5MN6A

S. aureus ftsz 12-316 f138a gdp closed form (3fcm)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
296
Chain Sequence
b'TLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSAEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLILDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title A Polymerization-Associated Structural Switch in FtsZ That Enables Treadmilling of Model Filaments.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 94
structure length 296
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5mn6A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5mn6A01
2VAWA 5JQGB 2Q1YA 3JAWA 5LP6B 5LYJA 2BTQA 4ZOLB 3HKCB 4EB6A 3RYHA 2R6R1 5CA0B 3HKDA 5MN6A 5LXTB 3RB8A 5ITZB 4YJ2B 4IHJA 1OFUA 5LP6C 3RYFA 4O2BA 4DXDA 4EI9A 3RYCA 5EZYB 4LNUA 5BMVB 1RQ2A 3HKBA 4FFBB 3ZBQA 4E6EA 5C8YB 2GVIA 5J2TB 3N2KB 4I55B 2VAPA 5GONB 3N2GA 5JVDB 4I4TB 5LOVB 5EYPA 1W581 3HKEA 4ZHQB 4U3JB 1FSZA 4YJ3A 3VO8A 3JATB 3M89A 3ZBPA 3WGMA 4X1IB 3JAWB 5LYJB 4DRXA 2VXYA 1TVKB 4X20A 3E22B 3RYHB 5J2UA 1SA0A 3HKDB 1TUBB 2RHHA 4IHJB 5IYZA 5IJ0B 4O2BB 1W59A 4IIJA 1FFXA 1Z5WA 4LNUB 1W5FA 2RHOA 4O4IA 3HKBB 4O4LA 3RYIA 4I50A 3UT5B 5IJ9A 5KX5A 2RHLA 5LA6A 4F6RA 3JALB 5JH7A 3ZIDA 4O4HA 4TV9A 4B45A 3N2GB 4TUYA 3CB2A 4M8IA 4WBNB 4U39A 3HKEB 1W5AA 5CB4A 4EI8A 3C8LA 4ZI7A 5CA1A 4HNAB 2XKBA 4DRXB 4X1YA 5EIBC 4O2AA 3WGJA 2BTQB 1W5EA 5JQGA 1JFFA 2Q1XA 5LP6A 3R4VA 4EB6B 5JCOC 4ZOLA 1FFXB 5KMGA 4O4IB 5LXTA 4O4JA 2RHJA 3RYFB 5ITZA 3RYCB 5MN5A 2XKAA 5JH7B 3VO9A 1RQ7A 4O4HB 4B46A 4TV9B 3WGKA 3JAKA 4TUYB 3VPAA 5M7EA 4X1KA 4ZI7B 3JASA 5CA1B 2VAMA 3N2KA 5J2TA 5EYPB 4I55A 5JVDA 4TV8A 5FNVA 4YJ3B 5LOVA 3WGLA 4KWEA 4U3JA 4O2AB 3JARA 1JFFB 4X20B 1TVKA 5J2UB 3VOBA 3E22A 1SA0B 1RLUA 5KMGB 3HKCA 3VOAA 5IYZB 4O4JB 1TUBA 2BTOA 4XCQA 4IIJB 5IJ0A 5IJ9B 5CA0A 4O4LB 3RYIB 4I50B 1Z5VA 3UT5A 5KX5B 4YJ2A 3JAKB 5LA6B 4F6RB 3WGNA 4X1KB 5EZYA 5BMVA 3JALA 3JASB 4FFBA 3V3TA 4EI7A 4WBNA 4TV8B 5CB4B 5FNVB 5MN4A 3M8KA 5C8YA 2R751 5GONA 4HNAA 4I4TA 5JCOA 3JARB 4ZHQA 1W5BA 5EIBD 4X1YB 3JATA 4X1IA
chains in the Genus database with same CATH superfamily
1UM9A 4BBAA 1YNOA 1K6JA 3P4XA 3RSLA 3RJMA 2CNLA 1G8FA 3N87A 2X1LA 3LA8A 1JAIA 1SUWA 1U2DC 3RVDA 1W87A 3J81M 3EG5A 3R77A 4HGOA 4JEMA 4X3PA 4YJKA 2E37A 3IAS6 1TTHA 3HKBA 1US8B 3ZOPA 2ZRIA 1E8DA 1RABA 2EKLA 3QLVC 1RRCA 1X38A 5ELMA 5C1BA 5AOBA 3H8SA 1QHSA 2G8NA 4S1PA 5K0ZA 4LGVA 4WZZA 2RK6A 1JYEA 3HKEA 1N8NA 1FJ2A 3E70C 1RI5A 2PO7A 5CU7A 3MG9A 3WKAA 2ZRLA 1I30A 1C3LA 4EABA 1KJQA 1GSOA 1MO3A 1A7UA 1NW9B 1U0HC 3QNUA 4ZI5A 2VZEA 1VG0B 4LC1A 1J39A 5KTYA 4CM9A 5H9WA 4MHTA 1N8TA 2Y1KA 4HI0E 4DDWA 1R18A 2QLFA 2VWQA 3BVPA 4QWMA 3FFXA 1FS5A 4FYJA 1L4EA 3GOQA 3IKLA 1FYXA 4H4DA 1KE2A 3ZD8A 1CUAA 4HS9A 2O7NA 1JJIA 2Q0HA 3RDPA 1RT9A 1UPCA 5GP1A 1CTQA 1I9GA 1UC4B 1JDBC 2ZTSA 5L3ZA 3BORA 3CR3C 4KIGA 3H1TA 4GNKA 2UYNB 3KU4A 1RI3A 2WAMA 3IIMA 4C4RA 2ETVA 1WCV1 3DMHA 1Z6ZA 4CM7A 3WIVA 3E9EA 2GCIA 3LWBA 2BKVA 4XEUA 4BQNA 3ORQA 2PA0A 4HDKB 4NYMR 1NYTA 3JS5A 4A6EA 1S8FA 3BA1A 3SJUA 4PBTA 3D0RA 1S02A 3DDUA 2BUAA 2DH5A 1ZN7A 3PC7A 3ANTA 1XA0A 2DY1A 2QL9A 1M1YE 3KK0A 3QVTA 2PUEA 3EYAA 1JYFA 1IJFA 2QMHA 3GPCA 3H9EO 3OX3A 1FK8A 3BRQA 1FQJA 5M34A 3I05A 2JBAB 3U7IA 3WQSB 2YRFA 2P65A 4KRYA 3AMVA 1SRRA 1L7DA 3VX3A 5DYWA 1EGHA 3K96A 3BGOS 5KPJA 4IIYA 1TEZA 4IV0A 3QTYA 4KW7A 1GNVA 4NBUA 2JIZD 3SS9X 1UBTS 4HEA6 3SXUB 1SVSA 1XQ6A 2AJDA 3QVLA 4KXWA 2EDCA 2JFZA 3W8RA 2BR5A 3JR3A 3Q8KA 1F8GA 1EFRD 3U17A 3V80A 4QTYA 4B9AA 3P27A 3S8EA 4EG0A 1UINA 4ZIRB 5JANA 2FR8C 3K6JA 2ATIA 1DFGA 4HDRA 3QPCA 4WNAA 5JXHA 5TJ9A 4DV4B 1PTJA 4PZ9A 2DTXA 3UYLA 1V8BA 1VL8A 5AHKA 4J4BA 4ZO6A 2CHUA 4YGXB 4GUAA 1E3QA 4NJOA 4IQGA 5FWYB 1T2VA 3W5BA 2ZRMA 1MRZA 3TI7A 2RE8A 3K4PA 2FZGA 2GRAA 4FD3A 3CT6A 2Z5GA 5KWVA 3WLJA 3T3GA 3PF8A 5AJHA 5BT9A 3WL6A 4JD5A 5FJ4C 3K70B 1US8A 1F8YA 2X8JA 3R9WA 1XU7A 2IYXA 3FSGD 3DKIA 4TLDA 3S5JA 4LI3X 1GL3A 2B37A 3FKSD 4M89A 2GKSA 1JQ3A 2W0MA 3NLLA 5JBIA 1OZ0A 2ZW9A 2ONJA 3D2LA 5I9MA 1H6DA 1XP8A 3IPXA 3ZDBA 3HB4X 3L6UA 2ORYA 4K8RB 5DXFA 3TQTA 4Z8YA 5DM60 3QFHA 1GFWA 1ZHHA 2HC9A 1VJ5A 3F5SA 1I6KA 3AVXA 1C80A 3CXUA 4QXQA 1NM5A 1I0LA 2V7VA 2R6R1 4A23A 3B53X 1Z25A 1CUEA 1QANA 3TQQA 2BM0A 3F97A 5B2FA 1WPRA 1NVDA 1VDZA 4G0NA 1Z17A 1DEOA 1M1NB 4OHVA 2HMSA 2IELA 4XPZA 1B1CA 4GI5A 4LXGA 5DHUA 2VJMB 5JY1A 1XTVA 3C8HA 3SPXA 2OBXA 2ZE7A 1W85A 2O3TA 1J97A 1NVTA 3BK1A 4M99A 1ZCZA 2P4QA 4MMYB 3G2KA 4GW3A 5FO1A 3IQDB 3VO8A 1WUJS 3OSUA 1AHNA 2ZBEA 3NVKE 1HMYA 2V5AA 1CB7A 3D7SA 4KIJA 2C4KA 3ZLVA 2RHMA 4P83A 1IYZA 3V48A 3D0QA 3PSAA 4F4UA 5JLJA 1X77A 4AP6A 1D2AA 2FGJA 1BE1A 5GIOE 1JWAB 4GOOD 1VJ1A 1GQYA 3QEMA 4UQLA 2JBAA 2ESRA 2C7GA 2WWIA 1ODLA 1IG0A 1EX7A 1NV9A 2FW9A 1MFZA 2W6NA 1GRCA 1LV7A 3HH8A 5A9TA 3CCJF 2EZ4A 1L5HA 3R8XA 3CB2A 2W48A 1GZ3A 2AN1A 2Z04A 2RHTA 4UM5A 3T7SA 3UK0A 3TX6A 4X7PA 1TIPA 1YC2A 2NSHA 4A2PA 2UZ1A 5CNKA 1R64A 7MHTA 3NHMA 1R7RA 4ZOEA 3W5UA 3A2MA 3IX7A 2YWBA 1N8KA 4WK4B 3P94A 2QPOA 4ZIRA 3QWFA 3PKZA 1X3LA 4BMVA 2RC5A 3CZRA 1L9XA 3TSYA 1RYMA 3VNUA 1BGXT 2ZR9A 3WGZA 4NNOA 2O23A 