2RHLA

Synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
305
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
molecule keywords Cell Division Protein ftsZ
total genus 101
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhlA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhlA01
3N2GB 3UT5A 3JALA 4IHJB 1TUBA 3HKCA 4U39A 4ZOLB 5BMVB 3HKDB 3RB8A 2R6R1 3JATB 5EYPB 1FFXB 5LXTB 4I50B 4EI7A 5CA0B 5CA1A 4O4IB 3RYFA 3JAWA 3HKCB 5BMVA 3HKBB 2BTQB 3N2KA 4O4IA 3VOAA 5GONB 4DRXA 3WGLA 1Z5WA 1FFXA 1RLUA 1RQ7A 5LXTA 4O2AB 5J2TA 3JASA 4ZI7A 3RYHA 1TVKA 5JCOA 4IHJA 4ZOLA 5JQGA 5LP6B 5J2UA 4O4JB 1Z5VA 5EZYA 3RYCB 3JASB 4O2BB 1SA0A 3ZBQA 2XKBA 5ITZA 5JH7B 4XCQA 3VO9A 3C8LA 5M7EA 1SA0B 5EIBD 4U3JA 3VOBA 4O2BA 5LYJA 4EI8A 2GVIA 4LNUB 4WBNB 4IIJA 5MN6A 5IJ9A 4ZI7B 3N2GA 4I55B 5LOVA 4O4LA 5EIBC 5C8YA 3JAKB 3WGNA 5IJ9B 4ZHQA 3ZBPA 4X20A 3WGKA 3N2KB 1W59A 2BTQA 5J2UB 1W5FA 5CB4B 3RYFB 4X20B 5JVDB 4FFBB 1JFFA 1W5BA 3JARB 1TVKB 2R751 3VPAA 4O4LB 5LA6B 4I50A 5FNVB 4E6EA 4TV9B 3M8KA 4I4TA 3HKEA 5IYZA 5JH7A 4I4TB 4LNUA 4WBNA 3M89A 4O4HB 2VAMA 4TUYA 5LA6A 4YJ2A 4EB6A 5MN4A 4TV8B 1JFFB 3R4VA 5LP6C 2Q1YA 3JALB 4B46A 5IJ0B 1W5EA 2RHLA 3UT5B 3JAKA 4I55A 4O2AA 5LOVB 4X1IB 4B45A 2XKAA 1W581 1RQ2A 2VAPA 3HKBA 5LP6A 3JAWB 3RYIA 5JQGB 2VAWA 4HNAA 4EI9A 3HKEB 4EB6B 4TV9A 4O4HA 5GONA 2VXYA 4X1YB 4DRXB 5KMGA 1TUBB 5IYZB 5ITZB 4FFBA 3V3TA 4YJ3A 3VO8A 5FNVA 4ZHQB 5EYPA 3CB2A 5MN5A 4O4JA 3JATA 5CB4A 3E22A 3WGMA 4F6RA 5JCOC 5IJ0A 2RHHA 1W5AA 5EZYB 4DXDA 4F6RB 4X1YA 5KMGB 5J2TB 2Q1XA 4TV8A 3WGJA 4X1KA 1OFUA 5LYJB 4TUYB 5KX5A 4YJ3B 4IIJB 3RYIB 3ZIDA 5KX5B 2RHJA 5CA0A 5CA1B 4M8IA 4U3JB 4X1KB 3RYCA 3HKDA 4HNAB 5JVDA 2RHOA 3E22B 2BTOA 3JARA 3RYHB 1FSZA 4YJ2B 4X1IA 5C8YB 4KWEA
chains in the Genus database with same CATH superfamily
3PIIA 3TMAA 2VATA 3QE2A 4IO0A 3O95A 4UM7A 3VGJA 5COQA 2XCOA 5EFZA 3RC2A 4WGFA 3ZXXA 3CW9A 2IPOA 1U5CA 2J9FA 2PMCA 4C2TA 2P79A 4IOLA 1XZFA 4DUZB 2RI0A 4YRKA 5IMBA 3IR7A 3GFBA 4K3UA 3HKBB 3U17A 4CDMA 3C15C 3L0PA 4GPD1 5TJHA 1MV8A 1DZ3A 2WAXA 3UCFA 4DRZA 3GDHA 5ITSA 1A77A 5JQGA 4HAVA 5A5VA 3AR7A 3QVUA 4ETMA 3SIRA 4DARA 1QONA 3GJTA 1KH2A 4O25A 2YQ4A 1QIKA 3GROA 1FLDA 2YHAA 3T9CA 1M6EX 4CKXA 4XPZA 5ADUS 3AVVA 1E7WA 5JH7B 2W48A 3LYUA 1PYGA 4I3FA 1CNFA 1MTOA 1W85B 2VYND 3BEOA 4B09A 2H5EA 2IYYA 3E18A 2P77A 1S8FA 5JO0A 2M2IA 1I01A 1SUIA 3PD7A 4JOCA 4W8GA 4IIJA 2YVQA 1FL9A 1LQ2A 2ZIAA 2OT3B 4YP1A 1KE2A 5K99A 3H17A 4D9EA 5G1OA 4CLEA 4FHGA 2E4AA 5LOVA 2ZWIA 4IS2A 3DPSA 3WNVA 3GJ4A 4ZYTA 2UZ4A 4MIKA 1OFUX 1KY4A 3UXYA 1XNGA 2WUGA 3WMGA 4DXAA 1W5FA 4QGHA 1PAUA 2C5LA 2YWDA 3FW1A 3GLHE 5JATA 2LPMA 4AT1A 2CVHA 2BE9A 4FQ7A 2QP9X 3IQXA 5ANRB 2BEVB 1FUEA 3H4TA 1GAXA 2I54A 2EKBA 3M5WA 4B6QA 3NWEA 4DSUA 4JJ7A 5FUQA 3IAFA 4LNUA 4UBMA 1PP4A 2P5SA 1ZH6A 3LGXA 2OUIA 4RAQA 3TLBA 3G6EF 3DBOB 4ALJA 1AKRA 1U0LA 4L50A 3CTPA 3ET4A 1K6MA 4NDAA 4XDYA 2PRSA 2Z2IA 2XMZA 3QUSA 2CLSA 1TJ3A 3KV1A 4WWHA 4WSOA 1N1MA 3I3FA 1L3BA 4R1NA 4X1IB 1OBOA 2FC3A 4KVGA 4QJIA 4EPRA 3OOSA 4KBYA 1XMOB 4GD3Q 2VBFA 2XEXA 4EDFA 4YT8A 3TOCA 2HHJA 1RWKA 1UQUA 5BWNA 1ZVVA 1L5HB 2IYXA 3DCJA 1PZHA 3GR6A 3QFRA 1QRUA 3IQHX 3BCSA 4NECA 3RS2A 4BATA 7MDHA 3ICVA 4CIYA 5KNBH 1Y34E 