2RHLA

Synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
305
Chain Sequence
b'ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 101
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhlA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhlA01
1SA0A 5IJ9A 5LOVA 5ITZB 4X20A 3JASA 3RYIB 5J2UA 3HKEB 1TUBA 4ZI7A 3JALA 5IYZB 4DXDA 5CB4A 5LOVB 3RYCB 3ZBPA 4XCQA 5LA6A 5LYJA 1W59A 4EB6B 5IJ0B 5KX5A 3WGNA 1W581 4TV9A 3HKCB 3WGMA 5JH7A 2Q1YA 4DRXB 3HKBA 1FSZA 3E22A 3JARA 4HNAA 4O4LA 5EIBD 4F6RA 3ZIDA 3UT5A 3JAKA 4YJ3A 3C8LA 5M7EA 4WBNA 4ZHQB 2VAWA 5FNVA 5J2TA 5LP6C 4F6RB 3E22B 4O2BB 4O4LB 4U39A 5ITZA 5EIBC 1W5AA 1Z5VA 3RYIA 1FFXB 2XKBA 3HKEA 5IYZA 3RYCA 3HKDB 3VO8A 4LNUA 5LP6B 4EB6A 4O2AB 5IJ0A 2RHLA 5EZYA 4KWEA 2RHHA 5CA0A 3HKCA 5MN4A 3WGLA 4LNUB 4EI8A 4X1YB 4DRXA 5MN6A 2BTQB 5EZYB 5LXTB 3RB8A 5CA0B 5CA1A 4ZHQA 4O2BA 4O4HB 4B45A 1RQ7A 4IHJB 5CA1B 1OFUA 1W5BA 1FFXA 1Z5WA 3ZBQA 4EI7A 3HKDA 3WGKA 3N2GA 4O4JB 5LP6A 3VO9A 4O2AA 4O4IB 3RYHB 4I55B 3WGJA 2RHJA 4X1KB 5JCOC 3N2GB 4X1YA 4I50B 5JVDB 2XKAA 2BTQA 5LXTA 3RYFB 1JFFB 4E6EA 3M8KA 3VPAA 2RHOA 5EYPA 4O4HA 2Q1XA 5KMGA 4IHJA 2VAPA 5BMVA 5JQGB 3CB2A 5EYPB 2GVIA 2R751 2VAMA 5GONA 3JATB 4TUYB 5KMGB 4M8IA 4FFBA 5BMVB 4O4JA 5C8YB 4O4IA 3RYHA 4B46A 4I55A 4TV8B 3N2KA 1RQ2A 1TVKB 5GONB 3VOBA 4YJ2A 4I4TB 4X1KA 3JAWB 4FFBB 4I50A 5J2UB 4U3JA 5JVDA 1W5FA 3N2KB 1SA0B 4YJ2B 5IJ9B 3RYFA 1JFFA 1RLUA 4X20B 5MN5A 3JASB 4ZOLA 1W5EA 4U3JB 2R6R1 4ZI7B 1TUBB 3JALB 5CB4B 4X1IA 4IIJA 5JQGA 5JCOA 5LA6B 5LYJB 2VXYA 4ZOLB 5KX5B 3JATA 4TUYA 3M89A 4TV9B 2BTOA 4X1IB 4IIJB 5JH7B 5C8YA 3HKBB 3JARB 4HNAB 4TV8A 1TVKA 3UT5B 3JAKB 4I4TA 3V3TA 4YJ3B 3JAWA 3VOAA 3R4VA 4WBNB 5FNVB 5J2TB 4EI9A
chains in the Genus database with same CATH superfamily
3QUWA 2D5LA 4TT3D 5AHXA 1C50A 2O2XA 3ON5A 5KJ1A 1OZFA 4PZCA 3TFQA 4DTCA 1EFAA 3N58A 5KNCD 1AZSC 2EBFX 4LX8A 1G0NA 4BVTA 3LQRA 3N39C 2I62A 3LK7A 4U2DA 3ZJ4A 5CIYA 4Q4HB 4C0XA 2P6MA 4DR4B 5GVSA 5HIKA 1P73A 3QXCA 2QMOA 2YOGA 1MO5A 1HNXB 1MAAA 4ZD6A 2R85A 4CIYA 1QBGA 2GAJA 3UMJA 3W5JA 1M7BA 2EX0A 2QLMA 3IP5A 4NXNB 5AH0A 4KLCA 1N5RA 2DFLA 4OXXA 3T4UA 2R60A 1V96A 4TMYA 4ZRDA 2C61A 1DTEA 5AFSA 3MRSA 5IPFA 4B82A 1KNXA 3BRCA 1CB7A 1VGVA 3OY7A 1JDBC 1GQSA 1Z6XA 5ICGA 3TRHA 4CKBB 5C8XA 3DFFA 1EYZA 1ILEA 4AS1A 1A4IA 3DYBA 1T4BA 3R0PA 3LFTA 1IXKA 2Z8YM 3SJBA 1YS1X 1CLIA 2JAPA 3Q3JB 1U7HA 2POQX 5JS8A 3N2NA 4Z4FA 3RFXA 4Z4IA 3DBHA 2RHLA 3ORRA 4WZZA 3M3HA 3V1NA 1D4ZA 3VSAA 5AHKA 4MQFB 2H7XA 2BSXA 3GFOA 1PN3A 3KE8A 2H7YA 3CF4G 3BXEA 4QYTA 1KBZA 1QORA 1UFVA 1TVCA 4JLPA 4N3GA 3A3KA 2QRHA 5G0SA 2QD3A 1PJ3A 1UMDA 2PR2A 1I6LA 1MQ9A 4QNMA 4JJ7A 5B53A 1HH4A 2VPYA 2A78A 2Q4TA 2BPOA 2E3JA 1O8CA 2GM9A 1Y8RB 2X8WA 4GMFA 2CF6A 5FOWA 1IEQA 2G72A 4HYYA 4NENB 3WIVA 1OLXA 2FX5A 4QDZA 1F0NA 4H7FA 3ZHSA 3R5SA 2C3PA 5TRTA 2ZSKA 3PF8A 3AVPA 4RD6A 3PEVA 1GKUB 1YB6A 3EC2A 3KQWA 4TVBA 3VPXA 1RMYA 4MAMA 1CZRA 5FL7D 4B32A 3GZNB 4OP2A 2YXPX 3F4BA 4W5QA 2PH7A 1XTTA 1H47A 2BMFA 2IYNA 3ZU3A 4EM6A 3NV7A 4TZKA 2K5UA 3RSFA 4DSAA 5DHUA 1AHNA 4GOOD 5G4KB 2W6MA 3D1LA 3VM6A 4AIRA 2D7JA 3RRYA 1PWYE 1ISRA 2VUTA 3K2QA 2VOEA 3CPJB 1FTWA 3LT5A 1LBIA 4NDZA 4URFA 5EOVA 5SYAA 3SI7A 2KBFA 3NDPA 4KX5A 5CR9A 4B46A 3I0ZA 1IMOA 4JBHA 4JQYA 1T25A 1VPVA 3BRSA 3H4MA 3JAWB 1XVVA 4W82A 3GLHE 4Y2HA 3UAYA 4EG1A 3ZLJA 2BISA 3NWPA 2CJWB 5A2QA 1WCV1 1W6RA 1O54A 1PJLA 1EK2A 2W5UA 3HG7A 2XMGA 4DW8A 3RSOA 4X20B 4EJ6A 4ZK7A 2EL9A 3H87A 2R6R1 3RKRA 2ATCA 1FA9A 1CZLA 4OBBA 2GDZA 4WNAB 3ODPA 2X9NA 1U3CA 2ZT7A 3UAOA 1AO3A 4C7XA 6PFKA 1EWQA 3EXEA 1B0AA 1E2JA 3MCVA 4MUXA 4BNLA 4FOSA 4L8FA 3B70A 1LBHA 4KQWA 4TLLB 1B6RA 4JOBA 4MCHA 2DWCA 4F3NA 1TGYA 1GPUA 2P9BA 5HDBB 1CDOA 2RB4A 2OHXA 3ABIA 4JN6B 4NJEA 1RKUA 4R9NA 3VH4A 4AECA 1TOAA 4HGOA 5EJAA 3F73A 2VDLB 4U5XA 1GAXA 1KS2A 3B3QA 2I6TA 4ZYLA 3O9VA 5EUQB 4G1FA 4L4RA 1XEFA 1SA0A 2I71A 1P8AA 1OXXK 1P2DA 5F9MA 1SVLA 4D42A 3VU1A 4C0SA 1VCMA 1BKSB 2QGNA 2KTUA 4KE7A 3EDCA 4WCFA 3RS7A 3AF0A 3FB1A 3IPCA 4H4CA 1OWPA 4POOA 3CW2A 1PX0A 3T06B 3VZQA 2YJ4A 1XAJA 4U0KA 5DGTA 3ZHVA 2IIBA 4WD3A 2QUIA 2ZJZA 3HKCB 2Q0QA 4ZN6A 4JV5B 4QQKA 4DRXB 3UXYA 1MN6A 1ORRA 2AN9A 2QX4A 4DMKA 1BOFA 4R1MA 4QTTB 3F7MA 1J2TA 2CLMB 2QF7A 1WDKA 2LNDA 2Q6KA 2VWHA 4H7DA 3QPUA 2FGJA 3V8PA 1H2ZA 3HMQA 3PHBE 4XE5A 4D0RA 3EH1A 2Q8NA 1CR2A 3PV0A 5FUQA 1EP1B 3V7UA 1FMFA 4KIWA 3ZV5A 2CHQA 1ZOSA 1DP4A 2QZZA 3CX7A 4JHLA 4BGIA 2PKWA 3CWCA 3EDYA 2VPPA 4OM8A 1ACJA 5FWXA 2E18A 2IODA 3U81A 3TO5A 1NOIA 1UR5A 2L17A 4ZT3A 4D3FA 2JLAA 5DYGA 5L51A 1N7HA 1MRZA 2VEOA 1A4UA 5GOTA 2PMFA 4AJJA 4GYKA 3I6IA 4I50F 1YD7A 4C30A 2EATA 3ICQB 4FDAA 4BP8A 1BX1A 2GCIA 2ZQZA 2DX7A 2CJYA 4NEQA 3PHJA 4QM7A 5LR6A 4GVXA 5EJ6A 2YV1A 3MERA 5G2OA 2QN3A 4KZPA 4O2RA 5IKOA 1LWOA 4UM9B 2GA9A 5L4SA 1FDOA 1U4NA 1ZCZA 2GD1O 4HGNA 4J6EA 1NN1A 4DIKA 4O2AA 1KIMA 1U8CB 2PGXA 2YN4A 1DV1A 2JGNA 3B9RA 2HTEA 2X40A 3EZ9A 1UBUS 3GXBA 4NZMA 4TPKA 3WZ2A 4MVJF 2FJUA 4DM4A 1QH0A 4AULA 5J47A 2RMKA 2WU3A 3LSYA 3E5RA 4C7BA 4PQEA 2OCLA 1S7CA 2NGRA 5MGBA 5KMGA 2J9XB 3GO4A 5HJEA 