2CJXA 3IEKA 1P0QA 4OJKA 1Z4JA 2HH9A 4A73A 3PFCA 5LN1A 1J42A 2RGNC 3D6JA 1GU1A 1TADA 3N05A 3ZE1B 5FWYA 2ZIAA 3Q85A 1DB3A 1SC3A 4LV8B 5DCYA 5KOHB 4JT2A 1W7AA 4A3SA 4B4OA 5DW3A 3S28A 1H1TA 1KI1A 3DOJA 1OU4A 4GMGA 1P3Y1 1EMDA 4G25A 4M9CA 5E7MA 5DE3A 1IIBA 1JIIA 3QX3A 1VI5A 2QUIA 3EDQA 2ZJ4A 4ER0A 3PUHA 1JZSA 2OTCA 3PDUA 1U3CA 1NSFA 4JLAA 3KAQA 3PB3A 5DXJA 4D3SA 5KCZA 2Q6KA 4C06A 2R6AA 4EW2A 2B98A 5A04A 2RGWA 5JJKA 5AIBA 3C3DA 3K32A 4CQLB 1X7OA 1Z4KA 4OGKA 1N9KA 1PFUA 2ZWPA 3LTEA 1NG1A 1FYVA 5CLQA 4ZYLA 2G1PA 1CY2A 4JI5B 3S7ZA 1M1NA 4I0WB 3RUIA 4ZGGA 2P9HA 3OM9A 2J0UB 2FZVA 3ZCTA 1YAJA 3WZMA 2D1FA 3TW8B 4TM8A 2KSQA 1YIOA 2ZT7A 3D5EA 3LZCA 4H3SA 1YRWA 4ZHWA 3EH2A 4XWYA 4XSGA 1NMUB 2VAVA 3UPUA 1Y33E 4WOJA 2ZUWA 5I7FA 3Q3JB 4RADA 3TECE 1T5OA 3SF0A 3G88A 3H7AA 2WMOB 4DRZA 5EGNA 3CLVA 3CLTD 4P4SB 2YINC 3DFIA 3TD4A 2XQFA 2PS0A 4KQWA 1CF2O 1J6UA 1DUSA 2GZ2A 3LUKA 2HSEA 3ER8A 3EGDB 3WQBA 1T3LA 5I45A 2WVHA 3IC5A 5JD5A 2DKOA 3ADKA 2XYGA 1KYXA 3GDGA 4NENB 3Q41A 2C88A 3QBEA 4WFIA 2Q28A 4JJEA 4QG3A 5JNSA 1V71A 2A6PA 3ZWCA 4HNHA 3AHDA 2KBEA 1RJEA 4J0GA 2OG1A 4R4JA 1T1RA 3DULA 1E5DA 2HNAA 1IWOA 1M2OA 3USCS 3BJMA 5CG2A 1QIHA 4K5QA 2Q3CA 2X4DA 3IIEA 4TL9A 1J2EA 1KMMA 1N2XA 1UP4A 3LECA 1WXDA 3HL4A 4IKPA 4IRXA 4PYMA 4TL6A 2O0HA 3WBKA 2QQEA 5ITWA 4JK3A 1CUSA 4M38A 3WIOA 2V3CC 4OJNA 3ONWA 1E98A 4I5DA 4ZRMA 2HRYA 4N5IX 3EY9A 3CW8X 1L7QA 4IOJA 3VKGA 4B44A 2IS6A 1TK2A 4X8LA 2AN9A 4PNPA 2E6KA 2XYHA 2ZI7A 3C14C 4JWTA 4QPZA 5I5EA 2ZYIA 3UN1A 2IE0A 2EF0A 3EIOA 3RKSA 3PLAE 2O2ZA 4D42A 3L3BA 5CCBA 1V11B 2R62A 2ZR7A 3NX4A 4M1KA 4HGYA 1EFAA 1BDJA 3AVVA 4EYKA 3TINA 4DSAA 4FSHA 4D3YA 1WBBA 1FP7A 1Q7CA 1VMKA 2CUNA 2XE7A 1UJ5A 2BM8A 5GGYA 3KQTA 5JQGA 4PG8A 5LYJF 4BY9D 1SIUA 3HFRA 2PVCA 4JQCA 1X7ZA 2C5SA 5ALXA 2ZF8A 4E1BA 1KARA 1S2OA 2RB4A 3MJRA 1ZO8A 1VE7A 3VDMA 4CQLA 5JWRA 3UXEA 3FPFA 1YT5A 2PCLA 4Y98A 1TO2E 3CMEF 3OM0A 3KB2A 3CKKA 1IV1A 1JDPA 1O6CA 2GFQA 2AEJA 1JIQA 4DUGD 1E2LA 4F4HA 1Q1EA 4RZXA 1ORHA 2OO5A 2WJGA 3LLVA 1FDRA 2QTLA 4KWHA 4EDHA 2O8FB 2XZDA 3TW8A 1MJGA 4CKZA 1A9TA 1PK8A 2EV9A 5LSAA 4QUAA 2UZAA 2F62A 3QXSA 1IN7A 2YXNA 2F4VB 1FLDA 3U4QA 4JI2B 1B3BA 4RU1A 2Z56A 1MTOA 1T5BA 2H0AA 2HBZA 1RCFA 3IV7A 5IAJA 4HVCA 2GASA 2I6UA 5JNVA 2COUA 1QBKC 4HO1X 4CR8A 2Q6LA 5G4LA 3A6EA 3NGMA 4YN3A 4ND3A 4QEKA 3KQWA 4V0KA 2JG3A 2R44A 4YQFA 5JW6A 1VHTA 5FOUA 1JKXA 1E9AA 1C4WA 3C3CA 4NBWA 5KYWA 1YHYA 3EGDA 4ZMSA 3EC1A 3U39A 5C7IO 1C3EA 3QU4A 1N0UA 4GLLA 2QB5A 1U3LA 2VCEA 2MINB 3L0IB 3LDHA 3O0DA 4NBKA 4NENA 4IRMA 2IOHA 1SU7A 3BHJA 3QKRB 3I2JA 9ATCA 4BWFB 5LUAA 5A0VA 3ZKAA 4MS1B 1G5RA 2RBKA 4ZO9A 4KREA 2IPXA 1R6UA 3QXJA 3B7PA 4KQJA 3RBAA 3HWWA 3W2IA 5B1HA 1J33A 3UFBA 1S2GA 1F1JA 3U4CA 4K9LA 4L78A 1XO1A 2O2XA 3C7AA 1XZDA 2V5UA 4CQMB 2ES4A 3I2FA 1JPJA 3O2QB 4BE4A 3PIRA 2H16A 3U3RA 1VQKF 2R47A 5K3SA 2DETA 1Z7EA 5BQ3A 4QYXA 4NBSA 4U2EA 5MDHA 2IXAA 3LZ6A 3NDJA 1WD7A 1PKXA 3C9SA 1UBGA 1CQPA 3RAPR 2BI7A 2XRMA 1GL9B 5J2TB 1VSUA 1JI0A 2FHPA 2R1TB 1KFEB 2WNHA 3KDAA 1LC0A 2XCOA 4G0ZA 4K9RA 2MSNA 1TEXA 1GU7A 1YGYA 3IEXA 1VCMA 5FPPA 3IJPA 4KSYA 1PJZA 4OI4A 3CIOA 4ERNA 1IZ8A 4B34A 2QD1A 4XFJA 4CIDA 4E2FA 1C8LA 1XDWA 3I04A 1XCLA 3PA8A 3A9WA 4E5KA 2Z2JA 2ZI4A 2OSBA 5C2JB 1U9CA 4P6VF 4RM2A 4YO8A 3TBFA 1T0KB 2IUEA 2C9CA 2X4LA 1P1RA 2G9UA 3H4IA 1HDEA 1HSZA 3FNGA 3K0FB 2BEVB 2NVBA 3OTHA 1QTNA 3AYXB 3F3MA 5JRZA 1NATA 3V5NA 4P98A 5HM8A 1OAKA 1G8SA 3I2HA 1ULUA 3QVSA 1DAKA 5CJ2A 2XWSA 2XMRA 3LW7A 1VIDA 4IRUB 4OAQA 4LOHA 1OH5A 2EATA 1U2SA 4F5DA 1TJ5A 2V7XA 4FEGA 3AG6A 4LDJA 1MRSA 4GH5A 4XR4A 3IDZA 5AKHA 3A1TA 2H4ZA 2XMQA 2YZKA 1J2TA 1E69A 3GIWA 5JECA 4RTPA 2A0XA 3O31A 1IBRA 3P8ZA 3GLUA 2D13A 2BFNA 4L50A 3RWOA 1DT5A 1HNZB 3W77A 1MPTA 3VJMA 2LPMA 5B6IA 2ZKLA 3FI0A 4IIXA 4LHXA 1H4QA 2O1EA 1WV1A 2FPWA 3NBKA 1DO2A 3IUJA 3SZRA 1QOZA 1QKIA 2ANBA 4LC9A 4RENA 2I6QA 3A6ZA 3ESDA 3NATA 5D1HA 3MCTA 3O94A 2WWVD 3C8DA 3H17A 4YHHB 1YA6A 5EEGA 3WZ2A 5CDHA 1PBTA 1CUWA 4KI0A 3T1YB 1FTNA 3RJTA 3HDVA 4KJZA 4MR8B 1HLPA 4F9FA 4WZAA 3FH0A 2JLZA 3LS2A 2JZNA 5KSZA 4RZQA 2BFOA 3T0IA 2FXIA 3L4KA 3A6FA 4UW9A 4DHEA 1IM5A 1XZBA 2C5AA 3HP7A 3C3JA 1QD9A 2I29A 4PYIA 1G7TA 1QO0D 3BTSA 4S3MA 4Y9TA 5K5EA 4AUKA 3M5DA 3Q3HA 2Q7XA 3K1AA 1E96A 4Y2QA 2GN9A 2GB4A 3OBWA 1FW6A 2KLHA 2CHGA 1UOPA 3NTRA 1TYDE 2D5CA 4FIDA 1YAHA 3UT5A 2IYUA 2AXQA 5LA6B 3HR8A 1KH3A 3FDXA 4OBWA 2VF2A 1KZ1A 1W2GA 1ADFA 1KJZA 2A9FA 2R2AA 1SUBA 2JGDA 3B1FA 3F8SA 3IUBA 3M6FA 2WP0A 4DTCA 4ASUD 5JDIA 2Q41A 1W4LA 2WWFA 2X8BA 1UIRA 3FCOA 2R1TA 3BK2A 3DS8A 3NK7A 3RTAA 3U4MA 3DCIA 1NMEA 4TXLA 5TS2A 1YVUA 5CB6A 2Q99A 2VHEA 4FFMA 4MVJI 5GPBA 3PQFA 2V4UA 1Y9ZA 3K92A 1FTGA 3QI2A 5G0VA 6AT1A 1KC8H 1AV7A 4OX9B 4WA7A 4Y6SA 3NONA 2F1KA 4BAUA 5LKRA 3ST7A 2WV7A 3B2QA 4UNIA 2ZDQA 3ED1A 3QEBZ 3RHZA 2BONA 1IXSB 2Q27A 4UEWA 1QFXA 2V55B 3GQBB 1YI8A 1E1RA 1PFVA 2HNBA 2JAQA 2XNDA 4WUVA 2D2VA 4LWPA 1FZQA 1X7DA 3N8DA 1SKYB 2OYCA 2WWYA 1PR0A 1PR6A 2PGXA 1D0VA 8OHMA 1TO6A 4B1FA 4RTRA 2CHTA 4EX7A 2R11A 3GLQA 5HBRA 3H2JA 3TIVA 2ODAA 2XVZA 3HBAA 3CRW1 3ZU6A 1OAOA 2VF4X 1N6NA 3EHDA 1TF2A 4WA8A 5A3JA 3KYDB 