3L7JA 5IC5A 1QD9A 4L73A 3WP1B 1FB5A 1QYIA 2EWWA 4ZOQI 4GI7A 1AX9A 2BJVA 3D9QX 2WIKA 4V2UA 4Z4IA 1BXGB 2BI4A 1S7CA 3EVBA 3OSUA 3CISA 4UC0A 2O8BB 3TS1A 2VEOA 2QP3A 1JEYA 5G0SA 2QQ0A 2QVLA 1BJKA 1W0JA 3EF3A 5L8VA 3EC7A 4RUKA 2EATA 4Z4CA 3CGGA 3N6XA 4KGXA 4QLAA 1P75A 2DULA 3ZW8A 2NPFA 2FLKA 3HV0A 4H1UA 2VQ3A 2DWUA 1S3IA 4CFYA 4A7PA 2FK8A 5JSHA 1GZ0A 5KB3A 2WNIA 4A27A 4BKPA 2R8YA 1A9ZA 1IDN1 4NMMA 1HFJA 3K4HA 4BFWA 2ZK7A 4YMVA 3HLKA 4EHHA 1TYAE 5ECDA 4KDEA 1EFRD 3VPFA 1C9DB 3OUTA 4EKIA 2GDJA 3WLIA 2XBLA 1BE1A 1U5BB 4NXMB 2B1QA 2J0UB 2FSHA 3AHCA 3K1AB 4G0PA 4X3PA 5EINA 3G68A 4XW2A 5U4QA 4CL8A 4KACA 2XGSA 1E59A 1IG0A 2XX3A 3IAHA 3OMXA 5CX1A 1KOLA 3IOEA 1T0PA 5BW4A 3FNGA 2QI9F 3SEFA 3EXHA 3K2QA 5IT9M 1C3VA 2EW8A 4HR7A 1M1ZA 2GXUA 2RJNA 4ARUA 2C92A 1LW7A 4DGSA 3R23A 4XQEA 2H7XA 3G0GA 5TQ0A 3SIVA 1C0IA 1XCMA 4M7RA 4NWIA 4GZLA 3S4YA 5IAOA 2DBYA 1SIBE 4FBMA 1W44A 3H2SA 5CD1A 5D51S 4MUJA 5A9RA 1ZR2A 3EMVA 4YJHA 3OG9A 3KPWA 1DUIA 4G01B 9ABPA 1EUYA 5CXQA 4LJRA 1IY9A 4QFMA 1Y7IA 1YS6A 3OIFA 4XIJA 5U1PA 2Q5JA 1EX1A 1RIIA 2GHQA 4TVBA 5IXSA 4BT2A 2ZI5A 1CETA 1Y8QB 3DDWA 2ZRBA 3KQHA 2EERA 3TQIA 2EIHA 2OL4A 3ZNNA 4EY8A 2WQ7A 4F3TA 4Z9FA 2WV7A 3EIUA 3KG2A 2HDNB 1HYBA 1YAJA 4KYVA 5KVQA 3SNHA 3AP3A 3UK0A 2QPAA 2FDCA 3DT9A 2E9SA 2GNOA 1XWIA 2UYJA 2PANA 3ZDXB 4OI1A 2FWMX 2XY4A 1RYZA 1OXMA 3AFHA 4ARZB 4RK1A 2E4WA 1G8SA 3QNWA 1CVLA 1KI4A 3DUFB 3IKEA 4JL6A 4JYBA 2ZATA 1HLPA 5L53A 1SN7A 4M7PA 4GGMX 1HYEA 4Q05A 4GKVA 3ZP4A 1Q7TA 3U4AA 2IXFA 3FVVA 1YITF 3H11B 4OGKA 3ZD7A 1ZFNA 1RNLA 2GCPA 2NVUB 5HE8A 5D85A 3FIUA 3CC8A 4CM8B 1IVSA 3CMMA 4AWBA 5HY1A 2ZYGA 1S2NA 4NCBA 4LXYA 2ZR8A 4ENTA 3DO5A 3AM3A 3N58A 4Y2VA 2F59A 2NV6A 3H13A 4OTZA 5KIAA 2YX1A 4FFVA 1XTTA 1XCGB 1L4MA 1A04A 2H9IA 1E2LA 3V2IA 3AFIA 1YDWA 5BRJA 3M84A 3AIIA 5GADl 3NHBA 5A3SA 4OGFA 2RHDA 4NU0A 4QPJC 4H6VA 1WCIA 2GZHA 4Z3OA 1AKWA 2ZTMA 3KZCA 4CQMB 1WDMA 1CLEA 2JEZA 3BIOA 2GTIA 4Y8VA 1R15A 5ALTA 2ZSBA 1KVTA 2Q2QA 4JENA 1STOA 3AVQA 3SI7A 3TI7A 2WZCA 2PS0A 3NT5A 4BGIA 2GPNA 4FYVA 4PPFA 5TXGA 3T3NA 5MGNA 1Q3TA 2Z09A 3U6BA 3A3PA 4IIJB 1AZTA 5BW6B 2BEUB 1PWXA 4MV7A 3VDQA 5E0KB 3PCRB 1BDJA 4FD2A 4G4IA 5LIPA 2C1EA 1JXOA 3QHPA 1ZIDA 2DPHA 1ZINA 1HPLA 1Z0FA 1G20A 2JB9A 1JB9A 3IUQA 4EG4A 5BSWA 4JT9A 3TRFA 1KY2A 1LV8A 3PFNA 1VP9A 3PICA 4KRYA 5J59A 1AQJA 3FJOA 2PKQO 2IYZA 1LNSA 1TZCA 3RU2A 4YCCA 5TDHA 3LPDA 4NAVA 2FUG1 2VNKA 3C7CB 5A4IS 1BVYF 3E4DA 2IPNA 4O5AA 3LT5A 5IM4A 1X7OA 3G6WA 1QVWA 4RM3A 1M0TA 2CB0A 3RHFA 5GGYA 3SICE 1T9AA 4G4XA 1KEWA 4F2PA 3S0HA 4Q7EA 2RGCA 2J4DA 4YCDA 5K45A 3P4XA 2QRKA 1E6LA 3VR5D 1ADJA 4AIIA 2L26A 2P2SA 1VQ5F 4DDMA 1H2ZA 5H0IA 1G2IA 3CD6F 2ODEA 3L5KA 4ZI7A 1AOXA 1S2GA 2CVQA 2OZPA 3F8TA 3B9QA 3KSRA 2OD7A 1CQZA 4HB0A 4F8YA 3IA2A 4IFBA 1UEJA 3FVTA 5DP2A 2DR0A 1AGXA 1W0JD 3BUSA 3IBGA 4IW3B 3GQVA 2G06A 1IHPA 5HMMA 4CM4B 5JS6A 4DZTA 1RLIA 3OCUA 4P98A 2R68A 4UHDA 4JX8A 3VPDA 4ZAGA 1T3LA 3N2YA 4BVGA 2OYCA 4ZCTA 1VXRA 3GHZA 1OBHA 2JNWA 3VRHA 4CKBB 3EDCA 4KJZA 1A76A 4B2YA 2IEAA 3MS2A 2EJVA 3GI1A 4ZYYA 4GXQA 1ZGCA 4D42A 4MI9A 4B75A 4KQKA 3STUA 1JZTA 2QN6A 4LY9A 2DWPA 4PFQA 4HWRA 2QTBA 4GSKA 3JQAA 3GLFB 2OM6A 3NVDA 5C8YA 3SOZA 5JMWA 3IIKA 3SS7X 2W9XA 1T4DA 2DZDA 1B26A 3K2IA 