3PXCX 3ORYA 1PVVA 1KMHA 3MDOA 1L4BA 2G9VA 4RK1A 3FDIA 3H2YA 2PNJA 3TW8A 1YUBA 4KR7A 2MJLA 2RHGB 4XDZA 5G1PA 1JKJA 1H0KA 2ODNA 4Z6KA 1MB4A 1RKXA 4WESB 4ZO8A 4EY6A 2FKNA 5JAMA 1YFZA 1X80B 2XE8A 3D9QX 5ALJA 2XEXA 5EG5A 4AS3A 5B4UA 4HB2A 4DUYB 3N0RA 2GCPA 2V03A 1G59A 2CD7A 3PUKA 4LC1A 4EEKA 1M8KA 5ECGC 1L1EA 5BW6B 2PV0A 1Q0QA 1GU1A 1HM5A 5DCVA 1CRWG 4B3TB 3FCOA 1H22A 3MIZA 2I6DA 2DHQA 2GFIA 1OLOA 1YOVB 2G0TA 2D13A 2ZUSA 4G5GA 4OH7A 4DBLC 1UJ2A 1H6AA 1PZFA 3DDZX 2FZCA 5C8YA 3DW3X 4WFQA 2GEDA 4I5DA 4L5YA 4YCDA 3B1JA 1O95C 3MHTA 1A04A 4PS1A 1T5IA 3W34A 3B3AA 1BEEA 3LVQE 2Q9CA 3GHYA 1VHJA 1ZUNB 2JAHA 3E20B 4CL2A 5A7GA 1QLJA 1C9JA 1PFYA 1J33A 3CUYA 1QWSA 3KD3A 2GHQA 4ZI7A 4A92A 2ALEA 2P9ZA 3ZZ1A 2HIMA 3FR8A 3GG9A 3IE1A 1QCZA 3HDQA 1WABA 2EF1A 4BT4A 3LZDA 1FRNA 4PNZA 4OHCA 2RAPA 1FNCA 3FHOA 2OWEA 4PG5A 4BT7A 5L3RA 5CFNA 1V9SA 2NTNA 4PBRA 1TZJA 4HAWA 2PFGA 4B73A 1O9HA 4D9NA 3WYCA 4TT8A 5A5VA 1OWNA 1ZD2P 2FG7C 5CFPA 2GN4A 3R09A 3ILYA 2Q3HA 1NJ1A 2UKDA 4JFAA 5GJCA 3AUSA 3IPAA 3A4MA 9MHTA 3DUFB 3WLQA 4JI4B 3OCCA 5FF9A 4OLJA 5JE8A 4M98A 1CY2A 1GPWB 4RHTA 4PGHA 5DBFA 1RZRA 2FFRA 3SIRA 3MJDA 1XLUA 5FBRB 2JGIA 3EDMA 3WB0A 2PMBA 1UF9A 2BUCA 4V38A 2O2GA 3UAVA 4HNRA 4UM9D 2BC9A 3R0ZA 5KOHB 1ZD3A 1ZJWA 1BYIA 4MAFA 4NBSA 1TQ4A 1W35A 1QSGA 3OPXA 5AHWA 5J5AA 1LSUA 2FN9A 2JFNA 2K2QB 3OTWA 4PTZA 4DJJA 1LX7A 4A8TA 1GM5A 1JPNA 3H1GA 3ID6C 4N6OA 4BFTA 1QHEA 5AI0A 2XNHA 3KWFA 2C8LA 1C2TA 3DWIA 4KNVA 2EBWA 3O2QB 1ZWKA 4D9EA 2BGNA 3MGAA 5IEBA 4MVJM 1PQWA 1XZBA 1YU6A 3T61A 4I9UA 1X15A 3GMSA 2NN3C 1RYDA 3SQWA 3TNLA 2HREA 2DWQA 3VZRA 3WFJA 2FDXA 5FPYA 5LKRA 1G5PA 4U7TB 1XD9A 1DIBA 1RZUA 4A0QA 5KKNB 3NWEA 4YMWA 1I6MA 1XJCA 1W4ZA 3PEEA 3B2EA 4YRDA 1HZZC 1UIRA 2Q5OA 4UVDA 3WGJA 3CHYA 3G5LA 3WRWA 4AJ4A 2RI6A 4DQVA 4POAA 3GOHA 3K5WA 2FQ1A 1EM8A 4R68A 2W93A 1IFXA 3OZSA 1HKUA 1NURA 3K1TA 4UEWA 4DLZA 4YV2A 5K4HA 4N5MA 1JLRA 2EZ4A 3OU2A 1IV2A 3RTCA 4B2IA 4IFEA 3ELDA 4N8EA 2EJUA 2J6CA 5FP0A 2JGLA 4HMQA 2IUFA 1RDFA 4N6GA 2H7VA 4Z7JA 2C7OA 3K1AB 2IOFA 3HE3A 3O92A 2IVZA 1JJ7A 3FCUB 1NN0A 3PA6A 5DNUA 3M1LA 2FSVA 4UBKA 5G4UC 2YXLA 3W5UA 4QT4A 5BN5A 4CVNA 3KYJB 1AKTA 3MS7A 3O8DA 4Z3DA 1Y5MA 1MX5A 2F64A 5AKYA 2F9LA 2AR9A 5A3SA 4CGZA 1K8XB 3A2LA 4K3UA 5B2ZA 1E3EA 1A71A 1O97C 3IAS1 1HX7A 2V96A 1D2EA 3PGA1 3ZO8A 5AXCA 3WK6A 1W4RA 4Z4HA 5B64A 1DUSA 3AERB 3FHJA 4LDAA 3W5CA 1GZ4A 4BQOA 2H2DA 1ZOOA 1ZOIA 5LA6B 3KDAA 2I2DA 1N6RA 1PEYA 4A1FA 1L8QA 1E8MA 2ZB7A 3VTZA 2C83A 3K96A 4N5IX 2R5FA 4MYSA 2H9YA 3RUPA 2YHSA 2RK6A 3WL3A 1VOTA 4R2IA 1SUFA 2WJZB 5FBVB 1GCIA 1OLSB 1V7CA 2B2CA 2I7DA 4PRZA 1OILA 2BHLA 4HP8A 4C0KA 1V2GA 4DA6A 1I5OA 2VT7A 3HU5A 1RM3A 2GT1A 2PQ0A 2CL5A 4JLUA 5LOVA 4IO1A 5K9ZA 3UV6A 1NE2A 4CKWB 1N92A 1YZQA 2PZEA 1X1RA 3A1SA 1K9SA 1BMFD 2QMUA 3HSKA 4OQQA 3WHKA 2JIRA 4CNQA 5JXIA 3TNYA 3HM9A 1OB5A 1O2DA 4KIGA 1USIA 1NQ5A 3K9LA 3QH4A 2OECA 4HEQA 2J59A 2X0FA 3ZHYA 4PXAA 5DPMA 1X7YB 4WW0A 4D8YA 3WGIA 3WMFA 3E1SA 1SOVA 1BSVA 5HS4A 2IYEA 5K6AA 1KP3A 1M75A 4YECA 5IAOA 1E60A 3HKBA 1OYVA 1ZNZA 2IZ0A 2AOTA 4R1QA 3TR6A 4F11A 2AHOA 2JAWA 2KM1A 2NYUA 1O9BA 1TQ2A 1VTKA 3JQ8A 3MRXA 2YWRA 1BFKA 1NUUA 1YDHA 4TLEA 5I7OA 1E9RA 4PZPA 5TX7A 1DIGA 1Y7TA 1ZIYA 4NEHB 2NTEA 3WJ1A 1RMQA 1EFHA 5GZ1A 2G9QA 5CXUA 4Q3CA 5F3WB 1GDTA 5I01A 1M6VA 1W5TA 2JGMA 1LB1B 4GOXA 1XZEA 2AWOA 2PA3A 4ZZ2A 3U60B 4K6CA 4OXYA 4AJ2A 5E4TA 1KGDA 5BW4A 4H6VA 1W4AA 3OIDA 4OXRA 3RKSA 1SCJA 3FYCA 4OXNA 3I5YA 2R1VA 5B1IA 1DFGA 4NAVA 4O1IA 3ICCA 2YV3A 2X76A 3N5KA 1PR3A 1CY1A 1R6XA 3GK3A 2EKDA 1VHDA 3GWGA 3IUEA 3O84A 3OPNA 3OT4A 4MV0A 4C04A 5H3HA 1ZGHA 2XZLA 4ZQFA 5LA6F 3VNAA 1DPFA 2WKWA 1LLQA 2Z98A 2H4YA 2HF7A 1B43A 4AMZA 1M7GA 5JWRA 3CX6A 4IUDS 4OHWA 3T94A 3GFSA 3E53A 2BFWA 2RGDA 2BMWA 3MFQA 4BB9A 5LQJA 3RSZA 1MT0A 4XXHA 2A5JA 3SZRA 3WYEA 4C21A 4RLHA 5DLDA 5BSVA 5CMLA 1HZZA 2CXUA 4K3VA 5CB8A 1QHHA 1AY0A 2WFZA 3AJRA 3KPWA 1W0JD 1LDBA 2ZJ8A 4RZQA 3SGLA 3WLKX 4RV4A 4D0SA 3L7YA 1H0RA 1HDEA 2I3DA 4KXXA 4A0FA 4CE6A 4L8WB 1KKLA 1YDFA 1TF2A 2RC5A 3F49S 5ILGA 5T57A 2QWXA 1VSVA 3UVEA 2BFBA 1TRKA 4HUTA 4CEIB 2OZPA 4ASUA 3T9CA 3ITDA 4QJ5A 2K87A 5EA2A 2NV0A 4FJ1A 1U0SY 3FJYA 4PHTA 2XOEA 4RVFA 3RQSA 1CV2A 2ECPA 5TT1A 5SZKB 3TKAA 2FPXA 2V9ZA 3WAJA 2OAP1 2OXEA 4EL5A 1Y37A 5A4FS 1KYWA 1RRFA 2A1UB 3DO6A 2HEGA 1QC5B 1MC8A 4FUTA 1GEGA 2R11A 2DJ5A 4NECA 621PA 1P4JA 2RI0A 1S72F 2Z5VA 2Z01A 1L9KA 2G4LA 4Q9IA 5KCMA 3V4VB 4IQGA 3AO0B 3UM9A 2F62A 3IDFA 1FJXA 3HR8A 1VC2A 1ADGA 2IA5A 4KPEC 3PICA 4TTRA 3OMLA 5TPZD 4BV8A 2Y0PA 4S12A 3PX7A 3S2FA 5KTTA 4WVLA 4NQZA 3QTLA 3L9WA 3GR6A 3RVQA 1BDJA 2QE6A 2YTZA 2FEOA 4J0CA 3WGHA 3GLHB 1X2EA 2B1JA 1C1YA 1G60A 2ZYHA 1SXHA 4G01B 4MA4A 4NHEA 3P4EA 4DAEA 5FHRA 1R6UA 5AW3A 1J2JA 1W40A 1A8SA 2G70A 1D6NA 1FUKA 2WJIA 3CO0S 3R5JA 3JVHA 2FMKA 4QVKA 1J9GA 3EQ6A 5ECWA 4CMCA 1L5RA 3P9RA 3K0FA 1YR8A 1O6CA 2EWMA 2Q5HA 2YRXA 4FEYA 3CVUA 4F1JA 9ABPA 3NC1C 4P34A 4CU2A 3GEMA 3AQIA 2N48A 4DC0A 1KARA 3IDSA 1ZAKA 3KUDA 1J0AA 1QAHA 3MW8A 1K6EA 3TLZA 4QYIA 1YR9A 3OOHA 4ZAZA 3GLFA 4WSOA 5DBOA 1HV8A 2CLDX 2NXCA 