YJ3A 3HAXD 4HQ0A 3GFTA 2Y4OA 1R6BX 1NYLA 4U2CA 3T9AA 1ZI8A 3PPIA 3L1HA 4XQ0A 2WVAA 2CE2X 2D06A 2O2JA 3M6FA 3UWOA 4OG2A 4FBLA 4QU5A 2GM5A 4MUFA 3WHKA 3LYHA 1EGAA 2W6QA 3ABZA 4YXFA 2BGIA 4ZPJA 5DK6A 2RH9B 3T1NA 2NG1A 4WN9B 4DDVA 2Q3EA 4F5EA 3H9GA 2KWIA 4DA4A 2HXGA 3FUXA 1H05A 1FU7A 1CRLA 2YTZA 4QOJA 5GINC 4C89A 2J41A 2CVQA 4IGIA 2Q5FA 3HHEA 4ZCQA 5CA0F 5KREA 2HJSA 1C30B 3M2PA 1MH1A 3VR2A 5FO0A 2IXFA 1UQTA 4FS8A 3NEAA 2XZLA 3TFQA 1L6RA 1BVUA 5EO3A 4EWLA 5G4LA 4UZSA 3S1AB 2IY8A 3G68A 4F86A 5A06A 5BMOA 3GLIA 3ZJUA 5AHOA 2G9NA 5CNMA 4LY6A 4WVFA 3OP4A 5K6AA 2YASA 2YJ5A 2A78A 5DRYA 3G82C 4QUDA 1Y5RA 3EAGA 3N1UA 2BW0A 1IB0A 4MGHA 5I01A 1HT1E 3NQ41 1O94C 4O2AB 3EVCA 1IB6A 3DL2A 1RYHA 5JBIA 2HRBA 4HSEA 1T1RA 3TQIA 1ORWA 3PHLA 5JDIC 3WGIA 3MJEA 2ZYWX 4M60A 3F7OA 3M4NA 3ZK7A 1WB5A 4L08A 421PA 3D8BA 1A9XB 3HY3A 3NH6A 2QBYB 1EHCA 2P9FA 2W43A 3TZQA 1CUWA 3KT0A 3GLUA 4BT3A 1HQKA 4B82A 3R20A 4HWTA 2ZQ5A 3E3LA 4R3WA 4UHHA 721PA 3CRRA 2O5EA 4B4DA 3OZIA 2V6FA 2JJ8A 2IHUA 3WA7A 1YT5A 1GKIA 4OXYA 4BVRA 3HJHA 1H2HA 1UP7A 1QGED 3JD1A 4MRSA 5C51B 3E7FA 4NDAA 3CR8A 4Q1FA 1WCWA 3QWHA 5SYMA 4AMVA 4HG2A 3L7DA 1IV3A 4Y6SA 2GLTA 4ZEOA 4IHJB 3ZWOA 3P9YA 2IQ5A 1X8LA 4J49A 3VZQA 1Q1AA 4XD2A 4IJQA 3UJAA 4RMNA 4BGEA 3IEXA 2QL5A 1YTLA 2QL9A 3VZRA 3VR3A 5JDCA 3NB0A 3T38A 2J30A 5KJEA 2GVDC 4EB6A 1NIPA 2YWRA 3RAGA 1U28A 1LQTA 1W46A 3AK4A 4KWCA 5BSMA 4IKOA 4WUTA 5KYYA 1GTSA 5TY0A 3USES 4KXXA 8ABPA 1DBQA 3SM9A 2X3UA 3ZE2B 1SQSA 1C7RA 3KJJA 2FV8A 3OLWA 3ZCXA 3WK4A 4CIDA 1CRWG 1Q7GA 1FJXA 2BMFA 3KQLA 2XDQA 3MJRA 2XTJA 3HGTA 1D07A 3GFOA 4O3FA 1U7DA 1QGUB 2VDRB 2D0DA 4RPLA 1MAUA 3WZMA 4TV8A 1N0HA 2GXQA 4ZO9A 4DCPA 1E2MA 3VYSC 4BO0A 4H7EA 4Y7DA 3NIGB 4OO3A 1Z5ZA 3LVFO 3C3CA 4INOA 5FUYA 1O6ZA 1UMCA 2NSYA 1ZOPA 1CQPA 2QF7A 1QP0A 4X64B 5H1YA 1H2BA 3K1AB 4FILA 4JB0A 1CZOA 1QONA 3DOHA 4FW8A 3RRMA 1U3TA 3HYSA 3NHLA 4BBAA 4L22A 1NZJA 3G9UA 4OKSA 5MFZA 2AI3A 3U3XA 2HI0A 2WAXA 1UAGA 3UKOA 1ISJA 3OIFA 4OK5A 1DNPA 1NUHA 4BQEA 2NUBA 4V1CA 2Q27A 5KVSA 2WE7A 2PYDA 3SYNA 1Z83A 2M6RA 1HLFA 1T3GA 