3OZVA 2VCHA 2OXCA 3OMWA 3PUXA 4PQRA 4UNNA 3W2FA 3VU0A 4IQFA 1G66A 4KOEC 3EWAA 2CLOB 4PCLA 3LC7O 3SC6A 5AOAA 1W1IA 3ZGNA 3I39X 3OONA 1HXHA 3MTBA 4KV9A 3KJNA 3PC4A 2J5BA 4INZA 5B7QA 1NLYA 1KK0A 4CT4B 1MAVA 1NR1A 1VSVA 1USWA 4UARA 1ORRA 2G0TA 1XJ0A 3ZQUA 4DTIA 2CLSA 1HYHA 3MPUA 1PT9A 4WLUA 2HPZA 4ZYWA 4BVTA 1QGDA 4GYYA 1P19A 5IM4A 2VQEB 4WAUA 1J9ZA 3IEIA 3O95A 3D0OA 4QXPA 1D5CA 1EP1B 3HCRA 3BXOA 2PIAA 4LSMA 2Z2XA 1UR5A 4PR0A 4MR8A 1NJSA 5EVCA 3RVBA 4KH0A 1ESZA 1E2UA 5LM3A 1GWNA 1CDZA 2Q0SA 1UUFA 4JC4A 4PG4A 5E7IA 1HFWA 2BDTA 1MT0A 5FJJA 1WXQA 1KI6A 3ZZMA 4OA5A 5U9CA 5H16A 3X1WA 4TKVB 3WJAA 5C7YA 4UTXA 4W1QA 2TMDA 3GD7A 4KTVE 1OX4B 3SKVA 1E66A 1EKXA 3ZQ6A 4I8DA 2VTBB 1NY5A 4L8YA 4LXXA 4YMHA 3TW6A 1L7OA 5FPQA 5YASA 3JQGB 1RDFA 1JYSA 3TRHA 2XBLA 3WGGA 1P7YA 1LLCA 3AERA 1O5OA 4FS3A 3HV0A 4FMCB 5LBUA 1UI9A 4D9BA 5ALPA 1COWD 2XUGA 1X19A 3E7FA 2IDJA 3V4RA 2LDBA 3P5SA 1MVLA 3L43A 1F17A 5FLXM 4AY2A 3PQ3A 4BFTA 3G5MA 3JSXA 1YJQA 4XVHA 4JEHA 1R0YA 2A7QA 4C0LA 1N5IA 3Q2OA 1XVTA 4LDRA 3QPDA 3OTOB 1E1KA 1L8QA 1YWGO 3OCWA 3T61A 1KYYA 3GEEA 5BUCA 1F2VA 3WMWA 1NN1A 5HY0A 3LBIA 3TXYA 1JTEA 2VHZA 2WUDA 3BGSA 1R0ZA 4XJTA 3V8EA 5C8ZA 2VJCA 1N2EA 1FFWA 4WLNA 1P7WA 4HRAA 4OUDB 4GKJB 1P1HA 1N5DA 1NKTA 4G2TA 4I14A 4IG4A 1HV8A 5DM1A 1M7BA 1NUTA 1OBFO 2VP5A 1N2IA 2DHEA 3D3QA 3F71A 1HE4A 2PKYX 1D1QA 1J8QA 1K6EA 5A7HA 5BN4B 2DPHA 3MF4A 4RLHA 3VDRA 2CVZA 4H7IA 4G88A 3LK7A 4JBWA 5G4KB 1JDNA 1KK3A 2DUUA 3GLIB 2GPWA 2XNCA 3J80A 3LP8A 2PMBA 4MB6A 5AO9A 4IXMA 1H1DA 2R4QA 3ETGA 3LQ4A 1I01A 3AL0C 1OIVA 3KD3A 1NIJA 1UK8A 5FLKA 2FMFA 4CV0A 4FTWA 4NE7A 4O4LF 1ZOPA 4CKYA 2IHNA 1JT9A 4RK5A 3WLIA 4CR6A 5C8YB 2OTMA 2IYYA 1W4CA 2M6SA 4FDUA 2RH8A 1U94A 1PEKE 2DT4A 3THOA 2VRCD 4IDGA 3VH4A 1P2FA 1VJTA 5AVKA 5BYBA 1Q91A 4KXNA 2JJ2A 3NXSA 5KQSA 4JSYA 3UEOA 1Q0SA 2FP3A 5G0WA 5AW3A 4JJ8A 3IP6A 1JQJC 2PFGA 2RHWA 2VAXA 2R6HA 1NJ1A 4NOJA 4F86A 4DE5A 5LQKA 3IBCA 3SEZA 5F1OA 3QEAZ 1MKYA 1KC1A 1LA2A 5DM70 1C2YA 3I0ZA 3L4EA 1TKAA 3W5HA 5AKZA 1M7GA 3V7YA 4BFWA 4XJVA 1R6DA 4O33A 3S0HA 3DD1A 1OLSB 3E7WA 3IXMA 2I2WA 5J4LA 3OLQA 4EWLA 1Z33A 4UVHA 4H0FA 1ONOA 2GK6A 3FHOA 4YCJA 4D4IA 2IHUA 2JGKA 3FFBA 3IKEA 2VLBA 1A9SA 4EO4A 4R40B 1J5XA 3WGOA 3VM6A 1XXHB 2B8EA 4OOEA 3TM5A 2GN8A 5A4FS 4MQ5A 3NHJA 2UV8A 4RH3A 5EE9A 1BE8A 2D0IA 4DNOA 4QATA 3QX8A 3HUFA 3GBSA 3FFAA 3BKWA 1SBTA 4QDKA 1B8UA 1B2RA 2VBCA 2VDLB 3OLWA 5BW6B 3K14A 2P9JA 1ISIA 3FPAA 1TAGA 1ECBA 1N3YA 1CD5A 1WDLA 4PFJA 5DI3B 10MHA 5GV8A 1TMKA 3KQOA 2X1HA 3VMFB 4B3IA 2WD9A 4QUKA 4HFRA 3NWPA 2O4CA 4JLVA 1X1DA 3HP4A 2BGWA 1U0BB 2ZUSA 3PZRA 4RH1A 3LNTA 2P9YA 4OUDA 4MVCA 3F67A 2KLBA 3TVDA 1RKQA 1W73A 3BXPA 1QZUA 2VO1A 2YHAA 5DK4A 2NO0A 4CGYA 4LJSA 3FYSA 2IFTA 3R1IA 1S2MA 5JY6A 3D01A 2JGNA 4NDAA 1QIMA 1W0CA 1XFAA 4J2TA 3UK2A 3MT0A 5CH3A 5DYIA 1MHTA 3H9GA 1JE0A 1R3DA 4C8IA 1ZQ9A 1ZR2A 1MRNA 4YO7A 1T4DA 1CQZA 2RI6A 1I6LA 3HSKA 5LU8A 2EZUA 1NMSA 3EAGA 2V3WA 2YWGA 2F17A 2DQYA 3GMTA 1NR7A 2G7MC 2H85A 2IK8A 1DIRA 4J7XA 3JTMA 4KFSA 4BO4A 1U8TA 1G3RA 2VPWA 2JPDA 3MELA 4GEGA 4G4SO 2QE7A 3LWDA 3NJRA 4GT1A 1BXKA 3RCBA 1Q20A 4TUYF 2OQIA 3VR6D 1I0ZA 2IAFA 1ZD3A 2ZB8A 5C8YA 3R0QA 4GI1A 1NU8A 5JE8A 3X1MA 4DMKA 3RROA 2ERCA 1M7HA 4OI1A 2GZ3A 4Q0MA 1FP4B 3MWGA 4PYLA 5B4UA 1X7GA 2JLCA 2KQUA 4QX6A 1GRNA 1NFQA 3LBFA 1X7WB 4IUCS 2IQ5A 5ALKA 3NMUF 2N0SA 5E8JA 2WAOA 4UAUA 5CA0B 1KK2A 2P4SA 4CE6A 3K73O 3A37A 5F7ZA 3K9BA 1FW8A 2DHQA 1P0FA 3PEVA 3II6X 3QVOA 4KIUA 3OCVA 4Q16A 1OLSA 4JNKA 4N6OA 2I4OA 1OYVA 4DEXA 4HDMA 4NE9A 1T1IA 3H84A 4KQ1A 4MVXA 4I4TB 1H2RS 5EYPA 3QGMA 3W8DA 3ZHYA 2JJQA 4AD8A 2ADMA 2AF3C 3HJNA 1CZUA 5EUQB 1QCZA 4I8XA 4K9PA 4CGZA 4NZ9A 2CD7A 1E3TA 2UVQA 4R40A 4FHCA 1AUXA 5IULC 1U6IA 1XTRA 1W48A 3DVLA 2CWJA 4J1NA 2GN1A 3UYKA 3R3HA 3GMIA 3B1JA 2H4YA 5BR7A 1NQAO 5EESA 3KIZA 2Z0MA 3U19A 5KNCA 2F1IA 5FF9A 2ZDGA 2QMOA 1I3KA 3C45A 1B0ZA 2R60A 3KV1A 5B53A 2RONA 5KX5A 1C1XA 1NI5A 3A1CA 2IGTA 2FW1A 4EFMA 2B94A 3ICCA 2FNAA 4MCIA 1UK6A 1V39A 1U4SA 1XD9A 1JHZA 1V5FA 4KXQA 4ZEOA 1KMIY 3TS1A 1HX7A 4YRNA 2GPJA 5TR9A 2IX9A 3NQ41 1FNNA 2CVQA 2HT6A 2ADFA 1A04A 1NBAA 3L1JA 2Q6VA 2WYHA 1XZJA 3M9WA 4TVOA 4RQUA 2X0EA 2H8EA 1KXZA 1M34B 5LP6A 4Q01A 1EAMA 1NOKA 3SGLA 3O5AA 4X24A 2ZR0A 5CDUA 4LJ5A 1EK2A 1ZWLA 4L76A 1B2LA 2VKQA 3LKBA 4HVLA 4JXXA 1ZGAA 1EDEA 4HB3A 5DHTA 2HHJA 3E8SA 5E1BA 3EF3A 3GLHA 2Q6IA 3ONEA 3R2JA 3B7GA 3R3UA 3GI1A 3PICA 1GUDA 3CG6A 1N2GA 2W2LD 2QORA 5F4ZA 2Z98A 3ZHCA 1LXCA 2VPQA 3KJKA 1TK9A 1Y6JA 1EXMA 3EGXB 3I37X 2I87A 4MX8A 4AQDA 4JJ6A 4XD7D 5IHPA 1TC2A 1FP4A 1GYRA 1VKHA 5EP4A 1DBPA 1RI1A 1H66A 3RUHA 1OFVA 4FI3F 3N8HA 4N49A 4PZYA 3CH6A 1X7WA 2YN4A 1U80A 4WASA 2I65A 4LNHA 1QAQA 4LK2A 4EARA 4UQOA 2QD5A 4OKSA 5EEHA 3WB1A 5CA0A 2OZLB 3LVRE 4EA9A 4RTNA 5JJCA 2YQ5A 1YZUA 4XVCA 1IY9A 2ARKA 5KYYA 4B7CA 3DLHA 3MCAB 4WK6A 2HDWA 4GYJA 1XBTA 4BMZA 1G2IA 1PG5A 2FSPA 2FWRA 2LXNA 3LA6A 1G6Q1 3NETA 3ZZ0A 5CD1A 4Z4HA 1L3CA 1S96A 2PR7A 3PFNA 3VV2A 5IKOA 2QAGC 3ZU2A 2XEXA 2IDKA 1J1IA 3VCZA 4WX2B 1KBQA 4I4TA 1QWOA 1PD0A 5HOEA 3CS3A 3FUUA 2E49A 1MOPA 4ND8B 4R7GA 5B3JA 4YV2A 4EYSA 3SWWA 5DFAA 