1DAFA 1R74A 5DW0A 2C9ZA 4PZCA 4XVUA 4R31A 1NJ6A 2C3UA 2AQ8A 2CZWA 3FKJA 2DWCA 3GNLA 3T99A 1YZVA 3TSAA 3UXEA 4BFUA 2DH6A 2OHFA 4YP0A 1L5FA 3T3DA 4X54A 2Y1XA 3QF7A 4WBNA 3EJWA 3ZBUA 1B4DA 4MS4A 4BKUA 2J3EA 4LHXA 4H4EA 2O5RA 1UZUA 1GARA 1BWRA 2J07A 2ORVA 2RGUA 2Z4RA 1JAHA 1ACJA 4GX2A 2CVFA 1SZPA 1OYYA 1JLMA 2ZBUA 1L5ZA 1ZK4A 1GITA 1GL6A 2HRZA 4QODA 3DBVO 1R6AA 1R0BA 2L0XA 3QVKA 4XQCA 2YH2A 4DLLA 5JD5A 1RQLA 1KQ3A 1ESEA 2W6OA 1CEEA 3REQB 2WTEA 3GMSA 5BN3B 2WJYA 1MABB 2H7CA 3HVUA 4BGDA 2AWOA 5BV1A 1G41A 1M74A 5M34A 3R9XB 3ZZ0A 2IHTA 3K71B 2ODPA 1Y1QA 1D6SA 4ZVNA 3ZHCA 3KUXA 1GKYA 1MFPA 1OTHA 1GP2A 2ISCA 2Q9UA 1IEVA 2ZBPA 3IQFA 3K8YA 5FWXA 4LF8B 1P7YA 2Y76A 2PS1A 6PFKA 1XV2A 2FN7A 3L9XA 4H1VA 4KIUA 4QLBA 5BN4A 1T25A 5JAMA 2FR8A 4FIZA 2V96A 2RBKA 2BAGA 2XQFA 4YRAA 3KZ1E 4ZI5A 4ZHYB 4X1KA 1E8MA 3CMAF 3QKIA 3IV7A 2EV9A 4IH9A 2Z43A 3SS9X 3S2GA 1P39A 3LLUA 2E4YA 3G88A 2WD7B 1Z2DA 1JBKA 3TL2A 5CFRA 1QS0A 1ES9A 2WM2A 3O74A 4TQGA 4FBLA 4ZEVA 2I4LA 4HFMA 2Z1UA 3SHTA 3V8EA 1H2AS 3ZUPA 5ICGA 4RXTA 4KO3S 3QVVA 1C3OA 1MDFA 4US0R 4NMHA 1E1RD 4DJAA 4N5LA 2WTNA 5FV7A 4BO2A 3PITA 3ZBTA 4TL7A 3D2LA 3JALA 4MUFA 3RC3A 2BUBA 2QX7A 2QT9A 2RGAA 4GLOA 4KFRA 4CEJB 4HUTA 1AO3A 2OFWA 4IHAA 1U98A 5I9IA 4PV7A 3TJZA 3C5CA 2H7VA 2J31A 2ODWA 2YNMC 4GH5A 3AVWA 2KQUA 3RU9A 1EFUA 2MR5A 3ZWXA 3OFND 4GNKA 2Q4OA 1PHPA 3BX1A 2H00A 1E3TA 4RK4A 4MGKR 4YP5A 3THRA 1DI0A 3S40A 1OH8A 2YC4C 3ND8A 1Q7YH 5CFNA 4BBJA 3CPSA 4M87A 2J4FA 2AUNA 4AF6A 2PVSA 2RARA 2G9IA 2O2GA 4OQDA 1NM5A 5C18A 1EDEA 1JHMA 1UXJA 1RM5A 5KPJA 5K1ZA 5BR8B 4Q7LA 4TSFD 1ZICA 5FOSA 4ZTBA 1C7QA 1RYYA 4FW9A 4TSFA 4JI0B 3D3KA 2ZE5A 3AY7A 2RSLA 3CSSA 4LUCA 2RAPA 5EO3A 1EDBA 1X8LA 4QUGA 4P8RA 3F0TA 1KAEA 2A14A 1P4JA 1FTNA 3D3QA 1IPHA 1NE7A 2C5AA 1ECGA 5HF6A 3DDUA 4BB0A 4HP8A 1EVJA 3CXCF 1ORRA 5F5XA 3TLZA 2IF2A 3CTMA 1WJGA 3C7DB 3ZZMA 4A5SA 4CIAA 2C77A 2BF7A 3EZGA 3C8ZA 4BKMA 4F9FA 3LOQA 4LG1A 1ODTC 4FT2A 1JECA 1PT7A 4IVRA 4ZAWA 4AF7A 4QXOA 1FUUA 1ORVA 2PRJA 1O94D 1DU4A 2ZUWA 1NWCA 1BFKA 1BO6A 3WAGA 4W9NC 3I5MA 3F4LA 3X2EA 5LA6A 5G0UA 3WIBA 3DC2A 2PEZA 1DC3A 3NUZA 2F43A 4C7BA 4EGCB 1MQ8B 3TX6A 5L40A 4L8VA 2Q1YA 3C1OA 4BZZA 4Y6PA 1AO0A 3GT4A 5C1OA 2ATIA 5AVYA 2ZCJA 5DOVA 2XJ9A 4WXRA 5AW5A 2VGNA 1LI7A 4B45A 2H0AA 3NWOA 1PR3A 3FFXA 1A7JA 1XRLA 2EGHA 4ENUA 4JEHA 1ZL0A 3F3MA 4QGFA 4RY0A 3C1TA 2Y1OA 5H70A 5ELXA 1NVKA 3UJBA 1EFKA 3CIFA 3SGLA 4TV9A 1FFHA 3CH5A 4KRFA 2LBXA 3T7RA 1URPA 4QA9A 2NU6A 1PEKE 3OOHA 1J21A 1ZOPA 1DAGA 4KLZA 2IQQA 5TEVA 1ZM9A 1Z68A 3GRVA 3JATA 2VJQA 3KAKA 2E89A 3HA3A 1SZQA 2CLLB 2AUMA 3TJMA 1W42A 1T0JB 2Q8PA 4QO7A 1ZY2A 1WQ4A 1JKMA 4MHOA 1QHHA 2F43B 4DMMA 1T13A 1EYZA 2ZWVA 1XD9A 4Q9AA 4PQFA 2FPKA 4V0QA 1TK3A 1KQFA 1MOPA 3ILHA 1KXJA 1Z13A 2P5TB 1YVUA 3GFVA 3C3EA 4OP3A 5F12A 1CTQA 5DH9A 1I5EA 1VDZA 4YH1A 2KB0A 4A2CA 5JZVA 2DFNA 3DJFA 1QRDA 2AQIA 2GA9A 4I6GA 4YGYA 3EEYA 4BNVA 1U2EA 3ZNPA 2UVPA 2P9HA 1OWPA 2G6TA 4QFBA 3VNBA 2VL7A 1B16A 2GOYA 2JLZA 2JVKA 4R9NA 5BOSA 4GWGA 2BM9A 1S2DA 2R96A 2XYGA 4HFJA 1V7PC 1ILEA 3D64A 3K09C 4LC1A 1T2EA 4LWPA 5T4HA 3I92A 1YR1A 4TT3A 2WSYB 5TT1A 3SK0A 3RSGA 4RIFA 4RIIA 2C7BA 1TMYA 2Z0MA 1S2LA 3A05A 1KA9H 2HIGA 3S5JA 1LBEA 1NM5C 2QJTA 1GO1A 4HATA 1NQ3A 