2TMYA 3E81A 5E9JA 5J5CA 4D56A 2IE8A 1NTRA 2R25B 3R5SA 1ULAA 4JT4A 4YHBA 1MP0A 1NTOA 2CL0X 3EASA 3KJNA 1K6MA 2J0EA 3LT1A 4YRCA 5IW8A 3RODA 2FMIA 2NMVA 2WPDA 2R65A 2HS0A 3RT9A 5KQGA 3RYFA 5DIFA 1ZM4A 1ONOA 3CVOA 3QFRA 5HGJA 5TQ2A 2VHZA 3SX4A 3ZX4A 4A6DA 4ARSA 4BVGA 1R0ZA 3EA5A 3IB3A 3WRYC 2H9YA 5EIAA 1XU7A 1KBOA 3NK7A 2K1SA 3KQMA 4BLVA 4BX3A 5G1NA 3T5AA 5GINE 1DRJA 1Y3HA 5KTPA 1UKCA 1W25A 2DWUA 2GWRA 1DDGA 2H17A 2VTBB 1YS1X 1RR6A 2UXCB 2HLDA 1U31A 1U8XX 4QPNA 5EVCA 2D54A 1KARA 4QWWA 1LPNA 4S0XA 5B6PA 3BILA 3LNCA 1GOTA 1UXGA 3PQ4A 4RD4A 5DKFA 4NQRA 1W76A 4O5AA 4ZICA 3MAGA 3U39A 2XYGA 4B81A 2FPSA 3TX6A 2KB0A 2E0IA 5CX1A 1WAMA 4Q1VA 1VL2A 4X7BA 2ZDGA 5IPFA 4XM0A 1ESZA 3PUHA 1SXJE 5I9MA 1FW6A 3ZBTA 4D8UA 1T9GS 3G02A 3HUUA 2AOUB 3E48A 1Q84A 2RSLA 5AFSA 3RADC 1IHOA 4EPWA 4YMTA 3G9QA 6ABPA 2YQZA 2YWGA 1U11A 2YXDA 4HX5A 1IZYA 5HZHA 4CMEC 3GLHE 4Z1OA 2NU7A 3B1KA 5SY9A 4MQEA 1CS0A 2JFYA 4HNGA 4MGIR 5I9TA 5CDTA 3ERNA 1QIDA 4DG9A 4Q24A 4JMPA 4Q7JB 1KMIY 3DS8A 3QKIA 4QYSA 1DBIA 4LYEA 1KMCA 1EFKA 3FZQA 1A9RA 3EIHA 2H9AA 5F5NA 4WXMA 4UTXA 5GM1A 3PXGA 2GLZA 1KI6A 3O9MA 4LJ4A 1C80A 3ZQKA 3CMEF 3HKDB 3JWHA 1Z4OA 3RWMB 2W58A 1WB4A 1XJ5A 2R8XA 4C7BA 2FZ5A 4KPGA 2IIQA 3QENA 5EHIA 5JANA 1ETHA 2WYOA 3GPIA 2XMDA 1R8XA 3L7BA 3NONA 4U02A 1VE3A 5D5HA 1OAKA 3S2EA 2HF7A 3TM4A 3U31A 1EVEA 2DHEA 3HDGA 4G0YA 4G2NA 3AONB 5KWEA 4MV3A 3CXCF 1V26A 1F8FA 1UMDB 2JLQA 4DMLA 5KOYA 2HVYD 2R4UA 4Q19A 2CHQA 3JD0A 4HGPA 3CH6A 2HQSC 4L4ZA 4C8IA 4QPJC 3Q85A 1DI0A 1TKCA 4EUSA 4MYDA 4RTLA 3KDPA 4L0DA 3BWBA 1XN1A 3MIIA 2D2FA 3UMSA 1C30A 3F5QA 5ESRA 1DO8A 3NHMA 3C8UA 1SOUA 5B55A 4G1FA 1TW2A 1LRJA 2RG7A 3D2CA 2WJZB 2GILA 2X3FA 3I37X 4EYGA 4Y6PA 2XUKA 3S1AA 4UXIA 1UINA 4H7PA 2C3YA 4I9NA 2YRFA 3FSGA 5KTOA 2YQ4A 4G85A 2A9KA 2OCLA 2YW2A 4PX3A 3SKVA 3G5LA 2H1LA 4B17A 3U9SA 3P9KA 1HQCA 1CUDA 1A04A 4J0QA 1G5QA 3ASUA 4YP5A 1Q81H 2JAPA 4N40A 5JZBA 2O19A 1LDMA 1JH8A 1U9CA 1U9ZA 1C4OA 5BMVF 1JQJC 3NU1A 1ZWKA 3Q7SA 4CL2A 3R5HA 2XDYA 3GUVA 2F9MA 1W30A 5DLPA 2EIXA 2BCGY 1Q22A 2X15A 3V9AA 4R8RA 3ZIAD 1A9XA 