2ACEA 1FBNA 1IHDA 2VPZA 3CMMA 4Q3KA 4WCFC 5AESA 1JXMA 2WUFA 3QW2A 3IKFA 2PMCA 3I2IA 1KERA 2V7QD 2I6DA 3MLEA 3U26A 4DA0A 2OQVA 4FDMA 3HMKA 2FPLA 2WFLB 3N8NA 4P08A 1MOZA 3Q0IA 4PY2A 4EQ6B 4UHBA 4D9GA 2ID8A 2QZZA 4J1TA 4YACA 5SICE 4C01A 4RO0A 1P2UA 4LMBA 4ZCTA 1GPH1 3CW2A 3L7KA 2OCBA 3IAUA 3N2KB 3OE5A 3D31A 3GRUA 4L8FA 3T3MB 2PVPA 1B8VA 2RGYA 3G9XA 3TCXB 4KR6A 4U3JB 4J3FA 3UJDA 2WJJA 1GNSA 1CR2A 4X1IB 1K75A 2HMAA 1ZN8A 3OFJA 2I3GA 3E3MA 3V8NA 3MQFA 3NRBA 2YXDA 4EY6A 2IHKA 5IANA 1QB7A 1X8JA 2P5TB 3IOBA 3F8WA 5TC4A 4LRTB 4A8JC 4Y7CA 5DBGA 5B2EA 3CM0A 1M34A 3BD8A 2VNJA 5CX1B 5HKOA 4YP5A 2FPPB 3TNLA 4GC5A 3FTNA 5FLEX 3UGJA 4PNEA 2FZLA 4YGYA 4O08A 1Z5WA 1PS8A 3LGXA 1T4CB 1N7GA 4DR6B 2HS3A 2XZLA 3ZLBA 3ZHRA 4Y2VA 1A82A 1GRVA 1MU0A 2C95A 2HXYA 3HNRA 4QGAA 4AS3A 3BRSA 4BL5A 1ULBA 1I10A 1GPUA 2XUAA 4IZOA 4KRFA 4KQEA 3ZCQA 2I7CA 3H05A 4KBFA 1YQDA 2UUCB 3G8DA 1GCGA 4AJ2A 1P31A 4P58A 2B1RA 4NNJA 3WGTA 3AT1A 5JUWA 4PC1A 4MQBA 3QPAA 3EGXA 4FZ3A 2HQOA 4RIGA 1UC8A 1GYQA 3B70A 4NQ3A 2NYRA 3B9PA 4TMYA 3RF7A 4N8SA 3WYCA 4AMZA 1XWIA 4IOMA 1R0RE 4YA6A 4YNBA 4W5OA 1Z73A 3HU1A 4U7DA 5BOSB 4MICA 5EQJB 4OD0A 4O4IB 4J07A 2RJ3A 3AW8A 3EGOA 1KR2A 2FW6A 3D7LA 3QZUA 1YDEA 4PVDA 1DEAA 1M0TA 2XKAA 2OZLA 2X2FA 4WGGA 3TO5A 1P60A 2FVXA 4MYDA 5GAJA 4WKNA 2GTPA 1BJRE 4I46A 2AL7A 4XUDA 2ZIEA 3C8UA 4LAFA 5WRFA 2WUEA 2I2FA 4H16A 3V4ZA 4QVIA 4CIAA 1QVZA 3X2FA 2JGAA 3L7NA 3D4IA 2DBYA 4PCVA 3OZIA 4C4YA 1OFIA 1U7PA 3SICE 4US0R 4DY6A 3HN6A 2D5IA 1GG9A 1TGYA 2J5RA 4TX1A 4QYTA 2VUHB 4ILKA 3GGSA 3MFQA 4RVCA 4ND8A 3G2OA 3PUIA 5FOXA 4DW8A 5JBQA 4JNCA 3LQ2A 3NHZA 4J7CA 1ZK1A 1RQXA 2G9RA 5IEBA 1THTA 3TW4A 3LDAA 2E82A 2GUGA 4BUCA 1LEHA 5FUQA 3VI6A 1TM2A 1E59A 1R6BX 2JIZA 2NZYA 1DCKA 2V6MA 1JAHA 5HKAA 2WFLA 5HRUA 4DYHA 1XNJA 2PRSA 3KPVA 3GLGE 4HH3C 1Y6GA 4CW7A 1AURA 4X1KB 1QIDA 4HLCA 2PAAA 4EQ6A 1RTKA 3U4DA 3UO8B 1WXWA 3PFWO 3JY6A 4Y67A 1CY7A 2O2CA 3WP0A 4UBMA 4RQTA 3SX4A 3UHOA 3E53A 3OQJA 5IARA 1E0JA 1AJEA 1J0XO 5E6RB 2KW5A 4X1YB 2EJWA 2VSFA 1JW9B 1SU6A 3TW0A 5EHQA 5M5BA 2ZXFA 4X1IA 4FX2A 2C0PA 4UUNA 3CHYA 3ZDAA 2M1XA 5DYNA 1USKA 3NWJA 2JZCA 3C7KA 3KJIA 3NHWA 4AP9A 3BD9A 5ADVA 3M1AA 2BFMA 1S7CA 4WBSA 3D6VA 2R3SA 2WUGA 1U8UA 3OURA 3PJEA 1J7KA 1HZJA 2FPPA 4NMLA 3ZK8A 1KSGA 2P30A 3QM1A 2SCUB 4HH1A 4CMEC 4D80A 5J1SB 1T4CA 3K5IA 5CT6A 2CDCA 1DP4A 1B41A 1EA5A 1JSZA 1KRHA 2Y1OA 1WEKA 3D6FA 3OE7A 2Q5CA 3ORRA 3P9QA 4FYPA 2WV9A 4MIYA 2ODTX 5SYAA 3OT5A 2EIXA 3DQQA 3DC2A 3FNQA 4KAAA 4KYVA 1JNYA 5DNVA 2QA4F 5E9AA 2GJ4A 3A4MA 1GLVA 5AR1A 2UYYA 1YB5A 2ZWIA 4G9BA 1JFTA 2PY6A 1MXFA 2IY8A 4Z86A 1CBUA 3TSWA 1GUBA 3QP9A 5LQRA 3F6CA 3PR3A 1XTBA 2B8WA 2UAGA 3MBIA 3ET4A 4YRQA 5FOWA 2WM2A 4PN3A 1U1FA 3MJVA 1D6JA 1Z2DA 2BLLA 2ZIWB 4ZOLF 4B3HA 1RI4A 4MI6A 2DPLA 4K0KB 1AH2A 1CE8B 3BQNB 2R2GA 5CBPB 1H6BA 5BOSA 1YFZA 2ET6A 1VIMA 4O4IA 2QV7A 1NNUA 5FI5A 4NICA 1FSGA 3A58B 3HA7A 3GTZA 3QNMA 1SDSA 3IHWA 4GYKA 2VGMA 2QNRA 3IP7A 1ANKA 5A05A 2C3PA 4UMEA 4NMWA 5CB4A 1CQWA 1JKIA 3NBQA 4XAQA 3EODA 1Y63A 3EX7C 3CO0S 3OQBA 1CUBA 1QDLB 3B9BA 2C1XA 5HEKA 2IV2X 1ZM3A 3RK4A 1ZMTA 2PVSA 3O47A 1MORA 3D8HA 4HB2A 4LV6A 3TM4A 4A0HA 1NMYA 2I7DA 2H0QA 3ZDZB 1PZMA 3HFJA 5DP1A 2VZ8A 1IEWA 1QVFF 1HYBA 3IMFA 2HD4A 4N6GA 4R1LA 1MC1A 4H35A 5AICA 4B33A 4EG4A 3GUCA 4N9QA 1JXAA 2PZ8A 4HQKA 4DB4A 3ZXIA 3PUZA 4J29A 3I3FA 2XAUA 3CUWA 3WGKA 4IO1A 3PS9A 1H8HD 1V4VA 4CLDA 2A33A 3TLYA 4X1KA 1SC6A 3ZQ4A 3H5RA 4C3ZA 4C4TA 5JD3A 3A9VA 5KDOA 3PC6A 3KWJA 4RKFA 1WUTA 2Y93A 3QFTA 2QP3A 2J4CA 3CZPA 1YHQF 3JQ9A 2DCUA 1GKLA 1MMFB 4GL4A 4TTQA 3K9WA 3EXFB 3RRBA 1AQJA 4QLAA 1VYVA 2B6HA 1YCFA 2CBXA 2QR5A 5E6RA 1UPBA 3H9QA 5LIRA 2WM9B 3WTBA 3O92A 3W5JA 1J99A 4E5PA 4YDSA 4B79A 1G20E 1DC6A 3AQIA 1RA4A 2JVJA 3VMMA 4DKJA 3BWVA 3UPTA 3P0JA 4V0SA 1C8KA 2Y99A 4OB6A 1I0IA 1Y4UA 2H06A 2B4YA 3V2UA 1QHFA 721PA 1QP7A 1XCGB 1GIAA 2SCUA 3A4NA 1HBJA 1JEJA 1VCNA 3WIEA 3GFRA 2DPGA 5DN6D 5E6SB 4AY6A 4TV9F 1XNQB 3HB5X 4QYWA 2WM8A 3R3YA 3JD2A 5JXJA 1T36B 1ZQ1A 3MJTA 3FIUA 4F0JA 2UU9B 2GLZA 3D8TA 4BVRA 2BFFB 5IUKC 1ZWKA 3EVNA 4LCEA 3ZV6A 3NVDA 4LRYA 1OPRA 3SJBA 1QV9A 4NCBA 4BJ1A 3O4HA 1WB9A 4J0QA 2FPOA 3OY7A 5FWXB 3C5CA 5DYGA 1QPGA 1HK7A 1CW2B 1TQDA 1DJOA 2P9CA 2WPNA 4LHVA 1UBNA 2QDKA 2BI8A 3RE1A 1RM3A 1YZVA 1EWKA 1F6DA 1JZTA 4PG5A 4D9NA 5B55A 2QTTA 5CBPA 4Q4AB 1VKOA 2VP3A 2VYVA 2A35A 3DV2A 1WW8A 2M6KA 1LDGA 5K3BA 1DT9A 1JJ2F 1A8SA 2AQIA 3LF1A 1GZ4A 2FG5A 1OILA 3S8MA 5K0NA 3GJ3A 1ZVJA 3SHQA 2YQ4A 5A3SA 1LBQA 2YXPX 2B92A 3OJEA 4UAGA 2FJPA 1HORA 3DPSA 4PO1A 2CNDA 1Z0SA 2JFBA 5J4YA 3HDJA 3PSHA 2WQZA 3ZEAA 1M2HA 1R5NA 2BOVA 2IYSA 1DXOA 1JG2A 2QPLA 3BZWA 3DZIA 3TLEA 5DBEX 3OPVA 1DTEA 2WEKA 2FPMA 3NHRA 4Q9HA 2GZLA 2WSIA 2W2MA 1K3UB 2Z95A 4WXEA 5CHYA 4NESA 1UEXC 4ZAVA 1KOLA 3VZSA 1W34A 2J67A 2J0SA 1NA5A 2XQVA 3ABSB 4UHCA 3LVFO 5E95A 1AHIA 2Q5EA 2JKYA 2XE8A 1PTJC 4TVKA 3E2MA 3GNQA 2BFDB 2IVZA 3M9LA 3P96A 4Q6WA 4WPGA 3MWYW 2JLRA 3U9SA 5K8JB 1GXSB 1W96A 2QZ9A 2QW1A 3Q9SA 5K3EA 4TWBA 5COBA 1W5AA 1DDIA 2HJGA 3Q3CA 4URWR 4ZAZA 1YTLA 2I4TA 3BIFA 3DMTA 4Y2UA 5EG5A 1H2XA 5GONF 4N3GA 3TKLA 4ITUA 5CK5A 