3NI2A 4MKXA 3VKFA 4PN7A 4ZCMA 4Y0VA 4BFXA 4H77A 4JODA 4K0RA 1GNTA 3SYTA 4NCJA 1A8SA 5BVGA 2FGYA 2CHTA 2O8BA 3EASA 3QLTA 2FNAA 2QVGA 4TL6A 4CKWA 4XUGB 1X8JA 3O4JA 1M3SA 4QEDA 4OHZA 3KNZA 2RK6A 1MX5A 2IELA 4FYXA 3BTVA 4W5HA 2HCJB 3OZRA 3UV3A 3CKLA 3TN7A 5JLJA 4DF3A 2BM8A 5ITZA 5LOVF 4HAOA 2HRYA 1V4VA 5BYJA 1LCIA 1XAHA 3OO0A 2HGSA 3R3VA 4RKQA 2EX1A 5HK8A 1M34B 3KVRA 1TM2A 2RBGA 3DOEA 5DBIA 4HLUC 4KVFA 3TSWA 2E4ZA 2BI7A 4MEAA 3QIVA 3WS7A 5A3VA 1UJ2A 1TXGA 2EFGA 2B7LA 2H6EA 5FPHA 4L4ZA 1GQQA 2P62A 3CLKA 2XHEA 3A6LA 3GW8A 4N7RA 1U8EA 1KVQA 1WDTA 1JG1A 4N5MA 2GN0A 5AW0A 4GDMA 2FSFA 3C7AA 1AG9A 1AK1A 2QAGB 4JQOA 3PNBA 5ALDA 1G5QA 1R6UA 2PUTA 2HF8A 3TLCA 2VKTA 2PX2A 3HCEA 4B7XA 4NTZA 1QVFF 1HXHA 2XIQA 3DF9A 1XTQA 4MWGA 3V3KA 3ZDRA 4AZSA 4MHTA 3I0NA 4HDMA 5JCJA 5IH3A 1YJWF 3PT5A 3AIMA 2WKWA 2AN4A 2FOLA 3E9CA 3CC2F 3MDOA 2VPXA 5C34B 2Z3WA 4XVCA 1EHCA 3DMRA 4ZK7A 1W5EA 4CKYA 3RVJA 2BZ1A 1E6EA 1V8FA 3GJSA 2B82A 2E48A 2QU8A 3AP1A 2NU8A 5KZMB 2LD4A 4NC9A 3A1NA 4OAPA 1L1EA 1PVDA 3L1UA 1RQ2A 1H94A 1XCLA 3QHQA 2Q5IA 3SFZA 2VAWA 1QZZA 1RRCA 2ZAUA 5IT0A 4V0SA 1W4CA 2PWPA 3FPBA 1SBIA 2XZDA 4ZRDA 3MJDA 1DZIA 4NCIA 3SX4A 1T5SA 3WLAA 1WXIA 2QGNA 3CG6A 5T4FA 2NPOA 3ZXYA 3ZJ4A 5AM2A 1FVOA 2UYOA 3RAEC 4XWOA 4WA7A 1TEZA 2Z6UA 1RTTA 3H0EA 3BBPA 5IG2A 2WF7A 5EESA 4ILEA 3CUTA 2N75A 3B2EA 4IJVA 4HX9A 3RA6A 1KR2A 4F6RB 3ASYA 3WZMA 1HL3A 2NG1A 2Q50A 3D7MA 5J2TB 2DGDA 3EWIA 1SPBS 3QKTA 1QTIA 3KEMA 4I7EA 3AEQA 4N47A 2X0FA 1VCOA 2PMWB 5JI2E 1IC6A 4KXYA 4ES6A 3MUNA 1RCUA 1SXGA 1QAQA 1ZYUA 2ZDGA 5I7WA 2W2MA 1OB5A 4GFDA 1OXUA 5FUWA 2BFBB 3MELA 5E4JA 2GN2A 5HXUA 1T3TA 2WR8A 4X00A 5ESWA 2AD1A 1XTVA 2OESA 3DMFA 3ZVNA 2GYYA 2IEIA 4QRHA 2CE7A 3IP9A 1RAHA 1V1RB 3V2GA 3KZXA 1GR1A 2LVBA 4KWEA 3JQAB 4RMGA 1G291 3GLFA 2A1UA 1K3TA 4C7JA 3EC2A 2APJA 2V9YA 3JY6A 3AUAA 2WOOA 3L43A 3ID6C 1ZC4A 4NSNA 5HKAA 2BV3A 2N46A 1JEQB 4C4SA 2P40A 3C9TA 1L5KA 4DKXA 3GARA 2KLHA 3X44A 3SSNA 2XRZA 1DRVA 3NBKA 4HGYA 1EFCA 1GGFA 1OAOC 2EBWA 3O38A 4LBZA 3AEQB 3NOOA 4QQKA 4C1BA 3HVRA 1EUQA 1Q0SA 3DL2A 4RCVA 1Z8DA 4BC0A 4KHPB 2QMUA 5JPIA 3A06A 4AG5A 4BVEA 1HNZB 4ZOLA 5GWXA 1QAHA 4XGQA 1V37A 2X77A 4ZRMA 2CJFA 1T3HA 4QXQA 4Y2RA 3FOFC 3FGOA 2NVOA 2CNWD 1PJ2A 1E1MA 1LK5A 1YHQF 1QYXA 4WFKA 4CMGA 1A2KC 1BW9B 1YGPA 2FPPB 2HN9A 5LM3A 1QIIA 3UY4A 4XB6B 1PD1A 1YI0A 3T3EA 1DQSA 2OORC 2ZJ4A 3MRVA 3DV0A 3ZG6A 5BWLA 5EJ6A 4QAJA 2VHWA 3QELA 1ISGA 2QUIA 1HDXA 3C8DA 3VQTA 1XD2A 2IS2A 1X7GA 2XF8A 3H1PA 3LVQE 5E4FA 5AW4A 3R0IA 4MW5A 1J0DA 1E4EB 3CN7A 2A3NA 3DOFA 4A0SA 1OI3A 2Z9DA 4OD0A 5AVOA 3BMNB 3OQIB 3OVMA 3C70A 2PV7A 5HUJA 1NW4A 4DG9A 1ZJWA 1EQAA 1FNDA 1I0ZA 3MPUA 1VE5A 2CLEB 3WBFA 1JW9B 1US8B 2DLCX 3EY9A 2L18A 2KG4A 3AUXA 4IUDS 1S2IA 3FLEA 2QVYX 3TTTA 3SXUB 1YRYE 3BQNB 3R9WA 2ZAYA 4OK5A 4YIHA 3EPRA 4Q12A 3T12A 3E1GA 2IOYA 2JFFA 3DLTA 3N86A 5FBKA 3RC8A 4XJSA 1KZHA 1Z4PX 2XTJA 4DLSA 5KOYA 3VU9B 1WZ2A 2UZ1A 3SQXA 5DGCA 2XI4A 4NYJQ 3IPLA 1CFZA 2ZIXA 2I9KA 1UC9A 2GJ8A 1BMFA 3V55A 2ZI3A 1ORTA 2HK6A 2JHAA 2JFUA 1TW2A 1JHQA 2YRWA 3FYCA 4M1OA 1LWNA 1PW7A 2HWYA 4AJ9A 1W49A 4M83A 3VO8A 3WQSB 2FW6A 2V45A 4BX3A 1JHYA 1S72F 5TB5A 1NQWA 4O0MA 3RTBA 1YJCA 2PJZA 3D4NA 4JC8A 2PH3A 5CLHA 5EP3A 3AOEA 1SVWA 2P9YA 