5F1KA 3E48A 3FG9A 3I05A 3MJCA 2F48A 4LY9A 5AVZA 3U3ZA 4WBNA 1Y1TA 3S7ZA 2GK7A 1A5SB 1YH3A 3JZIA 4UCFA 2JLUA 4PLFA 1DB3A 1Y42X 3PHLA 5CHEA 3DTTA 3PF9A 1L7NA 4PLCA 4IVQA 5K45A 3TG2A 4BAUA 3LUGA 2QX9A 2WOOA 5AKJA 2C4MA 1RBQA 4LQ4A 3EXIB 4B3CA 1NPDA 1E5DA 4E51A 1OQAA 1AZLA 1ZWZA 4AZTA 2O1WA 2XHZA 1EBBA 1Q7CA 4BMCA 5LP6B 2XMRA 1Z7YA 2A0XA 3COJA 2FH5B 2V7GA 3TQCA 4G4XA 1OXTA 3AIIA 5FUBA 1QG6A 1R0WA 3MLBA 3W05A 4XM1A 2OB1A 3MN1A 2ZTVA 3O3CA 2ZYRA 1P1HA 1CX9B 1YI1A 3HEBA 1LNQA 4HX2A 4P4SB 4ZCSA 4K9DA 3MJVA 2PUAA 5LDGA 4BEBA 1VQ4F 1TZ2A 2OUKA 5FPKA 5IUNC 4QSHA 3HFRA 3KKOA 3EFBA 4X61A 1RQ7A 1T5OA 3TRIA 3RT9A 4C7JA 2F67A 4DA7A 5ABPA 2WG2A 4AY2A 1T9AA 1QHFA 3P4YA 3CY6A 3MT8A 4HLQB 4J0JA 4EJ2A 5C34B 4DLXA 3QUAA 5JC1A 1BCRB 4O1HA 4PZZA 4YP5A 2Y66A 2RH9B 4ZGBA 1NQOA 4DDHA 4Z7NB 1GJRA 4B4DA 3SBOA 1Q92A 2Y1EA 3LKZA 3AVTA 2F17A 1QZZA 2WNSA 2OFOA 1GEEA 1D7AA 4AJ9A 2O5EA 3P9ZA 4N5DA 3ENZA 4WA8A 2E82A 1KOLA 1T6XA 5IJZA 4ZP1A 4DYHA 1GTVA 2Q1XA 1BU8A 5LBUA 1GUAA 1SQFA 1E7MA 1MQ8B 4D8VA 1CUGA 4QJ3A 3DC2A 3DXXA 4UTOA 4G2NA 3E8XA 1DJOA 5HDQA 1RWNA 3C6XA 1ZR2A 2OENG 3D7SA 4CQLA 4ZK6A 1ZK2A 2VJMB 2FZVA 2GR9A 2AFIA 5K0JA 3CMMA 3K15A 1FRQA 5HF8A 2CSUA 2VLIA 3QSGA 1DXYA 4N0DA 5P21A 2FY8A 4FR2A 3AUUA 1L7XA 2IHBA 3A4TA 1ZD9A 1DX4A 3M3PA 3NHZA 3NXKA 2VYFA 5AK3A 3QHQA 3QV2A 5CT8A 3L6UA 2QDXA 5EWMA 3UQYS 4RD3A 3WQQA 5KHOC 3LAWA 5K51A 4IFBA 1SBNE 1I0IA 4DWOA 1RTKA 4YPVA 4Q1CA 3EE6A 4BQIA 3LZ6A 3KJZA 4GH5A 4DCSA 4JJ4A 1UAGA 3C5HA 3MFYA 1QO9A 1XMPA 4UJ5A 4B79A 1QNLA 4LGVA 5K4GA 3S2ZA 2VJCA 1R2QA 1J49A 2IV7A 1VCNA 3L49A 4D9MA 3FWKA 4B3SB 3STVA 3DDCA 1OT3A 1AMOA 3KJGA 3UUWA 3MGGA 1BWPA 3OQNA 2J9ZB 2WD7A 3Q0IA 3K73O 3Q9UA 1AGXA 4KKXB 3TR5A 3P5BA 1XK7A 4Q3OA 3LC1O 2VJPA 1W85B 2AOXA 3D6NB 4US0R 4WZ6A 2C31A 5AVMA 3RRBA 4K1XA 1OWLA 1QMGA 1IRIA 5DIFA 3AOEC 3ZNNA 3ADDA 2HJSA 3FNFA 1X92A 1D03A 1GPH1 1LBQA 1G3UA 1Y4DE 3BJIC 4H7IA 2J3KA 2P6OA 1JRLA 1S0UA 2WZCA 3A14A 2JW5A 3C3DA 4EYQA 2JFOA 3JQ7B 3DVLA 4I08A 4URUR 5CCDA 2QTPA 3AKDA 2YJTD 3S68A 1CE8B 1DBWA 4XR9A 4IGKA 4IHQA 4RVUA 4TSFD 1GPKA 1H8EA 2P4UA 5K8IA 4RY9A 3ZGVA 1IQUA 1JIKA 4LJSA 1WB4A 1Z37A 1AQ6A 2XIQA 4H16A 3WZLA 2JFZA 4RIEA 1J6UA 3GLGB 2D62A 3HBNA 5AVOA 4C1NA 5KDOA 1XHEA 4BX2A 3DBLB 3TQFA 1NVTA 1E6LA 1SBTA 3TPZA 4V0LA 2IP4A 3SYMA 3Q7PA 3INTA 2YICA 5MF6A 2QP9X 3FVVA 5PGMA 2HQRA 2RIRA 1L5YA 5DM70 4B17A 1XU4A 4GVLA 5FOTA 2XNCA 3L7BA 5KYTA 3V1TC 3CVWA 2GN2A 3OHPA 3WIBA 2HLHA 2Y92A 1E89A 4H3HB 3HY6A 3FOFC 1ZNYA 2GRAA 4O02B 4E2YA 4IJWA 1EM6A 3B7WA 4MIEA 2QQ5A 4GR9A 1G8HA 3PJDA 2BZSA 3KHTA 1S3FA 4GW3A 3IKTA 4OP1A 2Z9DA 2C4WA 2CMFA 1TYBE 2NWQA 3MINA 1J8MF 2OHWA 1JKXA 4WXRA 1VG0B 1Q16A 1IZ8A 1TMYA 2O3RA 4J0KA 1OIXA 1VYVA 7REQA 4US2R 4D6YA 3N3BC 5ILQA 4AIIA 5IJWA 3Q4GA 3TLEA 4D0LB 5IG2A 1HE5A 1GQQA 3VR2A 3HABA 3BEOA 3IOYA 1DAFA 4U9IS 2Q29A 1MVNA 3HWSA 4KIUA 1C3LA 1TM7E 1UJ6A 2OGSA 2ZE5A 4LMAA 1U65A 5JYEA 4RK4A 5HY4A 1DAIA 1HSZA 3STYA 1NMUB 4UCXA 3VJMA 4EA8A 2ZXEA 4L7VA 2ZIVB 4KIFA 1B8OA 1TJPB 3AJEA 2A88A 3D7KA 3GEIA 4HXEB 3N8KA 4MYDA 3KVYA 1V1RB 5IHPA 1VQ9F 5ALSA 2AOWA 4PSAA 5KNDA 3OKPA 2VHJA 3H2KA 4DLNA 3DT6A 4MQLA 3B60A 4GR5A 2OLKA 2OOKA 2FR8A 4X3LA 3NGMA 4J9UE 4XDHA 5ALVA 3N86A 4XWWA 4RADA 3DEYX 1ECPA 5C7OO 1NQWA 1D04A 4JWKA 4JXKA 5IF3A 2QUAA 2QD4A 4PFJA 5IC5A 4F38A 2DHEA 3NQ41 1VBNA 3I04M 3IIEA 1PSZA 2ZRFA 3AK4A 5JCOA 4JCCA 3TS1A 4AG6A 3WTCA 1TIBA 1TJ5A 4HPJB 3FHCB 5ELMA 4P3NA 1P72A 4Z1MA 4W9NC 5K0BA 1OI3A 3IV6A 2V1UA 4ZYZA 2XE7A 3Q98A 2XE6A 4DG9A 1GRVA 4JKIA 1Z34A 3ZIAA 3LP8A 1N78A 4LISA 1XSEA 5A04A 3N1UA 2GSWA 2QSZA 1Q6ZA 1SU7A 2V7UA 3A58B 2B0JA 4OB8A 4A26A 1L8OA 1ZVMA 3M4ZA 4YP0A 4KXQA 4BLPA 4DLKA 1M76A 2IW3A 4DQDA 1IHPA 2GRJA 3P5SA 1K66A 3VZSA 4AJOA 1GL3A 2FSIA 4BC1A 4ZARA 3AWDA 1ZRSA 3HN6A 3O8NA 4V0OA 1JYSA 1P7ZA 2IY8A 3GVPA 3OQHA 5EJFA 3C41J 2X5OA 4EJSC 3WJ2A 2VF4X 2CC2A 3ZU5A 3VUEA 3WGMA 4IKOA 1KDVA 2IYXA 3Q1KA 4RQUA 3STXA 4EMBA 3JARA 2RGWA 2AYZA 3NP7A 3KB1A 1NU6A 2CNBA 4W7SA 4ZAXA 4IIFA 2OZLB 1GYQA 1RWPA 3BWVA 1UT6A 2WJWA 3KCQA 4UXHA 2VJNA 5HIAA 5IANA 1C0EA 4K87A 5I9NA 4O1MA 4MKIA 4RPLA 1F2VA 4XB6B 3RBZA 3SHOA 4B33A 4KDEA 1SG0A 2MMCA 5JLJA 4OXQA 3QMPA 5BN3A 1NUQA 4OV6B 1VSQA 3WWCA 3A1CA 3TEMA 1WB6A 1NXQA 2G7MC 3KOZA 3DVAA 4KTTE 4RCVA 1DKMA 3KKEA 1NGSA 4M2LA 1QDLB 2WJ3A 4ETNA 2AE2A 4OHUA 3IOCA 1C8KA 3ZEIA 5C32A 3IEKA 5HF5A 1PE0A 1VE3A 1P7PA 2H48A 5G0UA 3EXG1 2D4HA 1FYEA 1T24A 5FO0A 1A96A 1H2EA 4MS3B 3IAEA 2G80A 1MVLA 2JCSA 4IWNA 4XD7D 1IM8A 3ZDYB 1GA6A 3F7TA 4MARA 4NYJQ 1RW4A 1MA0A 1M1XB 5ADUS 1U2RA 2FPOA 2QUKA 4AU1A 1Z16A 1UC4B 4PR0A 1AKMA 1K5PA 4HRVA 4NMMA 4ZV9A 3UK6A 1M1NA 1ESDA 1ULUA 3OCJA 1Q0PA 3ZHUA 1PO7A 5DXAA 4A73A 4BXOA 3OQIB 4CLOB 5E0KB 3KZCA 1HC7A 3WNDA 2V1XA 1CUCA 5CAEA 4M0DA 5IC6A 5CG1A 5TNXA 2HHHB 2Q3CA 3VKUA 3IUPA 5SV2A 2ZI5A 3M5DA 4X24A 4CHTA 1D2NA 5EESA 4IJ5A 5CM9C 1EINA 3WDKA 1D09A 4P7JA 1UINA 2BYTA 2BBOA 1JH9A 4OEHA 3GL9A 4BVJA 3KR1A 3LT2A 4Z49A 2BF4A 1ACMA 1SHKA 3R3JA 4RTRA 3HK2A 4LFBB 1JXOA 2PX2A 2R48A 3H3XA 4FWTA 1Y3AA 4TYNA 2PUEA 4FFBA 1SVWA 3C98A 2FE1A 