5AW1A 1JEDA 2QR3A 3UMFA 3L77A 2F64A 3GCZA 3IQGX 3ANSA 2RARA 3HUUA 3MCQA 4S35A 3JAMA 4CHGA 4NHOA 2ORED 3ZWBA 3CNHA 4OGFA 1B42A 2QM7A 3V32A 1A5ZA 4GPTA 1HDYA 4OQDA 5E7QA 2P3OA 3UGTA 1J0BA 1PFQA 1CLIA 3BHMA 3RIMA 2O5CA 3P2JA 1XMVA 1QQBA 4P3NA 2QIPA 4O2BF 2K6GA 1AKYA 1NM5C 1JJ7A 2OPBA 4GOXA 4UCWA 2B2CA 3IOCA 3CNOA 3IDFA 2ZGVA 4KH1A 5JATA 4N3NA 5CCEA 2QT9A 2HKIA 3HHPA 2Z1TA 3EF0A 3N8KA 5F2KA 4QZVA 1T36A 1K68A 2YWXA 4PV7A 5B3LA 2R7AA 4J0CA 2J5QA 3PGJA 3PHGA 2AD5A 2GCOB 2XYQA 4MWBA 3ZE9A 3TD5A 2AB0A 2XTAA 4DCJA 4K26A 1OJLA 3FLMA 3OQIB 4R0VA 3ASZA 4KVZA 2MDTA 5MF6A 1PT8A 3HTNA 2ECKA 4PHHA 2VA9A 4RPGA 5IKMA 5KMGB 1Y37A 1ECPA 5AOVA 2VUUA 1KO4A 2V97A 1FTSA 3UJNA 5HP7A 2ENWA 1U04A 2P2SA 5AI0A 3BMXA 4MA5A 2Z1DA 2VDJA 5LA6F 3V4VB 5AJWA 3CSDA 3ZTYA 1YUBA 2ZPUA 3FGOA 2D4AA 3OY2A 4KCGA 2SBTA 1K6XA 1JZQA 1TUGA 5FI3A 3FCXA 3MUOA 1Y5LA 4NL4H 1DAHA 1RI2A 4HMPA 3G82C 1UMBA 2ASVA 1XD8A 2PBLA 3DVAA 1OXTA 4LZOA 3AJDA 1G3IA 2IYFA 3TX2A 4F5EA 5GVSA 5EO3A 2I5PO 2X4GA 3A6KA 3ZTWA 3PRHA 2FFJA 1IV3A 3TQIA 4BNXA 1MD9A 3F5QA 4E2WA 1AZLA 4KVAA 2Y1XA 1R27A 1XWWA 5MN6A 2O2IA 1JPNA 2ZXEA 3HJWC 2H54A 2ZDHA 3LUGA 1FDIA 3VPSA 1OFUA 3TOVA 4BEBA 4Z53A 1IWBB 2QRZA 3QLUA 4X91A 4KGXA 1CJVC 1ZJYA 2XQKA 1JIUA 4N0QA 1VG9B 2OXEA 3E61A 4N7BA 1CP2A 1RJ9A 4UNPA 4UBIA 4WKCA 3KFXA 1Z08A 2BFDA 2HEGA 3JQPA 1GRQA 4LHZA 5DCUA 5DV9A 4NK5A 2GTHA 3PENA 1U8ZA 4UEKA 1E58A 3OPQA 3UJ8A 3A6DA 4TV8F 5CP8A 4CWAA 5BV1A 3DP7A 2AE2A 2HA4A 5LPNA 4BN4A 3S2GA 1IUOA 5HIMA 1PSWA 4I5FA 1X1CA 3SQXA 3QVGB 4BVBA 5SZKB 4JR2A 5C32A 2I33A 2FEWB 4FYIA 4P35A 4DWJA 5KU7A 1NI4B 4RMHA 3CN9A 1I36A 2X58A 5DU2A 3SYMA 3RE3A 1YRHA 4C0XA 4EELA 1TQ8A 2ZPAA 3JTEA 3K1ZA 4B0PA 3VC3A 3OQOA 4DDVA 1IOZA 2C2KA 1VKNA 3JQAA 1U4OA 5ICFA 3NTLA 4RLQA 1GUZA 4WKBA 1MBZA 1XTQA 2GNOA 4GOLD 3R40A 5BQPA 4B3XA 2HA5A 4ENUA 3CRQA 2AOUA 3EMVA 4GX0A 4IIHA 2J9XB 1Z22A 2GM3A 1P5HA 4U7JA 5D85A 2R68A 3P9PA 3PT5A 4NP6A 2PX3A 4I55F 3VFDA 4X94A 1LWNA 3FE2A 3GEPA 2HZBA 4QUEA 2FDCA 4YJDA 3DW1X 3N0VA 1PTKA 3PTLA 3OQIA 1XF9A 2Y66A 4OLHA 5E9WA 4YR7A 3S99A 2GYWA 4O8ZA 2BD0A 4FWIB 4CKCB 4JIGA 5KMGA 1NUSA 1OJ7A 5JFGA 1YNSA 2FC3A 2EEPA 1E1LA 4UOEA 3WMFA 4ZOAA 2H2IA 3D4BA 5K0EA 1NJGA 5AW9A 2AG5A 3DBHB 4CPDA 1WIWA 4FZVA 4BNFA 5HKKA 1E7RA 3C9TA 1CJBA 3V6MA 3PK0A 4E07A 4S1TA 3VR1A 2XXAB 1Q16A 4ZEWA 3Q12A 1JEQB 4INPA 3TIXB 2B30A 1UFQA 1XHLA 2DZDA 2J7PD 4KODA 5JS8A 2PYIA 1B15A 1CFZA 1JJBA 1P2TA 3DGFC 5EP1A 4AF7A 5KYNA 3WNVA 3GLFE 1P44A 1QGED 2V7PA 1KJ8A 1TZMA 1XDZA 4IMJB 1KAGA 2CLKB 1KVTA 1PS0A 1DOAA 2B4TO 4RSMA 4WFKA 5DLDA 5TPWA 1QJCA 1AX9A 3O03A 1TIKA 3Q7PA 4CHTA 3FPKA 2A9RA 1DXHA 3IKJA 4AP5A 1Q6ZA 1XEWY 5CXUA 4L51A 2PH3A 2XEDA 2QGFA 1Z6PA 3VZQA 2AXPA 3O8BA 4ZK2A 2YVAA 4OIMA 2XT0A 2MHCA 2PJRA 2VN8A 3X44A 5ESXA 3VR6H 4XASA 5ITVA 4YRIA 1TKBA 1SM4A 1UJ4A 3G6EF 4QOFA 1FP2A 5C3UA 4D4KA 2ODEA 2JK0A 1AZWA 1ORTA 4L2IB 5IVHA 2NO9A 1PJBA 3QVGA 2VL7A 3W34A 1RKXA 2LDXA 3UKDA 4MA0A 3ZGVA 3AFIA 3IAXA 2JIRA 5FNZA 1OFTA 3OAAA 1C7IA 3I4LA 3T5PA 4DR1B 4O4JF 3CUSA 3K53A 1T9KA 3R5JA 1BX1A 1EFVB 2H5JA 2PU5A 4D4LA 5JR3A 1CF9A 1XZLA 4DLPA 1ECLA 3UF0A 4EKNB 1P9NA 1TA0A 1OH8A 1E8MA 1V6AA 3DEAA 4OUKX 4Y2GA 3BCRA 1H2BA 4DZTA 1JILA 4FGKA 4P31A 3FCEA 4TKLA 3TOSA 4G63A 4MAFA 2WJAA 1OIWA 5B1SA 4MKXA 1K9SA 2GJ8A 5TPZD 4Z9AA 1WZEA 1EE1A 1Z62A 2OO5C 2IA5A 3GPBA 4FMDF 4RFVA 1H9CA 4MRRA 2WAXA 4BMNA 4UFNA 1J0AA 2SKEA 1XYYA 1F8FA 3B3GA 2ZJ7A 3D5QA 1ZI9A 1AUPA 3ASUA 1NQXA 3O73A 2RG7A 3O4JA 5HDBB 2YV1A 1U8EA 2FZ5A 2WDZA 2OB2A 4MRVA 1F9EA 2ZIZA 4EBBA 4CKEB 1YU6A 1UXOA 1ZH8A 2BY4A 2BJWA 3BJEA 3MWFA 3U81A 3ZCRA 4C7KA 4CKCA 2ZM5A 3HGQA 4N82A 3EWSA 1CS0A 4QULA 4YRPA 2VK2A 4N3CA 4HNRA 2J1LA 3F90A 3VI3B 4C5CA 1ZICA 3N7AA 3DBHA 5AKJA 5A4KA 4ENQA 4FC6A 2CSXA 3B5EA 4ZQCB 1JSXA 5HW0A 3HB0A 2XXAA 5K3OA 1K8ZB 2V1UA 3TLJA 1RBQA 2O9JA 4FOLA 5JEDA 1DWOA 5H59A 3AHFA 3BTOA 1E79D 4LVOA 3SQLA 2YVKA 1JLKA 2G0AA 3H97A 1D4FA 3QE4A 3UMJA 4G4JA 1IDN1 1MV5A 2VHQA 5EMKA 5AXCA 3HN7A 2Z1EA 1CRQA 5AVMA 2JEYA 2NADA 1HYEA 4CKBB 1KZGB 4BT7A 3KVVA 4OXNA 1SD1A 1FFXB 2AZ4A 2R7MA 5ERYA 1BFKA 4EHAA 4MO9A 4BKUA 2Y3IA 5B4TA 2FETA 1QAHA 2FXVA 3A9UA 5DTJA 4JMPA 1G9XA 2IUYA 4KQ6A 4WD3A 5HILA 5SYMA 4KO1S 3T5TA 2XLCA 1GDTA 3GUHA 3FWHA 1L4UA 1Y81A 4NCKA 3X3HA 3HXOA 4EGJA 3AF2A 3E5RA 4LXIA 1KDRA 2NPIA 1AQ6A 1Q7BA 2GPAA 4YJ3B 3TR0A 2H1CA 1VXOA 4C5AA 3OU7A 1WMSA 4R05A 1YZGA 4IDQA 3ZHTA 1U2PA 3UKJA 1GN8A 1FTWA 1R10A 1RAGA 2GBPA 3MK31 1E5QA 4OYHA 3W79A 5DNUA 2A67A 2FLKA 4L2IA 3B3FA 2I6TA 5CEJA 5IYZB 4ENVA 1N8RH 1NVXQ 2X5OA 1B43A 2BBTA 1T5HX 2I7VA 3HCCA 2IEGA 3OEED 1QK3A 1MOSA 3IE1A 4IOKA 4B75A 3AFGA 1AUQA 3CCQF 1SU8A 4LKOA 1VQ6F 3NKLA 1AS2A 4JL8A 4RTMA 2QTPA 4OL9A 1G8JA 1R6XA 1VQLF 4MGZR 1EBUA 2P6MA 2VT2A 4RVNA 1L5QA 4PYNA 2Q3FA 2D5AA 4ZI7F 1IN1A 5F7OA 5T5QA 3I04M 1B6GA 3HBLA 1LRKA 4WY8A 5F73A 1XRMA 3LF2A 5IBQA 1QH1A 3IILA 3LQYA 1KJIA 2Q1TA 3U37A 3DHVA 3ZO8A 4D7AA 1Y4ZA 1VFNA 5JSYA 4FHGA 3KSZO 1YASA 1XRGA 1E2HA 1ECFA 1IXZA 1PQ4A 3ACBA 4KGZA 1J7HA 4XH9B 3AI3A 5DWVA 5K8TA 5JYDA 2DTEA 1NJ2A 1B00A 5I9SA 3Q8MA 1NOJA 1VYUA 2HJVA 4Q9KA 1ZJ4A 1E7KA 3MILA 3KUCA 4PGAA 