3OOYA 3UAGA 1W5AA 1IQ0A 2OBBA 3O4VA 4HDRA 4AULA 3KSZO 1U1EA 221PA 2P1RA 2R8EA 3JQ8B 2ZSJA 4DIBA 4KOAA 4WJZA 3ZWMA 1NV8A 3FZEA 4C1NA 4DS3A 2I2AA 2W6CX 5KX5A 2A0FA 2JFBA 1ZSVA 4QTZA 4UBNA 2FF5A 4DCSA 4A15A 4PGAA 1X9HA 2OXTA 4ZHSA 4G9GA 5G53C 2V4ZA 4EHAA 1TCAA 4DLBA 2BDTA 4D9NA 1HT2E 1XXHB 4D5GA 4YB8A 5DFAA 4G1BA 5DULA 3UF0A 4ZVSA 1JD1A 2VG8A 5SYMA 4CLOB 5JVDA 3DZJA 2YYSA 3DTVB 4DJ5X 3HCWA 2OLKA 4IEIA 4S05A 3NP7A 3TQQA 4LHVA 2A0UA 2IS1A 3TXXA 4MQUA 5HDQA 5AJYA 2I2XB 1IN1A 5GIPC 3HB9A 1E89A 2WFMA 1OWNA 4NZMA 3QOFA 4AQYB 4OHCA 3JATB 4QICA 4OGWA 1KZ1A 1RKXA 2Q28A 4MGHA 2R1VB 4Q4LA 5B58C 4I5EA 3T7CA 5IX8A 4AJHA 4PG5A 3TWOA 4CIBA 1UANA 3H05A 3O92A 1WQ1R 2EHDA 1XVTA 1JIKA 2B6NA 5DHFA 1ZBDA 3ELBA 4PGFA 4K03A 5FTMA 4EY6A 4WZAA 4E31A 4I8XA 4US2R 2OWEA 3Q8LA 1TB4A 1Z38A 4MPTA 4X8LA 4RHAA 3ZE9A 3AJ9A 3VIUA 3AR4A 1XGKA 3EIQA 4CCSA 5K09A 1Z29A 2G4VA 1A72A 2OLJA 4QT0A 2HSEA 3KJNA 3RO7A 1CKEA 4J49A 5FO0A 3OM1A 4CCYA 3TG8A 1RJGA 2PZGA 3V9AA 1GQYA 1TDJA 4IUBS 3PF9A 3Q9NA 4NRDA 5AVVA 2DBZA 1P7ZA 2WVGA 1R64A 2OOKA 3OKAA 4YA6A 4YDSA 3K32A 5ALKA 3B5JA 4XDGA 3L4EA 1QHIA 3MM4A 3SLRA 1IZZA 3PDIB 1U0EA 3B13B 4GL4A 3Q5DA 4A8JA 1DHTA 1AKNA 3Q0IA 3K20A 3L82B 2D1SA 1P81A 4OH1A 2A84A 4P3YA 1JEDA 2CD9A 5AOCA 2FP4A 4QRDA 1YJNF 4UHCA 2I99A 2OXCA 3FDIA 3FTCA 3WLHA 5AFSA 3A7EA 1SU7A 1ZAYA 1ECJA 1YRWA 4EKGA 5LA6B 4S35A 2ES4A 4K0KB 1VJDA 3MCTA 4JUCA 3AP2A 1U3UA 1D8AA 2EEPA 2WTBA 1YB5A 4HBZA 2ZQZA 1NJ2A 3ABIA 4M1MA 2WWXA 1YKGA 4QPDA 4C6TA 4CTMA 4DWOA 5LMUB 2ZANA 3CUSA 4K87A 3PS9A 2ORWA 2DB3A 2RH5A 1CEYA 2Q41A 2ID7A 4DUYB 3W2GA 1AS2A 1RW4A 1ZRMA 3VI3B 1UQRA 4G88A 1II0A 4IH1A 4ZYXA 1MV5A 4D9GA 1ODEA 1T5LA 5BUCA 2UVDA 4B34A 1XLWA 2JIPA 1F5SA 4JKYA 3H1BA 1T4GA 1OPXA 4ROSA 5ADWA 5B7NA 3I39X 5BQXA 5C8YF 4JBHA 3DVAB 3LOPA 4M0DA 4OGLA 1LNZA 3R8CA 1HFEL 5ESDA 3TD4A 3LXMA 4P81A 4ZXPA 1E20A 4HVLA 2VA9A 3OPVA 1Z26A 3B51X 1NVGA 2CHEA 2W90A 3FPFA 3WLNA 4C4PA 3A4MA 1YR7A 2QX9A 5AJWA 1PN3A 4YUZA 5I8PA 1C29B 2Y8EA 1SUEA 1HY3A 4KUEA 4ENRA 4MYCA 1XDSA 4DLXA 2I66A 4N5DA 4MUHA 5KNCD 3VA7A 2A5LA 4GEGA 4ASUA 3GGJA 4A8HA 1MOZA 1UM9A 3G89A 1UKZA 3UB4A 4ZU1X 1JQBA 3BH7A 4RPLA 1DP4A 2BHRA 3ZHTA 4Z9YA 3EFHA 3LXRA 4XYEA 2W6ZA 4D9FA 2B4AA 2GN1A 3LDAA 3TE7A 5JCJD 4LTNA 4MO9A 1R9GA 2DTEA 2Y1CA 2G63A 1Z4NA 2PGJA 2ZWMA 5FWAA 1BX3A 2IXTA 3B6MA 5JC8A 3KTAB 3TDKA 4TMZA 1K68A 5FOVA 4URXR 1DEOA 4BWGA 2R1TA 2UXCB 4UUMA 2VJPA 3U4QB 1KMHA 4RQAA 2ZJ5A 2IUTA 1Q2XA 5IMSA 1VHDA 4QOSA 5TPZD 821PA 1YZGA 2ZYTX 1C8LA 1EUZA 1Y1LA 5K3FB 3K0BA 2I6XA 3PFIA 4P3XA 2H4JA 1T91A 2BDEA 1UP7A 2FWPA 3NALA 5EHGA 3DE1X 4CPDA 1L4EA 1YZTA 4IDAA 3NU1A 4IG4A 2WYIA 4HJRA 3FFMA 1DWQA 4NONA 2QL7A 1SHTX 2CNLA 2UZ1B 5ICEA 5L3QA 1DBQA 1M2FA 1MZVA 3VHQA 5FUVA 4MZDA 1D9XA 4K9SA 2V0CA 4XR9A 4ZVPA 5LYJF 4M9SA 3WLQA 1MN6A 3UV7A 4QQRA 5I8ZA 1DRJA 2ZJ6A 2P0EA 2R6GA 3JASB 1NFRA 3PF8A 4IGAA 4IIBA 4PBSA 3W3ZB 3L41A 4FMCB 1W85A 4WZBE 4F1JA 2IUSA 5C4MA 4HCJA 4LVCA 1H4SA 1JN0A 1MJFA 2XECA 3WWEA 3IEMA 2PUAA 3C4VA 3WRVA 1EM8B 4Z5XA 4J76A 1E9AA 1MMFB 1DRKA 1E2EA 4ZPJA 4O2BA 4ZQBA 3KAJA 1E5TA 1E7RA 3VKUA 3WQRA 4KTVE 2Z8YA 2R1ZA 3BIWA 1DKQA 1JR4A 3MIIA 1KH1A 2E49A 3O2NA 4M0KA 5NULA 5JAHA 2CL7X 3FRIA 3OQNA 2F4VB 1VHLA 3TRHA 3GOQA 5IP5A 