3PKZA 3ZD9A 2DB3A 1NXWA 2ZREA 4NHOA 3EF1A 1NM5C 1JP7A 1ZICA 4FNOA 4MROA 4OI0A 1I3KA 2Z8YA 3R6WA 5LZ9A 3AP1A 1NLMA 4HZUB 4TVOA 3Q7SA 1W4BA 3UWOA 2IY9A 1KAHA 3GT3A 5CLJA 1RBZA 4L78A 2HRBA 1A5TA 2F00A 3ICWA 3H6KA 2BHSA 1TD9A 4BUCA 5HG0A 1RKVA 2IYYA 4FSHA 4RA6B 3K4HA 1CN7A 4QXAA 2G1AA 4NV1A 3TQHA 2DR0A 1DCKA 3T5GA 5JSUA 3KR0A 4EZBA 1FL9A 4NZPA 1RC1A 1DDIA 4GVPA 4JUBA 2FG5A 3S1LA 4P2BA 4TWJA 2JIZA 2Q3MA 2OBYA 1YZTA 4YNBA 1I8TA 2J85A 1TXGA 3VZCA 2UYYA 3E84A 1OBFO 1Z6GA 1SCUA 3DMTA 3R6TA 3NBYC 3PYLA 1L4FA 2ZEJA 3OSUA 2XQGA 4GI5A 2RGRA 3NYWA 1L5HB 1XK6A 3M9WA 2W2LD 4TS1A 1DXHA 3UK7A 1RXYA 4BRUA 3IKEA 4UQPA 3PXBA 2IAFA 5EN4A 3BHMA 3TB6A 2M1ZA 3ZDFA 5BSUA 3HJTA 3ZDXB 5EEHA 5KQPA 1WY7A 4Q9AA 2Q5IA 3M81A 1PL0A 4FS3A 1KI6A 3D43A 3KQUA 3C15C 5DCWA 2NUPA 4TMWA 2P0YA 2WPDA 4LYJA 1Z0JA 5DJ5A 421PA 4TKUA 1K8RA 1Q1BA 2X2OA 3WGZA 4EHBA 4UD6A 1NZDA 1N9GA 4NCJA 3B1ZA 4Z4CA 1ZIOA 2ONKA 3RU3A 2HQ1A 3RBVA 3L7DA 3ROPA 3RVSA 3RYCA 3M49A 3MJTA 4FW9A 2HM7A 4JOCA 1U0NA 5BOSB 2O8EB 5CVJA 4EG0A 3VDQA 4EB6A 1SG6A 4D3ZA 4W9MC 2CZWA 2YJ3A 3HYRA 4H1TA 4OF4A 1SK9A 4MWEA 4U00A 5JT1A 4Y9RA 1L1FA 3EQ8A 3C70A 5T4EA 4G5YA 1GG5A 2GA8A 4E2WA 5KYXA 1E0SA 1WKCA 3CPQA 2LPMA 3EXHB 4JJKA 3H2BA 1DLJA 3MT7A 3WMGA 3H9UA 1HQCA 2PZLA 4U6NA 5L7TA 5CBPB 3H1FA 2X8JB 1Z0DA 5JDIC 4HK4A 5CFQA 4LBWA 1U1FA 1V5IA 3OJOA 1S8AA 3RS2A 5HE9A 1U7XA 2C9MA 2OEPA 4Y7CA 2SHKA 5KAMA 1KDPA 1ZO8A 3PWKA 3QLJA 3AY6A 3QY0A 5ERYA 4G8DA 1M6YA 4ZVUA 1YFJA 3TQTA 3QE4A 4FC6A 1FE8A 4P81A 3F3KA 1RQRA 1JXAA 5I47A 5JOQA 2D6FA 3FBAA 1FU7A 4F4JA 2H1LA 5IXSA 5K20A 2C8KA 1QYWA 2AB0A 1B1CA 1WHSA 2YC4C 5EZ6B 5T5QA 2W98A 2ZI4A 3IIIA 1UM8A 2GM3A 3HFJA 4Y3UA 5U9CA 2XVAA 2PZMA 3F6BX 1EZZA 4PFKA 4PGAA 3HVUA 1Q20A 5I7FA 3UUFA 4A3SA 1UPUA 3PFNA 1NQ3A 3Q11A 5I9BA 3V8QA 4OL0A 4WPGA 4FPXA 3TSWA 2FX2A 5HXAA 4JT2A 2H18A 2C7PA 1DVRA 1FOEB 3WWEA 3JATB 2EBUA 2X5JO 3BIJA 2IYQA 3L0ZA 1K7YA 5GJBA 3JW8A 1WR8A 2ZFUA 1IG3A 4DFDA 3PEWA 1Z15A 1RI2A 3IR7A 3P52A 2WVHA 1L1QA 1V45E 1K5HA 3V1UA 5JCJA 2OWDA 3KBOA 2DTDA 2REBA 3DXZA 4XGRA 3GARA 2B33A 3DPSA 3HB5X 4XTRA 4UNRA 2ZVYA 3JASB 4JHXA 4TXHA 1XAIA 4JLNA 4GX2A 2NXNA 4N82A 2YQZA 2YZNA 3AR5A 4R1NA 4GMHA 4A8HA 3GU3A 4ZTBA 3C3WA 3LXUX 5EIXA 1RA4A 1ISJA 1K4MA 1HEUA 2C2MA 2RJNA 3BVPA 4G09A 5K0LA 4FFOA 4BTVA 2QT0A 5C8VA 1ZHFA 3OZXA 1R8YA 4M38A 5LZ8A 4RV5A 5JH7B 1BOOA 1IEVA 3GPDG 4HSGA 1PHPA 2GM5A 5DNDA 3VOSA 5L45A 3ZD6A 5G0VA 1I3MA 2Y76A 2BIFA 5F1YA 5GTDA 2JC3A 4G1VA 2WIFA 1LU9A 2FP3A 3TD2A 1XCMA 4H6WA 4ZHQF 3EIFA 2MSCB 4BFCA 1PR9A 1NE7A 3ZK8A 3DAGA 3U44A 1DQRA 1EQUA 1QTNA 1ADBA 2GEBA 3G6WA 3OM1A 4Z5XA 1AQNA 3DBVO 2HS4A 2PO7A 3R7NA 3DV9A 5LCXA 1JECA 2BT4A 4GI1A 5LMZA 1A88A 4WT7A 5JCXA 3DFIA 1Z0FA 3FOAA 3RIMA 1YU9A 1N6PA 2H65A 2HRDA 5KNBD 1GGFA 2B7BA 3SJUA 1GL7A 1YJCA 1XKXA 3HRKA 1RU3A 3MQFA 4TZZA 1ATIA 3SEZA 2VA8A 5BR1A 4FFLA 3R0VA 3VTAA 1SXQA 4L1KA 1Z82A 1R0YA 1ZDMA 2ABWA 2QRMA 3HY4A 4OM7A 4UHJA 4XQ9A 1WTAA 1I1NA 2P6PA 4EUHA 3IAFA 1TU3A 4ARBA 1SZPA 4MS4B 3E3AA 1RRPA 1UWCA 5HCUA 3FPCA 1WPRA 4MQFA 3T3GA 4EA9A 1ZCBA 2ODEA 4ZZ1A 1NR7A 4NVRA 3WIDA 4PLWA 4LA4A 3QKSB 4N7JA 1T6NA 2EL7A 2FG6C 3W8DA 2ID8A 4QLBA 4C05A 2WTBA 5KYUA 1M1ZA 3TSCA 1JSRA 4OUKX 1Z5OA 2PBZA 3AHCA 1PFVA 2X2FA 3DHNA 3A27A 4NENA 1K0FA 3I62A 1C7ZA 2MU1A 3ON1A 2DLDA 1XQXA 2DWPA 4JLBA 2C98A 5AT1A 3OKFA 1GLGA 2XYQA 3TZKA 4NFLA 4C03A 2J6IA 3HN7A 2P4QA 3B8HA 4GPEA 4JT4A 3KU4A 1OKKD 2CMDA 1RI3A 3HGQA 2W6QA 1XKTA 2Y8EA 3CXRA 5FFFA 4ZXFA 5ENZA 5C31A 5AK6A 4E4TA 3FD6A 5ECYA 2IS6A 5E3IA 4IDNA 3AF3A 1U0FA 1XLTA 5TMPA 4RAOA 3Q2KA 3KL4A 5G4KA 3UWDA 1SKMA 1T2VA 1TECE 3SLGA 3BSFA 2G17A 4X91A 2HGZA 3H5VA 4Q7LA 4GPAA 3QBDA 5CT4A 1CUUA 3SBDA 1SKAA 2QYSA 2MINA 4EHAA 2N75A 2J3JA 4Q7QA 2SCUB 4OA8A 5I48A 2HJGA 4LN1A 4ZT5A 1N2BA 1P18A 1RRVA 3RE3A 4KVGA 3WJPA 2YOFA 4W7IA 5CTJA 5AVKA 1KK1A 4XPZA 2O57A 1Z0SA 4EGFA 4AO7A 2ZAGA 4BEVA 4M8KA 5B57C 5IKMA 1E9AA 1HLDA 4PWZA 2D4AA 4OHVA 1SVIA 2CVOA 2O8NA 4GEGA 4RHCA 1W8DA 4RMGA 5EJ7A 3U7QA 2VJBA 4I50A 5GV8A 1VA4A 3WGGA 3BUSA 5ESWA 1VBFA 3UJ8A 3VU9B 4MGEA 1KYYA 2MYNA 2ZQ5A 5KHAA 1BMTA 1B4DA 1W5EA 1V1JA 2QL5A 2ZXFA 3CUVA 4JC4A 3S0WA 4YROA 1JAHA 2TMYA 3HL0A 3T1QA 2LKCA 3WMEA 4B87A 2A0FA 2WYWA 5EIAA 4KQ9A 4CGYA 4PIPA 3WNQA 2WYUA 5FUWA 1VQ8F 3OE5A 2I6GA 4MWZA 3O7MA 4R0MA 2XQIA 5GJVC 4MVJA 4M4SA 4L6CA 2GYVA 4KB5A 6Q21A 5J2TB 3VYVA 3P19A 2B6HA 2JFVA 4W9RA 1YVRA 2AE1A 1RE0A 4RY8A 1OAPA 2OO5C 3TL3A 2EHDA 1IMJA 4ENRA 4EGSA 4QT0A 4ERHA 4XCQA 3P2IA 1CJUC 1Z62A 1LY1A 4DM3A 4P54A 1RJGA 1FLNA 3QBVA 3DE2X 2R5WA 4LRQA 1RPAA 3PNVA 4I5IA 2O6LA 1RBYA 4XAQA 1JMYA 1E5VA 5EIBD 2PU7A 2ZBVA 3PE6A 1W7AA 5DXFA 1C29B 2VAWA 3AR6A 3T15A 3FMFA 5KWSA 1YJWF 4JSRA 121PA 1PGQA 2Y1OA 2ID4A 3PJGA 4OQPA 4PAOA 1A7KA 1SCQA 4DYVA 1HNWB 3DLBA 3PKJA 2QZPA 1FFXB 1AG9A 5BYJA 1V25A 1KFKB 1KRXA 1GUFA 2HMVA 1AKEA 3UW3A 5TMEA 4GKJB 1NLUA 3T12A 1HDYA 3KSBC 5KS2A 3OIGA 2EW8A 3TNJA 2X23A 4TKZA 2XGSA 4DLAA 3MTAA 4FQ8A 4F3KA 1J4AA 3PXXA 1DOZA 2DULA 4AG5A 5JNTA 1RHJA 5K3AA 2Z1UA 3J7AC 1T8UA 2IEAA 2WWWA 3PDHA 5AW8A 4O4HB 1R1DA 1GSHA 2KX7A 4ESEA 