2RGBA 2BPOA 5EZYB 3WXMA 4CKEA 3AEZA 3SLRA 1ZUWA 5HOQA 4QELA 1L4KA 1ZLYA 5F35A 1IN6A 1FJHA 2E5WA 2PGAA 1XU4A 5I4IA 1R37A 2WSSA 3DO8A 4D79A 1GDHA 4ZCRA 4J0HA 5JVDB 1FMFA 2R48A 2AUMA 3KFLA 4JYBA 2QX4A 2ZODA 3NYWA 3V8PA 1U3UA 4A6XA 4COKA 1XMOB 4IDAA 2X2PA 4J49A 4BO1A 3G9TA 2BM9A 3WBBA 4A0SA 5EJ8A 5HNKA 4OJQA 3JAWB 1F0KA 2KI5A 2JJ1D 3ESRA 4M3NA 3T7DA 3E05A 2OUKA 3MRVA 4UUMA 4X6XA 1F8UA 4P5PA 2R79A 3UBMA 4BDTA 5KDDA 4WVFA 1U7XA 4KX3A 1NNEA 4IGAA 2DQ4A 1A3CA 1JU4A 4J0JA 4OQFA 3X1XA 4CKBA 4YUWA 3A36A 1U1CA 4IKEA 2O0JA 2J6BA 3IUQA 4JR0A 4MOWA 1FFXA 4L73A 4OOFA 4GPBA 2BTUA 2HI0A 3L6DA 4M2LA 4G97A 4J03A 4NPHA 1HEUA 3O93A 1KKLA 1PHRA 1BFDA 2VJBA 2VRCA 4FKMA 5BMVF 5JOQA 5BW4A 1IBSA 2GMWA 5ALLA 4TQAA 2Q62A 4ZU3A 1L5GB 5CITA 1U2EA 3S0JA 3W6PA 3ELDA 4FYYA 1WXGA 2UYOA 2J7KA 1E5TA 2V0CA 4NDNE 1GAWA 1SXJD 4WESA 4TZ6A 3AB3A 1GN9A 2RFLA 3W6OA 2C4TA 1CDOA 5P8WA 3CX3A 1AMNA 2QHXA 2PGJA 2A92A 2ZYTX 4NBNA 5CXSA 5ALZA 4ZCPA 3LYLA 4BZZA 4YRBA 2UXBB 4B87A 4BMCA 2P3QA 3USES 3WLNA 1YJBA 3D2CA 1M2WA 3G5AA 1WEHA 3T4PA 5DWDA 1ONSA 4IJMA 3RFXA 1YFLA 2OHWA 4EF4A 2QTBA 4ODIA 3UMCA 5FEMA 4Y9SA 2GBCA 5JNUA 4BNYA 1FRQA 1OTHA 3KJJA 1DBQA 4KXVA 4X6YA 5JPIA 1UT8A 4H08A 4R51A 4ZJUA 5J23A 4JKOA 1E2KA 1EM8A 3UV7A 3CCBA 4AG3A 1YBFA 2JI7A 3MTEA 4MVJD 1GR0A 3FYUA 5HF8A 2IS2A 5A0TA 3ZEIA 1ZA1A 1V5EA 3NUGA 3ASYA 3YASA 8ADHA 5BNIA 3MBKA 2QE6A 3CRVA 3GGDA 3MW8A 4FQ7A 1OAOC 4FZ5A 3P2EA 2NLOA 1N2HA 3ZD7A 3NRJA 1MO2A 3DV0B 3TD9A 2X9QA 2LCIA 2RGEA 3VQTA 2JI8A 4RK4A 1BMTA 3K05A 3PD7A 5JROA 1GFSA 3K0AB 3UICA 1XPJA 3CEPB 1LBEA 1UQUA 2G9ZA 4KO8A 3IMPA 4DLSA 5EZYA 3VDQA 3ROGA 4L4ZA 1PUJA 5HRAA 2VRNA 2EJTA 4O4HF 3ZW7A 5F2NA 1OGJA 5IAKA 1OGYA 4BDSA 1OT5A 3N75A 4H3KB 1ABEA 1JR3E 3KSRA 2OT3B 3EZYA 1R4NB 4U7FA 3N6VA 1LUAA 2BGKA 2R85A 3F74A 2RB5A 5I5GA 4A0RA 3DDHA 3L01A 1H3EA 4O2AF 3FY4A 4MGIR 4WW0A 3JAWA 4DXAA 1W36D 1XVIA 3RUAA 1U3DA 1P1KA 1T3SA 4L0CA 3H6GA 1DJNA 5DGHA 2XMSA 2C3OA 4RHXA 1WO8A 1BGWA 3I72A 2NUPA 2CCGA 2ERXA 2B2XA 4TYNA 3IURA 1LC3A 1EZ4A 2I03A 2I78A 1P17A 3ZBQA 4ENRA 5K0BA 3HA2A 2H6EA 1Z7GA 3SSOA 4MDEA 3NAZA 1A97A 1Z0FA 2JGMA 3M6AA 3KL4A 4HNGA 2REQB 4Y1RB 3SJAA 3RAEC 1BS2A 5K6AA 1PVDA 5CFOA 5H8WA 4BN5A 2QT0A 2XCUA 4GOJA 4LFBB 1O96A 3PNOA 4N18A 4OHZA 1GZVA 4GRDA 3GFPA 3ELCA 1Q44A 3K1JA 2QYTA 2CYAA 4WZBB 3CVUA 1QYRA 3A2NA 3FHCB 1H6AA 3U13A 2P9GA 2NZUG 1HDIA 5IC4A 1EP9A 4PTLA 3OQ6A 4D8WA 1JWBB 1PR9A 2XUHA 3L40A 4LNAA 4QQ8A 3VPXA 1BD4A 1CUCA 2B7LA 4AB1A 3WDSA 2VQ6A 4XM0A 3LIPA 3SMQA 2Y9PB 4KVGA 5G1OA 2MR5A 5F5NA 1WDWB 5JMOA 1DHRA 3ICOA 3B3QA 2JNWA 1OIXA 2QQ0A 1PR1A 4CODB 1QNFA 2ZIVB 4DIOA 2P90A 4KGDA 1G9SA 4OCZA 4DRXB 1SBCA 1JEYB 5AK0A 2NX2A 4K81B 1KQNA 5I51A 1CZRA 1WZUA 1LX6A 3DZHA 1K2VN 3LVQE 3RM3A 5IXJA 1UMKA 3KTDA 5KUTA 1RXIA 1D8TA 1SC9A 4BU0A 2TS1A 4BJ3A 4G5QA 1VIVA 3KHNA 5DJ5A 5T67A 3PNYA 3TF5A 5CCXA 2SNIE 3CCFA 2B4QA 2C07A 4XWAA 3VU9B 5K3FB 2P9QA 4CEIB 1RPTA 2J4FA 4OQPA 1KOJA 3W4KA 1W6RA 5B36A 3K0AA 4IYJA 2JHFA 5D7BA 1C3JA 3CKMA 1IJKA 4AG6A 4A91A 2GQ0A 3KKLA 3HZZA 2OAP1 4GLOA 1CC1S 2MCFA 3WK9A 5K3AA 1RRFA 2E4AA 1D9ZA 3QVXA 4JC5A 4R1NA 4TMKA 2HLDA 3JYOA 3C8ZA 2IOYA 3LJKA 4AJ4A 2C57A 4LZNA 1CSEE 1IAQA 4NZPA 4PGFA 3DAYA 5DT9A 3ZXXA 4L8GA 4EMSA 4KQ9A 4Y2XA 1JNXX 4YH1A 4W9RA 2Q46A 1K5PA 3JSAA 2WA1A 4XCXA 2A1TR 1RXUA 1UC5B 4O25A 4CEHA 3FVRA 3LT1A 4DSZA 5JT1A 3VOBA 5J2UB 3KVRA 4CLOB 1M1UA 1XRSB 2G70A 2C04A 2CF6A 2TYSB 1KH2A 4JROA 2HTFA 2O1SA 3C2QA 4MUNA 4KUGA 2Y0DA 1VQMF 5BRJA 1Z12A 1SBIA 5DMXA 3WL7A 1U43A 5GTDA 2YIMA 4BQEA 1HLGA 2B4KA 4ZO7A 2W6MA 3AY3A 3ZE2B 5C8XA 5KS2A 1JT2A 1KZ7B 3VKVA 1YRAA 1X8LA 3R6GA 2XNKA 4CIYA 1IRXA 1EFCA 1JECA 1VSBA 2CCKA 1YMVA 1I3LA 2GWHA 2PBRA 4XWWA 4YAJA 4Y1RA 2REQA 4Z0TA 1WX1A 2XDYA 3VYSB 5BV7A 1HH4A 2BKLA 3F6RA 3OZDA 3NWEA 3PDWA 2D0DA 1JIVA 3CZMA 4RQOA 1EWRA 2PGNA 4X8HA 3VNQA 3KX2A 3OU2A 1BFUA 3ON1A 1FTYA 2I1VB 2W2TA 4ZEMA 1ULHA 2YNMD 3I1FA 3I6MA 4MI1A 3OFND 1XN1A 3I9LA 5BWLA 4BVGA 1OAPA 2OC4A 1AHPA 2C9DA 5GOTA 3VSCA 1OB2A 3UJAA 1P2VA 4R9UC 5ICMA 1M5RA 1EVJA 1WXHA 4R2WA 2AE1A 3OPYI 1FP1D 5H0IA 5C8DA 5HUJA 4M9XA 3F6PA 1OX5A 4ID9A 2QY9A 4LXHA 4QU5A 2FZWA 4BLQA 5C1DA 4CV2A 1E2MA 1FB5A 1N2CB 4OSEA 1GL7A 5A6VA 2IPLA 4JA0A 3GDOA 4L9SA 1K4KA 3O3OB 2RGGA 1E3IA 1YULA 4D56A 3IB6A 3QW4B 4JA2A 4YV1A 5KSYA 4DRXA 1CIPA 4W9MC 1V1MB 1JEYA 1HO3A 2WNSA 1N0VC 2EFJA 1DAIA 4G84A 1G5HA 3DL2A 3DLIA 5EWJA 4ZVSA 2ECQA 5ALYA 5HZHA 3GFFA 5EIFA 5L6LB 3D3WB 4F5ZA 3DOEA 3M70A 4HRYA 4Y2SA 3K4QA 4BT5A 2A9KA 2NZVG 2LBPA 4EB3A 3HMQA 3LT0A 4MS3A 3B85A 1R8YA 4ZPXA 2HMTA 2VYNA 3VU9A 3GRYA 1XCOA 1ZMOA 4CEIA 1E9DA 1Y8AA 4DDMA 2HCBA 3O0TA 4JP8A 4LS3A 1A76A 4UJ5A 4HUTA 3ROTA 3S0WA 4YRGA 2YICA 1W0JA 2KE5A 3LLMA 4B3TB 1U9ZA 3B9RA 3DE0X 1Z8NA 2UYQA 3GA5A 4KPUB 2VJYA 1OBHA 3T12A 1FU7A 1M8KA 1WM1A 1JPVA 3KPWA 1P0CA 4AY5A 2H1LA 4DR7B 3COJA 2HHLA 2PXHA 3ZDQA 4NSNA 2FEAA 3IR6A 4RLFA 3A1FA 4PPGA 3NCHA 3M4SA 2QVXX 3VKFA 2JHCA 4TWAA 3AU9A 1NF8A 3VO9A 4QT0A 4B6JA 4C6SA 1PK7A 2JLYA 3AI2A 5CJPA 3LBHA 4DLNA 2XUJA 1QHEA 4MV5A 2PPVA 5M7EA 4NECA 1E1MA 1OCEA 3ZWNA 4AUEA 4E11A 3V4FA 3OI7A 4D0RA 4LQCA 4KSBA 1T6XA 