1ISJA 3NNSA 4P5EA 3DE7X 3WGNA 2Z1NA 4EF6A 3LXXA 1H2XA 1UPBA 2OE2A 2BKVA 3BERA 3IV6A 3RBAA 3P0JA 2AF4C 3G02A 1KXZA 4B62A 2ZSUA 3IT2A 4RVNA 5E2AA 2RJOA 3RVBA 5A02A 1P4GA 4WLUA 3E5HA 4XGIA 3UNXA 2FSIA 2XE7A 3NDPA 1B23P 3ERNA 1XEXB 1XZIA 5GJWC 5TQJA 3ZHSA 3D8RA 3RFTA 2IGTA 1B6GA 2A9KA 1N2BA 4R1OA 4FEYA 1N1GA 3AXTA 1NKVA 4IGFA 2EVWX 3MJ4A 1DTWA 1DCTA 1NYQA 2C54A 4NOJA 3UWPA 1NBWB 3PTAA 2AH5A 3NVMB 1T0AA 5IEJA 3GJ7A 1U7DA 2CL0X 4LYJA 4BNDB 2QRPA 2WUEA 4NWOB 3IUEA 4HGZA 4R9RA 4B3DA 4ICIA 4JXZA 3AYXB 4EI9A 2D5BA 2BZGA 2VJNA 3OQ6A 4V2IA 2CCKA 4XWKA 1GUAA 5HFNA 3EPHA 1J49A 5EMJA 4DJEC 3KB1A 3TCKA 1YR9A 5REQA 2H0QA 3GJZA 1PWZA 1E64A 3PLRA 4HGNA 4LVUA 3UMBA 1P73A 2IHBA 2WWYA 1UQTA 2CDRA 3ETDA 3ORHA 1NG9A 2W93A 3ZGXA 1QPBA 1IRIA 1RVDA 1ISSA 2H2GA 2WJAA 5JDIA 5SZKB 3B3AA 1U90A 3Q2KA 1YBFA 2F7SA 2C95A 1G8HA 3SSOA 5JCXA 3S2FA 3QMWA 4UVGA 3SC4A 3JWGA 1DTWB 3PNYA 3WRXA 3ZD9A 5JTUA 5LYJB 4TMWA 1JV2B 2GZLA 4MVYA 4L7QA 4U6NA 3VZDA 1ZW6A 4C6HA 2VDWA 4PNPA 1QH0A 1SD1A 4X64B 1QIGA 5F64A 3QUQA 4HDSA 5FORA 2JAWA 4AJJA 5I7UA 3JPWA 1DARA 1NR7A 4YV0A 3UEOA 2UUBB 1NXPA 1FF9A 2HTEA 5FHQA 1ONBA 4DEVA 1DT9A 3AFNA 1U0RA 4Y9UA 2OCDA 1P0PA 1CXZA 5FBWB 4ZZIA 1KTVA 4L4RA 4RL4A 5HNKA 3P32A 1U0JA 4ZU6X 2BBOA 3GRZA 3IKVA 3OW2F 3F6EX 3PTLA 4N7MA 4BZWA 1LXCA 1V9SA 2HA6A 2YICA 4BLUA 2DUWA 4M9ZA 1VQVA 4ECEA 3CWQA 4ERXA 1B8OA 1T2DA 2EJBA 5JCZA 4O4IB 4YFYA 4JMLA 2FN8A 2O2HA 4KE7A 4M3NA 3DKVA 4MWZA 2JHPA 1YL6A 2JRCA 2XA9A 3SWWA 3CZPA 2BTQB 3UOWA 3BMOB 4NEQA 1NW3A 1QYDA 1ZMOA 2V0NA 4AYWA 5IU6A 3CCRF 2WT4A 1AKQA 4MI3A 4H59A 1MZPA 4DG5A 3D1LA 4PC2A 5AKIA 3S70A 1XRMA 2ECQA 2MIIA 2CSLA 2DWOA 1ORIA 2QG4A 4O4JB 2X4DA 3AKEA 4LQDA 5EFOA 2Q7XA 1L8AA 1WLYA 4M8LA 1VIMA 2WQZA 4WZBB 1N4AA 4PRKA 3VYRB 1VQ1A 1T1IA 1HQYE 1OLXB 2NU9A 3D81A 5B30A 5MFPA 3T5TA 1JDJA 3CA8A 3AETB 1II8B 2JI9A 3K5HA 5SICE 3A2KA 3EGDB 3HXLA 1NN0A 2RGRA 3VSCA 1NNEA 2F00A 1U3LA 3MD9A 3VX4A 3AWDA 4MGYR 7REQA 3EXAA 4UMVA 1JA0A 4HMQA 1CYDA 1V4BA 3H2ZA 3ER8A 3WMXA 1WLSA 2QS9A 1AUXA 4P54A 2I2CA 3MCWA 4LJ9A 4MV6A 4DCJA 3FOEC 2D0OB 1EDZA 1K7CA 3RK4A 2AG5A 3M5PA 3WLEA 2IYOA 4I1VA 3VFDA 1TEHA 4CIWA 2UUAB 4KEAA 4LOIA 2AIFA 4QUAA 2X4GA 1Y3HA 2VJOA 4KI0A 3PGVA 1JJVA 1Z35A 1FMLA 4PPYA 1IVNA 4WHMA 5EKSA 1P2BA 4BTEA 4Z7NB 2G5CA 5A1JA 1Y5NA 3F67A 3LT1A 5AK6A 3F8SA 2WU4A 4G5XA 3R6TA 4PPQA 5ALIA 4RTNA 3L8MA 1GG8A 3FNHA 3HBFA 3KLBA 2C2YA 2J33A 3CYQA 4PY2A 2B1IA 1MJHA 4YCNA 3HWSA 1H2RS 5KWIA 1GPWB 2BFMA 1AVTA 6LDHA 1J6UA 1KYTA 1EUDB 2XW6A 2I2FA 3RQIA 3ZP7A 1FLNA 4EFMA 2FAXA 1XWFA 2WMNB 5EZ5A 1HYGA 1KY3A 3LX4A 1UXKA 2JLWA 4EDHA 1Z4LA 3DWGA 3N75A 4ZANA 1YBHA 1JRLA 1J42A 3DOUA 1IJEA 1ONOA 3NHFA 4Y1EA 1T43A 1JLRA 2VDUE 5HMLA 4CKEA 8OHMA 2F64A 3GEMA 1R3DA 4AURA 1IMOA 3PXBA 1SCBA 1FQWA 2W43A 4P4TA 2UZ3A 3E2PA 2B30A 2HZ7A 4ER6A 1L7PA 1FP7A 2PLRA 5IWCA 4HEQA 3F6PA 2H2IA 3P0EA 4X8OA 3ANYB 5DLDA 5CW1A 5TGZA 5JDCC 3MGBA 4NZOA 5A5DA 2B8EA 3K4QA 3QI7A 1WAMA 5AR1A 1HNNA 4LKRA 3W6UA 2NSHA 4XYGA 2XHZA 1L3IA 3SMVA 1M1YA 3TPCA 2XOEA 3S03A 1I32A 3LHIA 3U31A 3ZU3A 3LBHA 5F73A 2GPSA 2HYDA 4LHSA 2B4YA 1ZNQO 1RXCA 2R7NA 3AF5A 1LLDA 1OGYA 1SFRA 1W34A 1N2CB 4BT4A 3CT4A 4II2A 4EFLA 2JLXA 1Y9ZA 1A8PA 3I2KA 1D2HA 1NW8A 2Z1FA 5KREA 4O8ZA 