3JYNA 4PHFA 1BE6A 4IIGA 2L69A 4ZVLA 4K8RB 4MKFA 4J4BA 3ABOB 3DKRA 4IS2A 2OORC 3EVCA 5DKFA 2HR1A 3K05A 3H5RA 1FNKA 2POCA 4AD8A 1URPA 4F4IA 3UJAA 1E3WA 1CCWA 1KH3A 1E9DA 3GUVA 3P2YA 4MIYA 3S5JA 2VSYA 3NEPX 1NW3A 3ZGXA 5DLEA 3UJNA 2EYQA 3TYXA 1DIHA 4PWYA 3GLTA 5FBWB 5IH7A 1DAEA 2J3QA 5JDCA 1E79A 1KE2A 2F1JA 4JLDA 4JXJA 1YQGA 5DSZA 5F21A 1XYGA 1GTSA 2E5LB 2W4IA 2ZXUA 2QG4A 3T9BA 5KDDA 2FW0A 5FXMA 3AGPA 3ZHCA 4B47A 1E2BA 1EGMB 4A5SA 1U2DA 2AW5A 2IIQA 3S02A 5IASA 1CJSA 4JLVA 4OJNA 3G0HA 1KEZA 4IXMA 5IM5A 2VAMA 3PI7A 3ULKA 1HRKA 4J16C 4PAQA 3W5SA 1WWKA 3IBCA 1X80A 3GGSA 4BMNA 1FVHA 2E4ZA 2ZB3A 2ZWAA 4DHEA 4KPUB 4AJHA 1CEYA 1ZGCA 5FI0B 4D3XA 1V7QA 2EFGA 4MPPA 1FJHA 1T6BY 3KWLA 3A9TA 1E1NA 5AW4A 5IJ9B 4QDXA 5ARBA 3ZWCA 4Q02A 1YOVA 3EJWA 4MHOA 4M0KA 3TAXA 1T0UA 1UL1X 1K68A 5B3AA 3NIDB 4CLHA 4O0LA 1EVYA 2DCMA 4G65A 4ROSA 3V7NA 1P0FA 5CEEA 3D02A 3C6QA 2FVYA 2J1LA 4XGQA 2H0QA 1Z4PX 2B8NA 4PX5A 2IV3A 1ORDA 5K99A 3BDIA 4RXUA 1SPXA 3GAZA 4Q0MA 3V4LA 4OHKA 2LXNA 1ZUNA 4BFSA 5K09A 5JNVA 3QFSA 2NSJA 1AHIA 1TU4A 2D5AA 3SC3A 1W1IA 1OXMA 2BKVA 4EMUA 1ODCA 3L01A 4LBYA 5A05A 1J99A 3OE7D 3H5NA 3JRWA 5DOZA 3ZV3A 3C9TA 4C7OA 2JFUA 5I6DA 2VWQA 2VO1A 1CUJA 3RVLA 4M60A 2EHJA 1Z2PX 1J9EA 2UYNA 2JZOA 3N6VA 4RPIA 2G0NA 4ZXPA 5T41A 2DC1A 1E0KA 1Y81A 1TYDE 4RH0A 3WGNA 3T9AA 3WNCA 1XWIA 2LUOA 3I4FA 3DUFA 3P20A 3GCXA 4R8SA 3MCTA 5K0CA 1QVAA 1T4CB 3WAKA 2ISSD 6AT1A 1RQPA 1XDBA 4B5CA 2ZJ6A 3L6BA 1OT5A 1Q3KA 1BMFA 4IYJA 4J1TC 5LBTA 4ARZA 2O8BA 4JC0A 1E6EA 2XCLA 1MDBA 3RHTA 3U7RA 5JXHA 4QU9A 4JVOA 3EGXA 4CIBA 4RS4A 1NDUA 4EB0A 4I4IA 2Q0SA 3WC4A 5JJ5A 5LQRA 3HBLA 4ENUA 2PEYA 3CW8X 2YV5A 3WL5A 3ZGYA 2PPVA 4CEJA 2YINC 4IQ4A 4O5OA 1AGNA 4WBXC 1G5RA 3CMEF 2GASA 1NYLA 4KMRA 2IOQA 4LF8B 1GPDG 3MLEA 1TL7C 1U1GA 1JZQA 1WEHA 3BIXA 2BKXA 3FX2A 4UBNA 2FLVA 3W8EA 3EAQA 3OOSA 3M84A 1RSZA 2WF8A 1WVGA 4NUTA 2PQMA 2X6TA 3KVVA 3S1AB 2RSLA 3UKJA 3K8QA 3OEHD 3SF8A 3LYLA 1NFRA 3ET5A 1T3TA 3KNZA 3PGVA 1HI9A 3SHQA 1U8AA 3R23A 3M4JA 4O4JB 3F6MA 2TRSB 1E7KA 2MYUA 4G63A 4AX4A 2AKEA 1RJFA 4DMLA 3PUYA 3HRIA 3LCJA 5DHRA 5JVDB 1MX1A 1GL6A 1Y3DE 5CVTA 2XI4A 2EARA 1X2BA 4YMTA 1Z4MA 2D8MA 2OXFA 3G82C 3PDIB 1R6BX 4R8VA 1X42A 1LI7A 2NT3A 4UEOA 1GGEA 3URKA 4QFDA 4TYWA 4YCCA 2N9UA 1QIHA 2OPBA 2RHBA 5B3LA 2K2WA 1D1TA 3KXIA 4LXYA 4XOUA 5ALMA 2QLTA 2QTVB 2C4KA 3HBMA 1W76A 3CKLA 4BIIA 1GSAA 3IT3A 1NW6A 4KDRA 3AI1A 3U4DA 2N3ZA 5AJYA 2BM0A 4RTMA 3KPUA 4ZA2A 3JWGA 1W0JA 1M6WA 4J16A 1UXOA 2OV3A 2VDNB 4F3TA 3QYAA 1M6HA 3ZJUA 3L18A 2QUJA 3E58A 2ZAOA 2DHDA 1DKRA 3F71A 4MVXA 5D5PA 3BMOB 2OYRA 3H13A 4B6QA 4ZI2A 1RRCA 5AO9A 1MNAA 3IYLW 3RH0A 1GKYA 1VLZA 4XX1A 4DIUA 1HYGA 2VSNA 2Z2IA 1F3OA 4F5YA 2LDXA 2ZIAA 2OHJA 5AVTA 1XCOA 3AUAA 5KVQA 3N4ZA 3KR9A 1FSSA 1M2HA 4E88A 1RAAA 4WY5A 3SDZA 3BD6A 2QP3A 4EY3A 4HFNA 1JG3A 3ANYB 3DGEC 3NIFB 4I0WB 3DZ8A 4PCVA 4QAJA 3E1GA 4ZHWA 4M46A 5C2JB 3ENQA 2NZ8A 1E69A 1E3SA 3GLIA 1K3UB 5LMUB 1AF7A 2AR0A 1D4OA 5I4IA 1KAEA 3D3JA 5DHSA 1JBKA 1G5HA 2FK7A 2R8XA 2XVXA 2ZROA 1JBEA 2F8LA 3HO8A 5EIFA 5H80A 2HQOA 3FCYA 1OX6A 1NSTA 1WOYA 5FPQA 1WMBA 2YMQA 3ZNOA 1CP3A 5LD2B 2GI4A 1QAQA 3CUEF 3S40A 4LYFA 2GCOA 1JPJA 1RIIA 3IQWA 4L28A 4NONA 1AGYA 3HCOA 4FLMA 2UYOA 5DI9A 4AF7A 2XY4A 3AW8A 3CXCF 1BAPA 3AYXB 1FLAA 1CF2O 1T36B 2OQIA 3IQDB 4AURA 1P4RA 3D64A 1K7XB 3ZPXA 4PN3A 1YTUA 3SX4A 4RNCA 2QY6A 3EPPA 1ULZA 2AT1A 2I6XA 4OVKA 5LP6C 2ACKA 4G56A 1H6BA 1T4MA 1F0KA 8GPBA 2C94A 1HF3A 2R00C 4IVRA 1HYQA 4J1TA 2ZP1A 3M1YA 4PFSA 5A6SB 4RF4A 3TL2A 3TRFA 1A4RA 1P60A 3K70B 1JFVA 1KXJA 2HRZA 3QF7A 4PYOA 4WKNA 1ML4A 2CLOB 5EP3A 5K3CA 1NMXA 4N8DA 4FNAA 5LUBA 1XXHA 4B48A 2A0KA 4H27A 3V8BA 1KOGA 4S04A 4PQRA 1I7DA 2FQQA 3FI9A 3DZDA 3L8DA 3N7AA 3CG4A 3PNQA 3GGPA 4Z1OA 1DHRA 1YMQA 4Q3EA 2CKMA 3HB1A 2ZOVA 3SYRA 1PKEA 1ZM4A 3IURA 4RZSA 4UDNA 1QD9A 3LTNC 1XQ1A 3TX6A 1UUFA 3WI7A 1S01A 2CXXA 5JRZA 2ORWA 5KTPA 3W3AD 2CDRA 3K2XA 2DMRA 2PUTA 3AZQA 1MFPA 1OW3B 3EUAA 4B7UA 1FEZA 1POXA 1JR4A 3AUTA 4WASA 5KWJA 4E5UA 4L4SA 2D0OB 4LZAA 3ZKWB 4L8VA 1DI0A 4EECA 2J9FA 3TIVA 1A2QA 1N32B 4RMNA 2XB6A 1PZXA 2OM2A 1GQ2A 3ADOA 2G83A 4K9KA 4K86A 4L0MA 2H1SA 1R88A 2EKZA 3EIXA 3WLNA 1LS1A 3D2LA 3LCRA 1QJCA 4MCIA 4DDTA 1V43A 4TV8F 3KYDB 3Q9SA 4EG6A 3DEZA 3C8HA 3CMCO 3TSOA 4IDCA 5DXJA 1AURA 2HWWA 2XCIA 1KI1A 3M4NA 4ZRNA 5EJEA 1H1LB 1KH2A 2X86A 4RU1A 4HDQB 4EHKA 4GX5A 5KYWA 5EEGA 3C6MA 1P0CA 1R9GA 1JBQA 1SB8A 2J33A 2YWCA 2QAJA 3FKSD 3FM9A 4FLEA 2VEDA 3TD6A 5L7WA 2VTBB 2O2DA 1TU0A 2OHIA 1VZ2A 2BR4A 4ENWA 5CYGA 3U37A 1Q0RA 2FPKA 1XV5A 3IKLA 4M88A 4TKLA 1KA9H 1QC5A 3D6JA 4U7FA 4UBIA 3T3IA 1NXOA 4X93A 2JL1A 1KE1A 4J8PA 4NU0A 2D1SA 2GVDC 2A3NA 1SU6A 3L7MA 1FW6A 1SB9A 3PFGA 2XYPA 2BFCA 3GEEA 2PS9A 3EMDA 2AH5A 4RHAA 1DDOA 4RFSA 3SE0A 2O9JA 1U81A 3ZY2A 3TRKA 1HDCA 1LTQA 5FFNA 5JYBA 1XZGA 3GLHA 1KWGA 3SSMA 2Z0MA 4UUPA 2COEA 4ZC1A 3QFRA 1FJ2A 4B84A 4Z4GA 1P9RA 2QKYA 3KD2A 4NS1A 4E5KA 3H9EO 4QREA 4GC9A 5E7QA 3TL6A 2FYTA 3U3KA 4G84A 3HUFA 4JQCA 2PZKA 1P7WA 4C14A 3NM5A 3ZS9A 3W7VA 2CEKA 3DAYA 3UB2A 3G3EA 4KO2S 3TEJA 3RGWS 4LYHA 