4Z4CA 1VGQA 3L7QA 2PL1A 1Y9ZA 3ESZA 4IDCA 4PV7A 2B4YA 5FR2A 3UQYS 4MW6A 1ZGAA 4N0EA 4XRGA 4NBKA 1CTQA 1XTRA 2JIDA 4U6SA 2KBFA 3WGUA 4ER0A 4BWGA 3EXHB 2AG6A 3D3WB 3DL4A 4TTIA 4HWPA 2KJQA 1ZMXA 4DCVA 4XWKA 3HZRA 3IE2A 4WWHA 5KNDH 4YCNA 1LS1A 4OMFG 4LNUB 2AKAB 3KQVA 3OZRA 5E4TA 3BBPA 4FW9A 3ZWVA 2A5GA 1SG0A 3CCJF 2CZQA 1INLA 4M83A 2RGRA 1JPJA 4IHJA 2ZBRA 2E1PA 3K9BA 3TRHA 1PXWA 5BQ3A 1XU9A 5FTNA 3GAMA 3ZEAA 4YQEA 4OJYA 1ZK2A 4XTRA 3ENVA 3VR4H 1AUXA 3T7SA 3LUDA 1IV1A 3L0IB 5B58T 5FTLA 3FAKA 3QJYA 1YA4A 1ULZA 3NBZC 1XMPA 1U8YA 2A1TS 4LE2A 1TIBA 3G0HA 1B3BA 3ZY3A 1UJ4A 3TEJA 4KFSA 3WYBA 2ODWA 1MQSA 1HF3A 1R4NB 5FTKA 4Q3NA 1DXYA 3INYA 3GYQA 1QHFA 5TE9A 1UK9A 3V3TA 5DIZA 2C42A 4TMKA 3IQZA 1G63A 1O9HA 1QGUA 3CV3A 1YQXA 4QXPA 1OMOA 3DBOB 5LB4A 4LDRA 2I55A 2P9QA 4WN3A 2AOWA 1JHZA 3EW7A 4YV1A 1VZ3A 3VC1A 4XVHA 4AY2A 16PKA 3NIWA 1SXPA 3OQIB 5K8VA 2PAAA 2XIQA 1UXKA 3K1AA 4IQ4A 2W8BC 2ZLBA 4S1WA 4D3ZA 5LZ4A 3DOOA 1ODIA 3EB9A 4L4RA 5CLQA 3M33A 3GQVA 1MFZA 3H18A 1JALA 4JKIA 4TWJA 4H1HA 5FBKA 3ZZMA 1E5VA 4TLDA 4B71A 3J7AR 5F1OA 1T1IA 2R2AA 1KE1A 3TKLA 1A1SA 3DVAA 4C4RA 4XOIA 4ZEWA 4F04A 1PK8A 1BS1A 3WPWA 1H0KA 5L7TA 3CURA 2JHGA 2QRHA 1Q1GA 2PLAA 3MLEA 3PQCA 5EIFA 4U2FA 3GYGA 4WBNB 1RXSA 2BMVA 3IT0A 4M6WA 4Q9LA 5TC4A 1C7EA 3RAPR 4PC2A 4KWIA 4E21A 5B58C 2EFHB 5C3MA 5KDOA 4IF4A 3TZBA 1MX1A 2QV0A 2J3HA 3WGMA 1ORRA 3NGLA 3U9LA 2EF1A 3AV0B 2XVAA 2GGSA 3GJ7A 1EDOA 2GRUA 1O6CA 1B43A 4EG6A 5D7NA 4BP8A 2D2VA 1Q20A 3ACBA 3QNMA 4YQFA 2DPHA 3BHNA 3WGTA 4FX5A 3L4JA 2OAEA 4WLVA 1YSCA 2VTBA 2QMUA 3BGOS 2K5UA 3EGIA 4NENB 1GG9A 2CW5A 3ZZ1A 4B1FA 1E3SA 3I55F 1J7KA 2XCQA 3KJGA 4KX3A 1XL1A 1X14A 3H1EA 2D59A 2VQSA 4LQDA 5DWQA 4KIGA 1VLMA 3IUMA 1E2QA 3F8SA 4XVRA 3OIGA 5CG2A 1NAHA 1SKMA 2NYAA 1QVVA 1BG6A 3ECSA 4INJA 3V1UA 1ORIA 4D92A 3KAKA 3EVAA 4R54A 4ZVQA 3RLIA 3ZWYA 4IBOA 4D41A 2O7NA 3ICOA 3WGJA 2Y76A 2C7VA 1TW3A 4PLTA 1EWRA 2AOUA 4UHFA 1ECCA 3HXQA 2G25A 3G13A 3OKAA 5AKHA 3CX7A 1QGOA 4AJ2A 4E12A 2H85A 1U7UA 3KZNA 1FRFS 1LWOA 3MT0A 2O2SA 3OFSA 2H3HA 2J85A 4F56A 3K70D 1PZFA