4R2XA 1MIOA 3TRDA 4ZVOA 4AMGA 1E3LA 5GJVC 5EHNA 3BMCB 2AA3A 2OO5A 4QUBA 4G86A 4R9UC 2QQFA 3L7OA 4WZ6A 4R1LA 1F4VA 2ABWA 4R41A 3WRWA 1O8CA 3PGA1 3ZK9A 4EPVA 1QPGA 2XGJA 3UUEA 2C57A 1T0KB 1NRWA 5AQ1A 5C35A 3CWCA 3P52A 3EQ7A 3U3MA 3G8AA 5E7IA 2MHCA 5F76A 4DYDA 2JK1A 4MRPA 4GP7A 3OPYA 1VRWA 4HNTA 3UMMA 2XTMA 3V7YA 2EEZA 4B7AA 4EHLA 1XQ6A 2PS3A 3IJEB 3K92A 4F4CA 3QWIA 5G2OA 2JD2A 3EEOA 1GY8A 2AE2A 2XMGA 1JT2A 2DM6A 4UUQA 4PQEA 4XDHA 1PNTA 4FX5A 2QTAA 3JZFA 4D45A 1A1VA 3W5UA 4EW3A 5AIBA 1T4CA 1AKEA 4O1MA 2JLCA 2ZLBA 2HXYA 2XSZD 1N5MA 4I1IA 4QIHA 1KK2A 4AB1A 2WUFA 1W96A 4BT3A 2DVMA 1UJMA 1O0BA 4C06A 4X7RA 4HJXA 4DLWA 1A9QA 4LPSA 4BVKA 2OFPA 3O8DA 5F4BA 3LPNA 1VQNF 4A1OA 3W6PA 3ADBA 1Q1AA 5IXYA 4Q03A 4RMIA 1GUYA 1VMIA 2WFLA 3WK6A 2ZRHA 2KJQA 3OM8A 3HU5A 3NAGA 2QPLA 2B8JA 4TVSA 1EK2A 1RI3A 4NZZA 1WD5A 3K2XA 5H1YA 2C04A 3KQUA 2CZCA 2PPVA 4AMYA 1D2GA 5JJIA 1D0IA 1Z0SA 1EZZA 1P9OA 2VGMA 5AVQA 4AKTA 4C43A 2MU1A 3OTHA 4M1YA 1T15A 1XOIA 2E87A 5CNMA 3M33A 1DHRA 2WJ3A 4P7GA 2RD2A 2C1ZA 1R6VA 4TLEA 3GLHB 1PUJA 4CKBA 2PL9A 1A9SA 1KO5A 2I1LA 2J9YB 3JV7A 3A1EA 1KP3A 2ILVA 1M1UA 4K88A 4LZZA 2SCUA 3CE9A 4NAHA 4QAQA 3I5YA 1BZYA 1VG1A 2FPIA 3O5AA 3UXMA 3G1WA 2PRZA 4PZUA 5ARDA 2W4MA 3RIXA 2QE7A 1Z3IX 3VPSA 1QLJA 3EXIA 3CQ9A 5AKXA 3WL8A 5JSUA 1DG9A 4S1OA 4RKEA 2VS1A 5BPHA 2ODBA 4Y6QA 3DMNA 4INAA 1KMIY 4RZ2A 1SCJA 3ZK8A 5LOVB 4TTPA 3QVLA 4R84A 1N2XA 3R5TA 4RIEA 5GVRA 3VI6A 1KRHA 1QOQB 2AEFA 2IUYA 3UMGA 3W9UA 4EGAA 1VL0A 2W8BC 3HVKA 1L3CA 1RI4A 1KAOA 4G23A 3LA6A 3KKQA 3ZJVA 2KE5A 3CO5A 4GPAA 1H7MA 1N8TA 2D1QA 3IDFA 3OZ7A 3U2QA 3OJLA 4RF4A 2PYIA 5BWOA 3B9BA 4WECA 1U99A 1ULTA 4DREA 4JLOA 2WMYA 4GGPA 5JS1A 2IT1A 3I8OA 5L7TA 5G1PA 5LQKA 2WYWA 3LBYA 5HRCA 3QFHA 3KS9A 1PBNA 1CF9A 1PFYA 2XVXA 3A6ZA 1JG7A 4H17A 3GJ5A 1E1QD 5AICA 3UUWA 4YUYA 3LHSA 2B7BA 4WKOA 3FPEA 1WUKS 4KQIA 4M0MA 3UC9A 2O5VA 3NBQA 4UDNA 3AUKA 1RWOA 1W0KA 3GDGA 2P4UA 3V32A 3JWPA 3FMVA 3PUWA 2QTHA 1MEJA 1ZIOA 2AMLA 1Y9AA 3DT8A 1T2VA 1O87A 4JVNA 4MLPA 1OX5A 3RVNA 2H2FA 3UENA 5LU9A 5K3FA 1YGYA 3N4ZA 2EFYA 1EGAA 1II9A 3CLRC 4GBMA 4RXUA 4X9XA 3T4UA 4H27A 3P27A 4QKQA 1VLVA 1AE1A 2Z8ZA 4WV3A 1CVRA 4M53A 1GFIA 1MXFA 2C3YA 3B1VA 5CPFA 4CTNA 3PUIA 1OC2A 4Y18A 4GYKA 3TIXB 4A8JC 4K9OA 2ENUA 4N49A 4BVLA 3VVLA 4PLGA 5CA1F 2JGFA 4FFWA 2WF9A 3ICPA 5J4VA 4UXIA 3SKYA 3WLLA 4AJ4A 3RYFA 1CUVA 1V16B 3KOMA 3DG9A 3QFTA 2F1OA 1Z0DA 3MG9A 4KK4A 3SN6A 4RVHA 2GPJA 2YOHA 3ZJYA 5FPQA 4NESA 1IZYA 2AN5A 3ITEA 4HO1X 2IPLA 4PYOA 1TK9A 3GUZA 3K72B 4BY9D 1FRQA 1RE1A 1XTJA 2CDBA 4LXHA 4TQUS 2NX2A 5TVKA 3W1WA 4AJ2A 1YQGA 1K9VF 1VJGA 3Q0TA 4WPGA 1A71A 1OHHD 1JR2A 3DDSA 5IKPA 2W6PA 2PAFA 2D54A 4RQTA 1QIJA 3MRXA 2ZFUA 4UW9A 1M8GA 1UJBA 1E77A 1ZOSA 4ZO7A 2ZULA 2R8PA 5CX4A 2VAXA 2VAVA 4U8HA 1ISIA 1U8UA 2IHVA 3ANSA 4ZU3A 2GEFA 3DMHA 3MGGA 4IF6A 4P3OA 1XCOA 2HMAA 2NUAA 3WK5A 3MD0A 3W7BA 4LAFA 3T7KA 1VBMA 3EZYA 2I7VA 3CB4A 4JT4A 3GT3A 5CLLA 2DETA 1ZA2A 2FZCA 1JYFA 3NTVA 5EJMA 2CLKB 2VC2B 4KQ2A 2DFVA 2ACEA 2BBTA 2QMYA 4R81A 3HB1A 3UG7A 1KK1A 2PUWA 4DR2B 4I4NA 2GETA 5T6BA 2C4HA 4M21A 3WO1A 1YH3A 5A4AA 3OY7A 5KNLA 1EPUA 1LSOA 5TGDA 4WBNF 1SAYA 4DMHA 4DZRA 4YCSA 3H9EO 4A6XA 1E4YA 4DQXA 2WTMA 5FADA 2HOQA 5JTTA 4BNDA 1C7FA 