5DNVA 1HT0A 3O4IA 4RZXA 1C3OA 3UPDA 1XIVA 3OOJA 4IS3A 2ZF8A 3WGUA 2ZS7A 1U1DA 3BFVA 3OZWA 3R44A 3C45A 5ALQA 1M2KA 1VB5A 2TYSB 2Y1KA 3LLMA 3O9ZA 3UUEA 4XLTA 1UBLS 4MUHA 3FSJX 2LGJA 2PVPA 3WV4A 4MQ5A 1PL7A 5JPIA 1ZZEA 4M6WB 4EVIA 1JEEA 4D9CA 3LTEA 2QE7A 4AZ3A 4M1ZA 1G2PA 3AMVA 3IALA 4WE3A 3RJ5A 1BDHA 1TK2A 2WA2A 4MW7A 3O1HB 5M7EA 2X13A 2CV0A 4ZALA 1XN1A 4HPWA 4DOMA 2XTNA 3EXIA 3BTVA 3TOVA 2QG6A 3CVJA 4DLSA 4PZAA 3AF5A 3LBIA 1DXOA 1G7CA 1I6WA 4CKYA 1JYEA 2X7JA 4Z86A 1I3LA 2RH8A 5HQJA 1CR6A 1Q11A 1M73E 4BIMA 2D2VA 3NTQA 3OETA 4A27A 2A9KA 2VP4A 3PPXA 4P4SA 4DCNA 1PK9A 2RHHA 5IVHA 3GUUA 2I4NA 1B6GA 4LAFA 1Q3TA 1J22A 2YN2A 4TSFA 1R9NA 4RETA 5EZYB 1VQ5F 2C5SA 2P11A 5LP1A 5KJFA 2Q45A 4QUBA 3LFOA 3RNLA 3FBWA 1KVRA 2HF8A 4D4JA 2PXXA 5L9AA 4KR2A 1QX4A 4XWAA 2V3VA 2W8BB 4X6XA 2GEKA 3HJWC 1FTGA 3IAAA 3QVXA 4IJQA 5B36A 3USZA 1PZHA 3NNDA 4GPBA 4MICA 1EEHA 3OZAA 1Y63A 2B4KA 2P40A 5BWBA 2C2KA 1V35A 2DAPA 4I5GA 3EBPA 1ZI6A 2XEDA 3GLUA 1MEEA 3NTLA 2FN7A 1BVRA 4OHPA 1JLLA 3IJPA 3IRVA 3OZ7A 4G88A 4EPXA 2P2NA 3FF4A 4ER5A 4Y9UA 3IAXA 4BQRA 4M22A 5BQPA 4NY1A 2Y4NA 9GPBA 1JFFB 1UKAA 1EIZA 3IS3A 4UNNA 2NTYC 2NO5A 2HXYA 3U0VA 2GDJA 4BNFA 3QELB 4JUAA 4DPKA 1SKYE 2OCKA 2GHIA 5CNKA 4AMBA 4IMIB 3CR3C 4Y1EA 4B4WA 3OCUA 3NDIA 3VVCA 4LF5B 5HJ7A 1M5UA 2AUTA 5AKIA 2GBLC 4OGFA 5GANK 2DE0X 2LVBA 3UGQA 4LHZA 1V4NA 1SCNE 3MQWA 1IEWA 2FDRA 4F46A 2BEWB 1YS9A 2M2IA 4KNWA 1J90A 4RPJA 1CR4A 3PJFA 1WCIB 1FYXA 2IHKA 3F6PA 3P0EA 1F4VA 5H83A 3TXAA 1G8JA 1NTOA 2A92A 4Y2RA 4C0AC 4DDKA 1Y3CE 4UHHA 3COYA 1KAMA 2BJVA 1IXYA 2CLHB 2WU4A 2F1IA 3GN2A 3N07A 3AFMA 4YDSA 2BI4A 2WBLC 4MV1A 1X13A 4U0JA 3II6X 4BMYA 1L5MA 3A6JA 2VJKA 3DXYA 4RD4A 4WFKA 1FJGB 3S03A 1VLLA 5AW1A 2ATVA 2HAEA 5EZYF 5CT9A 2E6UX 4GWLA 3RRMA 4YXFA 3LHIA 1N6HA 4EUEA 4HY3A 4LRYA 4XGKA 1GPNA 4GQAA 3TLMA 3IEVA 2C3OA 1ABBA 3I1YA 4G5HA 4MR7B 1CY8A 1ZJ5A 3NZEA 2PUVA 3NVKE 1HNNA 2A5DA 3O21A 4MCJA 2B21A 2BFDB 3I2JA 3FXAA 4BV3A 3JQ7A 3UMMA 4JCOA 1IV4A 3UWSA 2VNAA 3KVNA 4LECA 3ABQB 2N42A 4YDQA 1NR5A 1JGTA 3RRZA 4AROA 1RHKA 3SP1A 4EY7A 3AVOA 5BWMA 5CX1B 2ODBA 4ITRC 3OZDA 4ISBA 2VDWB 4CMBA 3CH7A 3W04A 5HFJA 3LW7A 1QKJA 1K4YA 4W6ZA 4BKUA 1GQYA 1REQA 3CCEF 1QHGA 3DHWC 1F51E 3FFMA 3FHLA 4JI2B 4B3GA 2XKBA 4CR7A 3G0DA 1U8EA 4AZSA 1PIWA 3C7TA 3IHLA 3LNCA 2E2WA 3R8CA 3OTIA 4J0EA 2NUAB 1JDSA 1QCCA 1XVLA 3FYUA 4KE6A 3S70A 1XZNA 3OT1A 5ALXA 5BSEA 2OB2A 3H0KA 2CMKA 3H99A 3L7AA 5D87A 1T9ZA 5KVSA 1AKQA 1GU7A 3DZHA 3WYBA 2F1RA 1W4LA 4PC7A 4D46A 2V7WA 1G18A 1N5DA 2YV2A 3T7CA 4CL0A 3ZE8A 4CIDA 1DT5A 1K98A 4YCNA 1JX6A 3IVGA 3ZTTA 4NOLA 1RT9A 3TXYA 1GSOA 3IDAA 4RAQA 4MDEA 1CY4A 1MC5A 5ES4B 2V3CC 4WX2B 3PJRA 3WBKA 1ZGBA 1ELOA 2HA4A 3P9XA 3QVUA 3TTWA 4ACBA 2O1SA 3UPTA 2YVKA 3FMVA 3NRBA 4EFLA 2QRQA 2JFXA 1PEDA 1WQ4A 3BILA 4IPTA 5DW3A 4GOKA 4OI4A 2MSEB 5DTEA 2YYYA 3DXFA 2NXWA 1RYFA 1E7QA 3ONDA 3OPYI 1NJGA 4ZYTA 1TRHA 1YL5A 4QWWA 5BRNA 4KK3A 2FPMA 4LDZA 1RI4A 2O7VA 3JSXA 3RARA 1XGKA 4N8SA 5KNDH 5G41A 5IRCD 3EPKA 3UAZA 2PRZA 2IZ6A 3VYRB 4EOGA 3E9ZA 3PWTA 3B7GA 4FQ7A 3RS0A 1SHJA 4J4TA 5DK6A 3E9CA 2WQ6A 1E9SA 3BRWA 1K3FA 2A5FA 3E61A 3BMQA 4H7PA 3ZDRA 4MUIA 4LXHA 3KALA 5CDYA 4LOIA 3AZPA 4FKZA 3HA7A 1C3JA 2JBAB 2GBLA 1PS9A 2PSEA 4ZHYB 1IY2A 2X15A 4K0RA 5AP9A 5KTOA 2J3LA 4Q4AA 4V02A 1FTYA 5D00A 3BHNA 4XWGA 1OGYA 1W2HA 2D2IA 2W11A 2F1KA 3NPMA 4P33A 2IEGA 3OLWA 1MZVA 2E4YA 1YV9A 3BHIA 4IEIA 4MV7A 1RQXA 5ITSA 3FYTA 5HZHA 5SZJA 2R96A 1W96A 3I2FA 2JLBA 3BGWA 3I55F 3URMA 1N2HA 3VBEA 3WLIA 2NV6A 1G20A 2H51A 4B7AA 2NVOA 5LZ7A 4HQNA 2B35A 2BTOA 4LHSA 3OEYA 1E2EA 1U8YA 2Q2WA 4I2VA 2DECA 4R9UC 4P4TA 2VVTA 2RARA 5DP2A 2NVUB 4RHUA 4EI8A 5JAOA 1HDIA 3G9UA 1N5JA 4FI3F 3ED5A 3AEKA 1SOUA 4KXUA 3U3RA 3T7JA 4NCBA 1YA8A 1ZL0A 3C3YA 4JBYA 1N8SA 4C2AA 3R2JA 4CTNA 3FPKA 1ONBA 3DMFA 4RJ2A 3GNLA 5SYMA 4FFNA 1JIUA 3DLPX 4UOEA 1X7WA 2QV0A 3BK7A 2VAVA 2ZIWB 2E5FA 3C6BA 3FB4A 1DTWA 3H8SA 4U9UA 4EEXA 3IT1A 4EHFA 3OECA 3IP6A 1Z56C 2BGTA 5FO1A 2C54A 4YRNA 2V6IA 3I0MA 4QUKA 3VSBA 2R8YA 4LEIA 4H0NA 4AN0A 7MHTA 3QJGA 1WDTA 4KMSA 1DARA 2GHTA 2JASA 1L5FA 3M6AA 4NS4A 4F6RB 1JG2A 3HCCA 3LW8A 1ZNXA 5EWJA 3T3DA 1XZLA 3K6KA 2ZAYA 3AG6A 3KTDA 2YXZA 2E9SA 3PYMA 3QU4A 3HFSA 2HUNA 2NU6A 4FFPA 2PRKA 4TTAA 3SEFA 2ZRHA 3EXHC 4AUEA 2H8GA 2IYUA 2IPAB 1XNJA 4FZ5A 5IJ0A 4IG4A 4LG1A 1GTZA 2I3AA 4V2UA 3QXSA 5FWYB 3LMEA 1QQTA 5JADA 1UBCA 2VDMB 2B20A 3HCAA 5CT5A 1XRMA 2FMTA 4GL2A 3PQFA 2WTXA 5C5CA 2P9EA 4I66A 4J2OA 4U9HS 2C2HA 3RVMA 4NOKA 2ZSIA 5BVGB 5JD5A 1B1AA 3T0GA 2CXNA 1PJRA 3IGFA 4ZVPA 1GARA 1I7LA 1NSFA 1AV7A 5TY0A 3NRJA 1OAAA 3W0LB 3GN1A 1RP1A 1LDGA 2GLUA 3IESA 2I3GA 3RS4A 3CCFA 4UTNA 3AVUA 2OP1A 5I9LA 4ILKA 1Q12A 2CUZA 4A16A 2HB6A 3N2YA 4IDHA 1C4KA 2W0SA 2ZI3A 3RVNA 4MITA 2HA6A 2Z04A 2FCAA 3LF2A 4BT6A 4BLWA 2IUYA 2SECE 3BOSA 4C06A 2H2AA 4CETA 4GUAA 4LUCA 1TKAA 5IT9M 3PL5A 4WY8A 3WOHA 3WIUA 1C0IA 1MKYA 4PHGA 3VR1A 4KGVA 4L75A 3VR6D 4BO3A 5C7LO 3ZGZA 3LT1A 3TECE 1OBCA 1TEVA 2WU8A 3IHKA 2IH2A 3CXUA 2J3MA 1U9IA 1PSDA 1XQ9A 4HDKB 3MUEA 2ZIXB 3J81M 5CW2A 3V7QA 1EX9A 4YHBA 4A9AA 