2AWNA 5T4HA 2ZT8A 1THGA 4TKUB 3WJ7A 4WH0A 2EG9A 2AV6A 5TGDA 1JHRA 1JMKC 1V95A 5F7XA 1BOOA 1XEFA 2YJ6A 2IZ5A 2J85A 4FFNA 1Z2CA 3BJIC 3HCAA 3RHSA 2JGEA 1PL7A 1SQ6A 3FJYA 4US1R 3ZLTA 4XVRA 3LFHA 1KO8A 2WALA 3AM1A 3UB4A 2IT1A 4KXMA 2H52A 5A3QA 4HB0A 1EIWA 2YXEA 2MOKA 3SR4A 5JSHA 2GEVA 3MJ4A 4KWTA 2VSQA 2YN2A 4IG9A 4LOJA 2CEKA 2AEEA 2OFXA 5LDGA 3BSFA 1K1EA 3LP6A 2FJUA 1RZRD 5HXUA 2H1SA 2P35A 5KEIA 5CAEB 4LDQA 4M0MA 3RC1A 3C3AA 2BFAA 3PWZA 1QH8B 1U9IA 4ZQEA 1RBZA 5BURA 4V0ME 3PTZA 3R0VA 1YR1A 1UADA 3CCUF 1XV5A 2OGUA 2XIQA 1ADGA 2Z1MA 3ESZA 3NBUA 3QENA 4QYIB 5EWLA 3SZOA 5K9ZA 2GXAA 3O9ZA 1FUEA 3LWNA 1W3EX 2I8LA 3EXG2 5I7SA 3RT9A 5DIFA 2FMIA 3OZCA 2O06A 2F7SA 4KMSA 2HP0B 3CH5A 2CJYA 2QUJA 5LFAA 1V1MA 3O8CA 4M0UA 4R2JA 4L02A 1UBKS 4PZLA 4KITB 4X45A 2PANA 1QYWA 1TLLA 1QAMA 5LP6C 1T8SA 2FF7A 3KAJA 1E2JA 3MCWA 3P4UA 5FTJA 3T7CA 1HEYA 1BA2A 4G4WA 1MR3F 1MQ8B 2OY0A 3MXOA 3QXCA 3ZY4A 4XXHA 1VHDA 3TIFA 3ONVA 4X71A 2V96A 3KCQA 4QBGB 4PAOA 2GTIA 2IDZA 1M2KA 4RANA 1T8UA 4JZKA 3D54D 4Y8VA 1I4EB 3RSZA 3SSAA 4OYYA 2Q2VA 3OJFA 3BIOA 2I4IA 1ND5A 3DO6A 3LQKA 3Q1KA 4DANA 4PZ0A 4FOSA 4MRNA 4U2BA 4YYZA 2OGZA 1N5KA 2Z2KA 3QVVA 4HDAA 1REQB 4RKWA 4RESA 5H68A 4KPUA 3INGA 6Q21A 2B1IA 1Z26A 3JQFA 1MGPA 2EW2A 2MMGA 2WLSA 4BVKA 1QIFA 3I30X 2LZ0A 4IXNA 3QVJA 4N9WA 1NUHA 4IAOA 2HA7A 4H2DA 4TMZA 5CURA 5FYDA 2OMEA 4F97A 3CPJB 3CVVA 3PGKA 5JIBA 1DAPA 3JXEA 3R5HA 4J7UA 1Y8RA 4F6RA 4JLKA 5SZIA 2V8OA 1YRQA 2EERA 4Z1OA 4L6CA 4RC9A 3WOVA 3PGXA 5ECWA 4W4TA 4E1VA 4OKIA 1VIAA 4G4VA 4WDQA 5D7NA 3SZLA 1XAGA 1BKSB 5IDQA 2H1RA 1XPOA 4Q19A 1SHTX 3CEMA 4MLPA 1VP3A 2CDRA 4H1VA 1YTUA 4L6IA 1F20A 1P33A 3EASA 4ES6A 4NFYA 3LG2A 2QRVA 3IAFA 1FYEA 2ICAA 2VJQA 3HZHA 3Q6MA 3RIHA 3BF7A 3RRZA 4CUZA 5KB3A 2VDNB 3H4TA 2QEXF 5B3JC 1SQGA 2YWRA 2HVYD 3T7IA 4EA7A 4F3YA 1N5OX 1SXHA 1T9DA 2YV5A 3LFTA 3N6XA 3R7WB 4OX9Y 4U5QA 2G9IA 3ELUA 1NQWA 1T2NA 4R7TA 3T52A 3ULKA 1GCAA 3HU3A 4N7JA 5JNTA 2F6RA 3ZUPA 5CAEA 1G3UA 5CM2Z 2D6FA 1BMDA 1EVIA 3RVLA 1Q3HA 2IBTA 4PYJA 2B1GA 3NEJA 3TNDA 1VHJA 4J1TC 1V9CA 5ADWA 1YZKA 3RU3A 2GEDA 2FWBA 1U2ZA 1QGZA 5COQA 1IQPA 3CE6A 2QUAA 4CDNA 3UWPA 5K0SA 4CF6A 2B99A 2OE2A 2O6HA 1VJ0A 5I9LA 1DEXA 2CXRA 1GO0A 3E22A 3Q0EA 4MVWA 4ZO8A 5BV8A 4ESVA 2HP0A 3B1ZA 2AMLA 2OO7A 3A4IA 5BSWA 5IFKA 3EVZA 2GPNA 2AX4A 3PITA 5HBGA 2H4JA 3IHKA 4Y1GA 3U80A 2EF1A 1KTVA 1JJVA 4RZHA 4Y2RA 5DRYA 4E4RA 1V5IA 1YH3A 4D3XA 2FV8A 5D2CA 2ZRQA 1BA3A 1WDTA 2C4VA 3JASB 1XZQA 4RZSA 5ALQA 3WQHA 3O26A 1KEKA 1BWPA 4EHBA 4AJEA 2AG0A 1J1UA 4P82A 2Y68A 2WNIA 3T1QA 5GAPK 4D9KA 4EB0A 5BV0A 1P2DA 3CNNA 3EULA 5K3DA 1IMOA 5GV7A 5DLYA 4YRSA 2K1SA 1F2TB 1SVWA 4OXQA 4F3CA 2ECOA 1GARA 4NQRA 3ORFA 2FCAA 5IEJA 1KZ4A 5AKKA 4DLBA 4EA6A 2QXUA 2WJIA 1H69A 1ZPDA 5BV2P 4NFHA 1IB0A 1JKFA 3PDIB 4P36A 1I7DA 3HCFA 1OZFA 2EARA 4YJ2B 2DUJA 2FFBA 3FF1A 3WBJA 3RYFA 2IEAA 3QF7A 3TH5A 3QFRA 1O54A 4M54A 4XGQA 4MRMA 1LH0A 4ZANA 3ZD9A 3MXTA 3P9ZA 1UMCB 5GJBA 3DZJA 1EX9A 2G36A 5L7WA 1SCKA 1XEAA 2E4UA 1RAFA 5A4AA 1JLHA 4K6HA 4W9NA 5IDXA 2ZUFA 2PKRA 4CBVA 3MJEA 1QHXA 2I66A 2ZVJA 3KT0A 1OD6A 2L19A 4UU1A 4A82A 4KQCA 4BV2A 1PGPA 1EVLA 3IVXA 3FPCA 2FSVA 1XALA 3MLBA 5EKUA 2C94A 1F06A 3B3AA 1YHNA 1ZMRA 2YXLA 4PSKA 3E03A 4TLAA 1NJFA 4DCPA 3UWSA 4NJMA 2X0DA 1G3MA 4A8HA 2BMFA 3R7WA 1OTYA 2FGYA 2J9ZB 3L1VA 3MJSA 1C9JA 1K66A 3FNIA 3Q5GA 4Z99A 2CJWB 4M0DA 1N0WA 3SD7A 4U39A 5LQJA 4LPKA 2YYAA 3CVYA 1VQ5F 3CMAF 5F9FA 3DEYX 4JX8A 4J90A 1IAVA 1NTOA 3CURA 3I4CA 2RH9B 3A1UA 1PNQA 5JARA 2Z6AA 1JIXA 4R2XA 4P5EA 1Y42X 2C2MA 9LDBA 2H8CA 1ZH0A 2CFRA 4AZTA 1MDFA 2GSWA 1YBMA 2VDRB 1DBIA 2ZT5A 3KBOA 3PR2B 4MQEB 4XX0A 4LY6A 1KDPA 1GA6A 1TJYA 2NPOA 1EFPB 2Z1UA 1BXGB 1G42A 1HZZA 3AY7A 3LK6A 1A5TA 3F3SA 3NBFA 4JFAA 1ZAYA 4LXTA 2XCQA 4GR9A 3SM9A 3EFOA 4BBJA 1XI2A 5B58T 1JEOA 2WABA 1U5AA 3HCPA 4G4IA 3E81A 5ES4B 3I1YA 1N9GB 3DE1X 1R6VA 2NO7A 4O0LA 1JTVA 2FX2A 2C0QA 4QTXA 2NT3A 5G40A 3EN0A 4I3HA 2IF2A 3T3IA 1M2VB 2KTVA 3JD3A 4NS1A 4E03A 2B35A 4YR9A 3JASA 3PPYA 4D0SA 4RKRA 1QORA 2A3RA 5AVSA 1T2EA 4HPWA 3N0WA 4N3BA 5D5PA 1MJ5A 1YVEI 4JBLA 1LK0A 2XHZA 4CMCA 3WAKA 4Q4JB 3RKRA 1GUFA 3M4XA 1GTZA 1KDTA 1F2TA 3G6KA 3QY0A 2V98A 3K6SA 2A5LA 1XZCA 6PFKA 4IIGA 3SR0A 4N0DA 3GFBA 3IOEA 1A5SB 1JDZA 4G26A 4CL3A 4YUXA 1I3OA 4E5DA 4FMPA 4IJ6A 2IIBA 2X8WA 4HYTA 4NV3A 2C8LA 1JG4A 5L95A 4XQ0A 4YJ2A 3LD9A 4EMTA 5FUVA 2C5HA 1RXVA 4EHKA 1SD5A 1EAYA 1VHAA 5DISB 1EQAA 5G4VC 3JALA 1YB6A 2H63A 1R9GA 4BX0A 3LDTA 2PZBA 3IDOA 3UCEA 1CR6A 3VR4A 2IYNA 3K8ZA 4OXXA 1EHIA 5DM2A 4CM6A 3HR7A 4XD2A 4DCTA 3DMFA 1XQVA 3P9SA 2W2QA 3TR6A 3QKSB 3OTIA 4ZQHA 4WK2B 3DE7X 4F4IA 1BH2A 1XTPA 3I55F 4KQXA 4RYDA 4AECA 4UTNA 5DNAA 2PLWA 3DAHA 3FM9A 3IR9A 3TRJA 4UU7A 5CFZA 4EZIA 1KJJA 3LUHA 1EGMB 4YREA 4DPLA 2G5GX 1RWPA 1Q1BA 3CH7A 2C5FA 2Y0BA 3QKWA 4PTYA 2PKEA 4XE5A 2QI9F 5JSQA 1TDJA 4DNFA 3KYJB 1K92A 1A2QA 4MYUA 3WK4A 2D8MA 2XAAA 2NTYC 4JITA 1P7VA 1SOUA 3H87A 4LWZA 4QM6A 5E3JA 2ZVZA 4TS3A 4C2TA 4HAZA 1BWSA 4GZMA 4OY3A 4PW0A 3EOZA 5BNFA 1VPDA 3FUTA 3HO8A 3K5PA 4D8UA 4D9JA 3THWA 1FJXA 1QP4A 1A98A 3FDIA 4MW6A 1Y8QB 3VR5D 2ILTA 3VPCA 1Z75A 