3A9VA 1JB9A 1C30A 2NOAA 4IKEA 3DDHA 4MXDA 4K2AA 1E96A 4FCVA 5BWOA 3DDWA 4LXQA 4FS8A 2RGYA 2ZJ3A 4EQ6B 4NCAA 4X6UA 1T8RA 2RGNC 2AYYA 1S8OA 1K1EA 1X8KA 3KQKA 3HXMA 1H3FA 1K6MA 3ASUA 4GHWA 3I6ZA 2PCJA 4N5NA 1WPGA 3R1IA 4BNTA 1Q86H 2HP3A 1MX9A 1DX9A 1SU4A 3NOOA 4FBLA 5G40A 3THWA 1B23P 3LUKA 4Q15A 2VRCA 4HN2A 2XQVA 1CW2B 3W9UA 3K4QA 4RCZA 3GA5A 5BNWA 1L5LA 5IYZF 3X1WA 1ZGAA 3HJNA 4R9RA 1Z8HA 4UTZA 4PTLA 1KYTA 4K40A 4W7HA 2XVZA 2RAUA 4E3WA 3RHZA 2MR6A 1KQNA 1FNJA 1UKEA 3SBEA 1L7AA 2WEKA 2HW8A 3U7IA 3HVRA 3AHIA 5F7XA 1E0AA 1SCIA 5L3QA 2P1RA 2X9GA 5CDGA 2P8SA 2IUUA 3OMWA 3NWJA 2ZSFA 4F4DA 1GFSA 4XARA 1GNSA 2WT8A 2YL2A 4H17A 1H93A 3QGMA 1NI4B 5CURA 4YFVA 4ZEOA 1U3LA 5EHGA 5K0GA 1EUCA 5KNCH 5LQAA 4WNCA 4G89A 1U3PA 5CFRA 3A9WA 1EH5A 1E9BA 4KG7A 2RGGA 4HTFB 1W2GA 1U1CA 1HL3A 2YJ6A 3LQ4A 1DIAA 3QFCA 4LE0A 2L0XA 2HVYD 2AXPA 3MYYA 5IZCA 2WJHA 3H4VA 3KPJA 4OHFA 3C5EA 3ZN2A 1V7PC 2V97A 2R97A 2H3EA 2ZE6A 3MCWA 2BD0A 4QU8A 5CLQA 5AM3A 1C0PA 5DRYA 5BQFA 2GM4A 2EG9A 3MZ0A 4JVNA 4QOSA 4PPNA 4P0PB 3IDZA 4DMRA 3QEAZ 4J03A 3BORA 2FEXA 3N2ZB 5EMMA 3ZZMA 2O8EA 5EIBC 5SY4A 3F5SA 1PTKA 3HL4A 5TT0A 5F4BA 2QU8A 3ZCVA 1CR1A 4F1WA 1E2GA 5BT8A 5F9HA 3QKWA 3D3WB 4GPD1 1VMKA 3H04A 3GH1A 4H7JA 2Y1DA 1IHYA 1E4VA 4EHDA 2YNMD 2WW8A 3S0HA 1XQYA 2A9FA 3A1NA 3TTXA 3KSZO 2ZUUA 3R3SA 5EXEA 4TTJA 4DIFA 4F21A 2JHGA 3CG0A 5IKPA 4G5QA 3G8DA 4ZHQA 4QPDA 4P3XA 4IIUA 2H31A 4P4UA 5E9JA 3KQLA 1OH8A 1QO0A 3EWIA 2IKQA 4NNJA 2WMOB 5FCDA 3BHJA 2CSXA 5BV2P 2DLCX 1M5TA 1R50A 3O9MA 3G2NA 4KMMA 3BE8A 2CK3D 3BWBA 3FYHA 2VHUA 1GUBA 4R54A 2J0SA 1SHZA 4IH1A 2UYJA 1PTJC 3JQCA 5JSZA 1XFDA 2CNOA 2EJBA 3QX9A 4RORA 4P80A 1V39A 2IS1A 2O3JA 3W6ZA 1V71A 4X1YA 3GHHA 1OFGA 3N7UA 2ZBFA 1XD2A 4OJQA 1NOJA 5HKLA 1NAHA 1WXQA 3O8RA 3LX8A 2FAXA 3LFUA 1EZ1A 4CM7A 2SKDA 1L7RA 3NXSA 2VGMA 3MCQA 2REOA 2XZTA 3K0AA 4P7KA 4PTYA 4UM8B 3RFTA 4DSUA 5I5GA 2GZRA 2PMPA 721PA 5AVUA 2FUG6 4C9BA 1MG5A 1J5EB 1RYZA 6ADHA 1V9LA 2FFJA 2Z1NA 2R751 2AFHA 1JDJA 4YS6A 4EJMA 1ANKA 1B0ZA 2JS7A 2X19A 2D5CA 4KRGA 3OCZA 2GS9A 3CWZA 4K6KA 3ILHA 2GN0A 3IMKA 3TMYA 3EEQA 4BLVA 1ID1A 4D92A 4Y0VA 1KVTA 3EYWA 3I9JA 1NNSA 2AN5A 2GN1A 4FMCB 4M0UA 3RK4A 2NMVA 5L3VA 4TQUS 3AP3A 2WSBA 2JG3A 2IS4A 4CLXA 1SKYB 5ALNA 4OFWA 2ZT6A 2ID9A 3H4TA 1RHQA 2QA4F 1YQEA 2G9ZA 1W0KD 2JBHA 3PNYA 4BZXA 3WIOA 3L3BA 3K72B 3MMZA 4WLFA 1ZI9A 2AMTA 3FRHA 2J41A 4AY5A 2YZ2A 5LMCA 1JFLA 1U3WA 5ALYA 4D56A 4TOIA 4XDYA 1BW9B 1T5TA 4FYKA 4G0OA 4BMVA 1Y5RA 4BO5A 3H5TA 4MWSA 3EIOA 5B4VA 2HMWA 2PR7A 1E77A 1O03A 3AEZA 3IIJA 3L0PA 4FZVA 4JIGA 1EHCA 5DE3A 2E89A 3FE2A 3ZCSA 1KDRA 4YQZA 4IF6A 1R0CA 3DE3X 1WD7A 2X0JA 3CRQA 3E9DA 3QOYA 1ISHA 4P82A 5FNVB 3RFCA 4AC9A 1V1MB 2B5WA 2E4XA 4K7JA 4Q3NA 3SK0A 1G21A 2B34A 1T3LA 3L79A 4G0NA 4N3CA 4RVNA 5LVAA 4D6XA 1IPFA 2PLFA 1N1DA 2WHXA 1DC6A 3O4VA 4XM0A 2X0DA 2UXDB 1ESNA 4O63O 4CIAA 2OFFA 3PVSA 4K81B 2ZB8A 4NYMQ 1BEZA 4CUKA 2IY7A 4YO8A 4CN8A 3TPCA 4K9LA 2WJJA 3MILA 4M89A 2B1GA 1K6XA 1XC7A 2AN4A 3MJSA 3OEEA 4DLRA 2H0AA 4ZIRB 3MTDA 2CT8A 3V00A 2UXCB 3CT4A 2J08A 5HZGA 3S4YA 3LHSA 1EVJA 1A9OA 4HUQB 3RTEA 5JW6A 3VH3A 4CMIB 1GPAA 4RHEA 4M0EA 4DCPA 5GINE 1GV1A 5JQWA 1OC2A 3K6SA 4ZTZB 2JLVA 4Z9AA 3FTQA 2QTTA 2VI5A 1W6UA 4HT3B 1NWHA 1WUHS 1NJ6A 2XR1A 3KB2A 2Y77A 1ZK4A 4UUNA 5FEUA 3VTFA 4NH0A 1G4UR 4E2ZA 2HIAA 1TO1E 4HAIA 2X58A 2ZRGA 3JYLA 3QKSA 5FAXA 5EJ4A 4Z4EA 3O38A 2EOAA 4GUDA 1D2AA 3GD5A 4XYGA 1C7RA 1J9ZA 4OYHA 4LVOA 4FINA 1E1RD 1FXUA 1OSNA 4K8OA 3GP8A 2O8FA 5TQJA 3K20A 9LDBA 3WQSB 1E1QA 3IXMA 1ISPA 4MB0A 4LJRA 3L2OB 3PPWA 4YLGA 1ZL2A 2NO0A 2ZRQA 4AZVA 5LB2A 4OAQA 3LKVA 1J7HA 1IWBB 4YMSA 2YYZA 3R0QA 5H3LA 4CM4B 4YUYA 3NG1A 4QUAA 4D43A 3KJKA 1NF2A 2D7CA 3Q87B 1L4MA 3QLUC 2P79A 4UKDA 2GPSA 2UVPA 5LL6P 4M1OA 3LYHA 2G28A 2WT4A 3VO9A 4MWCA 3HWWA 3EBLA 1T2CA 3PXAA 3EFOB 1E58A 2C1ZA 1THGA 3Q8HA 3GJ7A 2LR0A 1OPXA 1BN7A 4UU8A 2V7QA 3ESYA 3NAGA 5LBIA 3JWEA 4WCDA 5IF9A 4CUZA 3FDZB 4QNNA 3HYCA 3M8KA 4GNRA 4C8IA 3LRTA 1U8XX 1XL0A 4DG5A 3I4CA 3RS3A 3A7EA 3GJYA 2QVLA 4WK0B 1SC1A 5DBIA 3QEMA 1QF6A 4KYTA 1WXIA 2F3SA 2JD0A 2HA5A 1UC9A 4TUYB 3PITA 4YGXB 5C8DA 4KI0A 2JRCA 4M8IA 2QL6A 1YBVA 4FKBA 3RAGA 4FE7A 2Z5LA 1QYRA 4Y6LA 3REFA 4D9GA 1MAUA 1FFAA 5HX7A 4G8JA 3OF5A 1IB0A 4AUMA 3ECSA 1G3QA 1GCUA 2I6UA 5AIAA 4F5EA 1E66A 3N2KB 3Q0EA 2ZYSA 2NX2A 3OLXA 4GGPA 3A9SA 4KI7A 2AOVA 5HK8A 1E2HA 1CB0A 4S1WA 3R76A 1NZJA 2QV7A 3CLRD 2JLWA 1XRNA 1KR5A 4XJXA 4A7PA 1R5JA 1WQ1R 1P2TA 1UXGA 3PFHA 3M3DA 1Z68A 3CN9A 3DLAA 3KEQA 3MMXA 2YWGA 5SY6A 1ONOA 3GELA 2V65A 1WU7A 1JIXA 2JEOA 2V7PA 4X66B 3I8OA 1ZISA 2A14A 2VF2A 5FPTA 4GKKB 5G0TA 3UT5B 2EFCB 4FU0A 5KO2A 2OQRA 5D1HA 1FXSA 4PYKA 4M3NA 1AKUA 3F6EX 2OCGA 3U26A 5JYDA 1Y9DA 4JT9A 1HDGO 2O59A 1ZUD1 3OZIA 4XVHA 1RJ9B 3B9QA 4BVAA 4Y1RB 1VE9A 5K3FB 1YKSA 2EGGA 3BQNB 3AR2A 3HKEB 3OICA 1E9EA 2CHSA 1GTMA 3K9HA 5IS2A 4U7DA 1F2TA 4EKDA 1L7QA 1I7SB 1Y6GA 1EFLA 1C81A 1X77A 3TD9A 3FUCA 1FW8A 1LH0A 2YFKA 3OE7A 4TYPA 4ZGWA 3B2QA 4UPDA 4F7DA 2SNIE 1N5OX 1H69A 2FF5A 4OGGA 4YACA 1I13A 4FZ3A 5F7OA 4I9HA 4K6GA 5DN6A 1FFWA 