3BCSA 1O95D 3QLEA 1M2FA 1WSDA 2OCLA 3RC3A 1Q7GA 2DWOA 2OBYA 4V1CA 2X0KA 5G41A 2ZFUA 2O4UX 3G7UA 3JQ9C 1RACA 3EAQA 4LK3A 1TNDA 4MQEA 5FBZA 2R5FA 2FFAA 1P18A 3BE4A 4FLFA 4JKYA 2OFPA 1BXGA 4JAVC 2UUPA 2X13A 3L0OA 4LE2A 4RZIA 5ABPA 3NOOA 3AUKA 3T5GA 2EYQA 1QG2A 1JFLA 4FR2A 1KWGA 1MA0A 1XCMA 1NN3A 2RHLA 1DKRA 4HG2A 1G1MA 4IIFA 2GAFA 4XGIA 1N9GA 4PANA 3HUTA 4YRFA 4D8XA 5JYCA 1YD7A 4ZAXA 1IBKB 2HXGA 1PJLA 1V1JA 2C1ZA 2CMDA 4HGZA 4B6FA 4HJRA 2O2EA 4EUEA 4LBYA 1FEZA 1AZSC 6REQA 2WK1A 2AR7A 2CN1A 4MUYA 3CT4A 1PWEA 3FBGA 3QOYA 3PYLA 5AI5A 3WTCA 1VRWA 3Q9NA 3DW3X 5IFLA 4MDFA 4R9RA 3RU9A 2FEMA 2BTQB 3SZ3A 5DKFA 4C14A 1GRRA 1YDGA 4IMRA 2VKTA 2C4MA 1U8CB 2DTDA 5EGSA 3IP9A 5FBHA 3QVWA 1NXXA 3L4JA 2V7BA 3EDCA 4NXNB 3B8EA 2VDPB 3IP5A 4KHZA 2A9OA 3VUFA 4FYXA 4RDXA 3Q3EA 3S4YA 4AM8A 3ZHBA 1MAAA 2BBSA 2J9GA 5J4HA 4NE2A 3RREA 4YT4A 4WXHA 1QRAA 1I1NA 1I7LA 5F9MA 5J47A 2HV8A 3G2LA 3H0KA 4YJ3F 1GFIA 2W4QA 1PLKA 5ALGA 5KTOA 3O2NA 4L7QA 5EI5A 4GF5A 4BX2A 1N3IA 5K09A 1OXVA 2J3JA 2I22A 2XOXA 4DADA 3PFIA 4ZI3A 3G4SF 1E61A 3EVGA 4OKNA 4RVFA 1HFEL 4KK4A 1FUIA 3NIDB 4RHUA 1AVTA 3VA7A 4ZTUB 2BELA 4ATNA 2BHLA 3E82A 1XA3A 2OCYC 2X9NA 3A9SA 4XDZA 4EYOA 1ISHA 1GT91 1OV4A 4XB1A 3P5BA 2BM1A 2OC9A 5D3KA 1KQSF 5JHGB 3SIXA 1NXVA 1OLUA 2JASA 3FPSA 4UE3S 2P9FA 1CZHA 1W4AA 2W6IA 4JJGA 5C18A 4DYVA 3VPHA 2MYPA 1QQTA 1IHYA 5BQOA 4NMXB 2VH2A 2ZVDA 2AR0A 3KG2A 3EIQA 4PNZA 4CIXA 1EG7A 3E2IA 1ZM7A 5KQLA 4J2OA 4CTNA 1R0WA 1OV6A 3LI2A 2R96A 2RAVA 4AN1A 3WL4A 1K0FA 4CQNA 1EFUA 3DMTC 3EUFA 1IDOA 4IYRA 1U2RA 3EMBA 4H7PA 2I6SA 2FMXA 4M1YA 4RS3A 1CDEA 2GEKA 1LJ8A 1J2JA 2C8JA 3ONDA 4G01B 3LFOA 2IYLD 1FRZA 2OVFA 1GP2A 2R1VB 4BCCA 2JFOA 1J0DA 4KE9A 2W2OA 3F78A 2HIHA 3QIAA 1EA7A 1X1SA 2OYSA 3PEWA 1Y3HA 4ZO4A 2E21A 5KHLB 4F1WA 2R6GA 4FFDA 4MTCA 4EHIA 4KLCA 4EL0A 2X15A 4L08A 5JISA 5ICSA 4GECA 5C53B 2YOGA 1FDTA 1HWYA 1L4GA 5EZ6B 3NB0A 1AT1A 1HKHA 3EEFA 2IXGA 3UPDA 4DG8A 3OX4A 3S40A 1K2WA 2G17A 4LYAA 5KVSA 2B33A 1XDBA 2FQXA 1B74A 3DEFA 1KY3A 2ATCA 2V7EA 3ICVA 2AEFA 2BFBA 3MD9A 3SHVA 1U8YA 4R1UA 5HS6A 4DFDA 2YDYA 2CLIB 4FM9A 4TRNA 3TTUA 3BSYA 6CHYA 5JQGF 2Q4RA 1AKNA 1LPSA 5CPBA 3USZA 4HBZA 3DA8A 2ZJ2A 1RYEA 1NBMA 2VLIA 2SKDA 3JZFA 4KLNA 1K9VF 3E7PA 3QJYA 1OXXK 4ZT5A 1PV4A 1NF3A 4JLBA 1RP1A 3CC4F 1P5FA 2CVHA 5M3BA 3H16A 1F5SA 2XWQA 4K9MA 1MDBA 1PJSA 3GWGA 4V03A 1X0XA 1WUYA 4Q48A 2DFKB 4BXOB 3AKCA 5HFNA 3EPLA 3QKUA 4PNHA 3IEQA 4X61A 2HLPA 4MV9A 3I28A 2WJ6A 3C6QA 3CTPA 5LQUA 5IRCD 2UYCA 2RHCA 3SDZA 2V7UA 4ETWA 5HP8A 1TOAA 3I4FA 2WF7A 2CZQA 3I64A 3QUCA 5ADHA 2FZ4A 1E9EA 3NWBA 5EPUA 1CYDA 1DMSA 2EBFX 3MTQA 1UPTA 4QECA 4QOGA 1AIPA 3ZY6A 2UVPB 2KMLA 4RY2A 2IU3A 3DL7A 3S2ZA 3EPKA 4BB9A 1MC8A 3R5KA 4XIFA 2LRHA 1YRYE 2R86A 2G5PA 2WMYA 4ZHVA 1QZZA 2H1FA 4M9QA 4MDHA 4BLSA 5DTQA 3MUEA 7YASA 1NQ5A 4X66B 1WMAA 1E2FA 3TDNA 3EORA 5I01A 2P78A 2FN8A 3QLUC 3BKXA 2VAMA 2UUBB 3EZGA 4Z9FA 3WBFA 4BNDB 3SHFA 4DLWA 3QNWA 4KG7A 3G89A 2PZJA 3NORA 4EEKA 2B21A 2BP7B 1IHUA 4A03A 1UP7A 4M1TA 1TCBA 2P69A 4MR7B 2XX3A 4BJ5A 2HRQA 1LBSA 1FFSA 2D8AA 2FFQA 2QN2A 3AJAA 3BPSA 3L8YA 4LVCA 1QHIA 3DAOA 3FLBA 4KE8A 1SA0B 1IC6A 1H48A 2R6FA 1RAEA 3HBFA 3K31A 4JXKA 1BN7A 3ELYA 4NV0A 4WHMA 3R0XA 3S2UA 3ZX4A 2WSMA 3KOMA 2WSYB 4UBJA 4B6SA 3U1BA 1O9HA 3IXLA 4M22A 1YKFA 5IJ9B 1CU1A 2R1VA 4GMFA 2QTCA 2OD2A 3B20A 1X1EA 2ECFA 5H5JA 1B6RA 1FNSA 1Z35A 2G88A 1XZAA 2XOKA 1D2MA 3ZZ1A 4DREA 2IE8A 3FOCA 1LQUA 3JQ8B 3LH5A 3MAAC 4H9GA 3FDZB 4OHYA 1JB9A 1Q1NA 4TTJA 3WJ2A 4KYIB 4CL8A 5EJ5A 2Q3BA 3PIIA 3HP1A 2W9XA 2IRWA 1KVRA 2JVIA 5BSTA 3E35A 3L1KA 3IBSA 4XLZA 3DCNA 3W4IA 4CF7A 3QE2A 1QFJA 2JFUA 1ADJA 4JYPA 1TB4A 4BKMA 1T0AA 4ABTA 2AFIB 2FQWA 3EXEA 3OPMA 4GM4A 3GELA 2F9ZC 2AMYA 2ACWA 1VPTA 3WDKA 3U44A 4NZNA 2WE7A 4JDPA 2CXHA 3L8FA 4PLFA 2G1JA 2NP6A 1DWQA 1THZA 1DE0A 4N5LA 3UCXA 1TEVA 3FSRA 1KSFX 4FOPA 3ZE6A 3DTVD 3V9PA 3WWCA 1GV0A 2CHFA 1AKUA 4EJSA 2D7CA 2F1HA 2HX1A 2IH4A 1YOBA 1SHUX 4WXRA 1A88A 2OKGA 4QXRA 3QX7A 4PAMA 4KR3A 3KD2A 3KZNA 2YVUA 5CMLA 1YCDA 2GWRA 4MO2A 4ZHQB 3E1YA 1MENA 4FLEA 4C6TB 4K9DA 4MJ3A 5EQDA 1XROA 3UATA 3I3OA 3CV3A 4EMBA 4YP7A 3WYEA 1UDBA 2A58A 2XGSA 2H0RA 4OBEA 3DB2A 1EUYA 4ZAYA 3IQZA 2BR4A 2XW6A 3BFJA 3HKDB 2RBEA 1UWCA 4U1RA 1V45E 3H2BA 3UOWA 1ORWA 2QRPA 3KOUA 2UVPA 2BYTA 4R16A 3UAZA 2QQFA 4D0GA 4MKGA 2H4HA 4X7MA 3AZQA 3V7QA 1VE9A 4MW7A 2Z2ZA 1ZU5A 3IUNA 5EFOA 5KWIA 3SX2A 2WJZB 1RNLA 3PGA1 3EG9A 3H5NA 4OU4A 1LNSA 2A5DA 2PAFA 1VHWA 3HSYA 3QRWA 4G56A 3TQFA 3UJCA 5B5SA 3E8MA 2JLVA 2FOIA 4R41A 3EPJA 1X1AA 3D3EA 4B40A 3SOZA 4CF3A 2H8GA 1QXSA 4HDCA 3KTFA 3CG4A 1PEDA 4I1RA 1WCXA 3OEHA 1FE8A 1PX2A 2EGGA 3ZP7A 3NXKA 2BP7A 1VQOF 2GEFA 3RFTA 1T25A 3TTTA 3GFGA 2NQ2C 4R98A 1JLLB 3ZXYA 5JFOA 2H11A 3KQLA 1Z6QA 2XSZD 2D7JA 5LBTA 5C1OA 5I7UA 3MWEB 3A4YA 3H18A 1QP8A 1TA4A 3ICEA 3F0DA 2Q8QA 4MGKR 2RI0A 2VDWB 3RS8A 1GG8A 3Q10A 5IAEA 2COKA 3F98A 2OCGA 4R83A 5FL7D 3JQ8A 2PKCA 3BXFA 4MHOA 3RVQA 1G18A 4II2A 3IP8A 4UHEA 4V3BA 1DTSA 1U1GA 2B0CA 5K8LA 2PTHA 2FWMX 2PZFA 2QSZA 3GPIA 4HQFA 3CPHA 3OJLA 2H8KA 3RKUA 4BLVA 4EFKA 4Y6LA 3C1UA 2RGNA 3EUEA 1TGVA 4OQQA 4LG1A 1QZTA