4A8JB 3X1JA 1M0TA 3MT0A 5L4LA 4CEHB 1GPLA 1WB5A 4BGUA 2QTNA 4DJEC 4C88A 1WUYA 3VR5A 2IZZA 2OV2A 4B9AA 1L4GA 1GU0A 1Z5VA 2QAIA 2WF5A 3IO5A 4MLPA 4ETWA 2QTBA 3TUJC 1CLUA 3HYSA 1IZZA 1X1EA 3HP7A 1LGYA 1RQNA 3EY9A 2I2FA 4OXKA 4ZVVA 4HLDA 3EEBA 3E15A 1I2CA 2UXBB 4B6JA 2G5CA 1EJ2A 2WFLB 3VR0A 4XQCA 3X2SA 3U7FB 1T3SA 4INAA 2OE2A 2P6RA 1YC2A 1JJ2F 3W7BA 4MRMB 3UJBA 3VJRA 4PINA 3W1WA 2AUMA 4BJ1A 2XTMA 4XASA 1FX0A 5JY1A 4HDRA 5AM5A 1Z2OX 3SIUA 3LDTA 1J20A 1KJYA 2Q6OA 3WLLA 1U80A 4BO8A 1KZ4A 2XA1A 2ZWOA 3B2NA 4DCGA 4BBZA 4YMGA 5BNTA 2ON6A 4RJKA 1YTLA 2PXCA 5EY5B 2JF0A 4LBZA 2J7PA 5LQDA 4P0TA 1XB2A 1SIBE 1VL8A 1Y8CA 3PK0A 4NAUA 3PXUA 4RCYA 5KINB 1EUYA 1EHYA 2QPTA 4H15A 4AFNA 4ENTA 2HSGA 3NEAA 3AM1A 2A1IA 2RBEA 4BE4A 1UBTS 1W52X 3ZQKA 5FJ4C 1VJ5A 1WIWA 1IHUA 1KYVA 2HMYB 2XUPA 4I6EA 4L5BA 3H2GA 4LZJA 4TN5A 4RBNA 4FMDB 2V4ZA 4X1OA 3T38A 4EB3A 4Z53A 1V5WA 3K8YA 2D1TA 4M83A 5HBGA 2NU8A 4BYGA 5CLFA 3H9GA 2NNWB 3A9UA 4NRDA 2PK3A 1GY8A 3BT7A 1QFYA 1EDOA 1JI0A 3N6RA 2HU2A 4PSDA 1QDUA 4PO9A 2J46A 3LVFO 2DSNA 2EWVA 2YJ5A 3A1TA 3OUTA 1AZWA 4HRAA 5ER6A 4RABA 2PCLA 5JJCA 1I4OA 3IL2A 1U63A 4ZANA 4L3WA 4C07A 4TXNA 5AI5A 5K01A 5JMWA 2G67A 2EP7A 2V6JA 1DZ3A 3D6HA 4NZYA 4QWMA 1XEWY 1JEDA 1UMBB 2I9KA 1JVSA 3AQ4A 4XPIA 1YDMA 5GAPK 3RU7A 3JPYA 2O0LA 3NCHA 4KFRA 3R9KA 1QHNA 5CU7A 3NUZA 3PC6A 2QAGB 1IN6A 1DQNA 3NRCA 3PQDA 5KPDA 5EKTA 2ZZMA 1Q7BA 3S3TA 1PYGA 4HAUA 1UEJA 3EXFB 1XRRA 4UE3S 4O6VA 1JDVA 2OV8A 2XVMA 4J1NA 3QVKA 3JYOA 1CDEA 3KM0A 1IOVA 1R64A 2DY1A 2UZ0A 2QRVB 3C3EA 3JCMM 3MBOA 4I4LA 2VHVA 4TV9B 1RCFA 1Q0SA 1SBYA 3HRHA 3ER8A 4CIVA 3REQA 3DO8A 5JS6A 4E09A 3OUZA 4N3BA 4EZEA 4WJZA 5CEFA 3L6OO 3QUQA 3AETA 4I4TA 5LZ4A 5LD2C 4GLLA 2XB9A 2VT6A 3N2LA 3Q7IA 2IXGA 3EMBA 1ONSA 4X90A 2QDKA 3I3OA 5FA8A 1PHRA 4YR7A 3SG0A 2ETXA 1IHXA 1VIAA 4RTNA 4LRXA 3CYFA 3PVCA 3C6ZA 3V6LA 5HM6A 1VQPF 3AVWA 2X0KA 5FTLA 1BXRA 1LV8A 2WC1A 1IDOA 1CRPA 1T2NA 4P36A 4DNPA 1U3UA 1Z29A 2ZRNA 1ZK3A 2R8RA 4JYPA 1QOPB 5TF0A 1XA4A 1B16A 1LPMA 2R7KA 4UBLA 2DPXA 3K70C 1CJMA 1CNEA 2BO1A 2O4CA 2Y0CA 1MIHA 3NDRA 4WKOA 4H1VA 5EMKA 5LXTF 1KPGA 4D8WA 4EGJA 1AMNA 3E22B 5ELXA 4GDFA 2C8JA 1JLMA 3IKFA 2RB5A 2QNIA 3H1AA 1VECA 4R98A 5B12A 4E03A 1OU0A 4P3YA 2PFSA 5KWVA 3BD7A 2C88A 3EUWA 4D4GA 2BDTA 3SDBA 4D26A 1PJZA 5CB6A 4KWEA 4IEFB 1Z0ZA 4ZYWA 1ZYUA 1TM5E 4LNHA 3LGAA 4DUZB 1NBWB 4C0HA 1BWRA 1EQAA 4JLKA 4CMAA 5AKGA 3E70C 2IHVA 4AB1A 3BWCA 1XELA 1Q19A 4HX5A 1C80A 4ZK2A 3CR8A 2EFDB 4HSEA 1QQAA 3B5JA 2WE7A 2W22A 1NUHA 5HKKA 2HJWA 2R1UA 3CZ9A 3ND8A 3BSWA 2WDZA 3K35A 3QHPA 5DI3A 5EB0A 3F67A 2Y1WA 2AF4C 3M6FA 2N46A 4IQ0A 4WLUA 5DHPA 3UAWA 3UJ6A 3VU8A 5EHXA 4RTPA 4B74A 2HX1A 3W3AA 3I01M 2E5WA 2V3WA 3VI6A 1SVKA 4CF4A 3JQRA 1R0LA 4QJ4A 3IEUA 1NW4A 1T6YA 3E23A 4GLOA 5CXQA 2FRDA 1GO2A 5TPWA 1O6BA 3JVUA 4DKXA 5B1YA 2JZNA 3UO8B 2Q27A 1CUXA 2F8SA 2E49A 4RPKA 4KU4A 4RMHA 4YJGA 4LXIA 2IYVA 3GIDA 2WJYA 4BUZA 5CDFE 2A1TS 3LRXA 5C53B 2Q50A 1Z26A 2K4MA 4JX8A 5E9QA 4FKMA 4MRRA 1XTRA 3QG5A 3UA3A 2C8VA 3ZDEA 2CXHA 4WN9A 5BWCA 4ER7A 2I1WA 2VH1A 1Q7TA 4RH3A 1Q0TA 2P91A 3WLFA 1FMLA 5TGZA 1W5FA 3NASA 4DUGD 3ENVA 3LA8A 4EB8A 4GEKA 5ALFA 1UJBA 2I4TA 2GERA 1B15A 1CF9A 3FKSA 3M6VA 4K9QA 221PA 1YGYA 3FCXA 3RM3A 4ALMA 3U80A 3V32A 3IOMA 4XWOA 4CODB 4QQRA 4DREA 5ITWA 1R4ZA 4CV3A 5SZHB 3NHUA 5JQGA 1XMOB 4L4YA 5CB0A 2GOYA 3ANTA 1P1BA 2WP8J 1KSFX 3F6SA 3M89A 1HMPA 2Z95A 1WU8A 3DVSX 2R79A 4INJA 4URHA 1QYIA 1DQSA 2GPWA 4M0LA 1CJVC 2AS0A 3UT6A 3EZXA 4NQRA 1A4XA 4Q03A 4TV8A 3N6XA 5FUVA 1CEQA 4CN9A 1SKQA 4K9MA 4QQFA 1MGOA 2MSKA 2A33A 3Q85A 1M1UA 1N36B 4R2XA 1N1GA 1OROA 4UXIA 3WHPA 4F5ZA 5JECA 2X5XA 3WLHA 2OHOA 1OVGA 3FTNA 2BSQA 5A5DA 4MUGA 4DR3B 5FR1A 1O0CA 2I7CA 4HRYA 4CQJA 3YASA 4BC0A 3MBMA 2ZBQA 1W9HA 5DFAA 5I7UA 1QRSA 1NDHA 4ZO7A 4PYNA 3Q3HA 3THRA 5EIHA 3RSHA 1M8PA 3GI1A 4EG3A 1E5XA 2FRVA 3UUGA 4RL6A 4J1SA 5ANRB 4INOA 2AGVA 3GLVA 4OI2A 1EK1A 2DF8A 2IU0A 3R3YA 2CW5A 2WICA 4NMWA 3ZV6A 2I2XB 3AFGA 1M54A 3G0IA 4MK4A 4OH1A 1YB5A 1OY1A 5TQ2B 4DLVA 1J2EA 3SSNA 5A6SA 1UMDB 3CGGA 4TTVA 3THYA 1FIUA 2P9FA 3VR3D 5B58T 4O4LB 3SQNA 4YAJA 4DABA 1MEJA 3NEJA 2YW2A 3OZRA 4M9ZA 3FFAA 1C7EA 1JNXX 1M33A 3PFCA 4RESA 1CNMA 3BWDD 4EI2A 3SZMA 1ZKMA 3LS2A 1OH6A 4I8DA 3PBKA 2G9RA 4MUAA 1VJGA 1S4QA 4BKMA 3TGLA 3EVDA 5I9TA 4MR8A 2O0MA 1EZ4A 5U1PA 3C4JA 5KCZA 3IO3A 4MA5A 3TK1A 3X43A 1R8QA 4CV0A 4M8NE 1AH2A 4L08A 2W8BC 5BYAA 1R9MA 2ZT5A 3M6MD 2YMPA 3IR6A 5A1JA 3LUDA 5KKCA 2CL0X 4HKTA 2WSYB 1PT7A 1RMTA 4CTKA 1XMXA 1GTRA 1P9WA 4GM0A 5KSZA 3UKDA 2JAUA 2XT0A 4AP6A 3UMVA 3DV2A 1XZIA 1TADA 5DBEX 1A7UA 5AW0A 2NZJA 3TW0A 1FBNA 1I3OA 1ZI8A 1D4FA 4BLQA 2Y0EA 2BW0A 2XX3A 2CUTA 4EX7A 8ADHA 3S1SA 3FI0A 1PBNA 3L92A 4FHDA 1M72A 3NBKA 1X87A 4XLZA 1R0RE 1T5LA 1PDWA 4OB6A 1F8YA 2IOYA 2P0AA 3EORA 2H8CA 1WMSA 4UMEA 1SH7A 3UMFA 1H1LA 1YRYE 2BGJA 1M8FA 1ENZA 2CDAA 1V2HE 2H1IA 3KXDA 3W2HA 4F56A 3PZBA 1AT1A 1YR6A 3E9RA 3GRFA 3GVIA 1TQDA 3QWIA 4OK6A 4PO3X 2VTBA 5HRCA 4C4XA 4LSMA 1PNTA 2W2XA 3OZUA 3DT8A 1VA5A 2VDKB 3EXEB 2GXUA 4NV0A 1GITA 5AUPB 5JSFA 2XUGA 4XJVA 3RDP