2IZ5A 5A9SA 3ECAA 2Y1GA 3JYOA 3NIGB 4F4HA 2Z5VA 1QV6A 2HWWA 4AZ3A 5JO9A 1QKIA 5T5QA 4NBVA 4PANA 1U0NA 2FMFA 1BDMA 2BZ0A 1YU6A 1A27A 4AIRA 4K3VA 2WDPA 4YCJA 2WOJA 2FWAA 3PDIA 2XYVA 3QXHA 1KSHA 1UFVA 3FWKA 5WRFA 3T7EA 2JNBA 4B6PA 3U39A 3CZQA 3BWMA 3K0SA 1LBSA 3DKKA 3L7LA 1KI8A 1MORA 1ZKMA 1YZQA 2YHIB 3F6MA 3PJGA 3Q7TA 4JJGA 1H48A 1PE0A 1CHNA 2CW5A 1BYIA 3NQ41 5FNVA 4XD2A 1WOYA 5IBQA 4C6RA 1J2JA 2ATXA 1MJGA 4FGZA 4DPKA 4F3CA 5DGDA 4UU8A 3ROKA 3V1LA 1NXXA 5DW3A 1K0FA 4V0LA 5TT0A 5DTQA 1RZUA 4LFCB 2DU8A 3DCYA 5KJFA 1OHHA 1MIHA 1T6ZA 1N0UA 1HEYA 2GVDC 3FJYA 3ESYA 4XPIB 3VISA 4DXHA 3EQ9A 3BEDA 5BURA 5AK3A 1YJ9F 1VLQA 5K3OA 3I55F 3FSJX 4A10A 3JQFA 1GZSA 3I56F 2ZVJA 4MICA 1XMVA 5T8KA 2GRUA 1EJ2A 4CKCA 2ZDHA 2WPDD 3EA5A 3JWIA 5K8TA 5BNTA 1E2IA 1OD6A 2EFEB 2VBCA 2JEOA 4CQMA 1SVUA 4C30A 1UH5A 3EF1A 5ALZA 3TXYA 1NSTA 2BZSA 4YRQA 4IHJB 1IE3A 3U1VA 4H6XA 3GPLA 3RD5A 4QUEA 2PUCA 1R1DA 5CCXA 4OK3A 1AKMA 5AOVA 3T4EA 4ZYLA 1O95C 4ER5A 1NN3A 5JWOA 4BTLA 3PRKE 2WM3A 2ZAOA 2B94A 4RK5A 1WP4A 2PWYA 3DUWA 2V7UA 2CXOA 3FRJA 1VE7A 3QPBA 1N5RA 1PR6A 2GCIA 3D4LA 2VF5X 3QBTA 4P22A 4U9IS 4A26A 4BX8A 2ZVQX 4M9QA 3IA7A 5BSEA 4XEHA 2MMCA 2ZYAA 3F96A 1OFGA 1Q3KA 1M66A 4ZMRA 3VU8A 4F4UA 2D1TA 1T6XA 2IHJA 4OP1A 3WISA 4KNVA 4L9RA 5EZYA 4FNOA 4C87A 3IAS6 3SXUA 3UCEA 5F3WB 1I6WA 3NMUF 4GO1A 3TECE 4PXYA 4RJJA 3U3JA 3KTAA 1B8VA 4AG6A 3V4DA 3O8QA 4M0PA 5JUWA 1ESZA 2P0AA 1QVRA 3EVCA 2ZITA 3R7WA 2AEEA 1O3YA 1DMSA 1GTZA 4PVCA 4MPDA 3T9AA 2CNNA 2YHSA 5JXHA 3KOZA 1IAVA 3LPMA 4OIMA 4QPCA 4WLEA 5KQGA 2ZCVA 4F71A 4QM7A 3UYLA 1CU1A 2JCBA 4R05A 1ZVQA 1J8YF 1BEZA 1O94C 3N2KB 1RP7A 2QPTA 4RD3A 4CDNA 1HSZA 2ONZA 4KAJA 5ALRA 1OAAA 3OWXA 2C94A 1WV1A 3NETA 2JIQA 1EHIA 1OKKD 3LUGA 1NIPA 2AI3A 5KYGA 3UANA 3DZBA 4DIOA 4S1PA 3W2IA 1YMUA 2A9OA 3F74A 3HVJA 3NONA 1YFKA 3NTRA 2YWHA 4MW1A 4AAYA 2YYYA 2QD1A 3WNQA 2GA8A 4DHEA 3RCBA 3TPZA 5E9AA 5ABPA 1SK8A 3T1HB 4AKSA 2BEJA 3JVHA 1IPFA 1KYXA 1XA0A 2BKUA 3JQ9C 4KR9A 4EUHA 5GJBA 5LWHA 5AKYA 5GMOA 1UFQA 1YKFA 3QE4A 1UBOS 3LT2A 4DQKA 1W88A 1TIBA 1Z2AA 2XMBA 2NXWA 3AF2A 4ZC8A 2C5GA 4UU1A 3X1JA 4KN5A 3F0EA 5G3ZA 1XE3A 4N0EA 1RTKA 3NEJA 5CDYA 4IDBA 3ZK7A 1TO2E 2I7TA 2AQHA 2BFNA 5JAQA 3VXKA 1TGVA 2P9BA 2ZUUA 1VQ4F 1CLUA 3Q3IA 2MQEA 4H3VA 1L8LA 1XXHE 4FOPA 1VSTA 4GZMA 1KYYA 4WBXC 4AWXA 4LN1A 2JCXA 1W75A 2G1UA 1P0CA 2VJBA 1CP3A 1VJ1A 3Q2IA 2PKXA 3GUVA 2AXNA 5DHPA 2TMKA 3RSHA 4UNRA 5J4YA 2OYRA 5F9HA 1WU8A 2RGDA 1E63A 3OFNA 2HADA 3ROZA 1OFVA 2J3LA 3EQ2A 4AWAA 4BUJA 1G7TA 2ODNA 5KMGB 1D4FA 3DFMA 2WMOB 3I01M 1BYUA 2QUHA 3EVZA 5CIWA 4EB0A 2OKCA 3EQ6A 1PT8A 2AK3A 4LC9A 3T94A 3SC2B 3RRJA 2YQ5A 4MVJF 1E79D 3WQQA 1O5IA 1BS2A 5BN3A 1FOEB 3KT6A 5D5QA 4YUXA 1BHSA 1WXHA 2P78A 3LHKA 4YRNA 4RTJA 4MVJP 4X3CA 4PAMA 5FKJA 1QIFA 2XUJA 4LZPA 3RODA 4EG8A 3KB2A 4KQXA 4U6SA 4NJMB 5LQMA 5JNWA 1UFYA 1IG3A 2BBWA 2ZVZA 3WL6A 2ZXFA 2FOXA 2K2WA 3HRKA 4B71A 2NNLD 2H4WA 1C81A 4N6OA 1FDTA 4A8TA 3ILVA 4OK6A 4ZJPA 3RAFC 4J91A 4X6LA 1YS9A 3VNAA 2WWTA 4O5OA 1Y6ZA 3D7SA 3ZW7A 2ACKA 4QOHA 1AURA 4FQ5A 5FCDA 1H2YA 2R6R1 3LLCA 4F9GA 2VIIA 4RJLA 4D4JA 4ZZ1A 1CJSA 4O02B 3U7IA 4B74A 1KMNA 1WHTB 4YDHB 3CRQA 1D6MA 4XB2A 2XYQA 3NKLA 3V4VB 1TCUA 4MIYA 4KOEC 1KBQA 3UTDA 1XU9A 2I4NA 3NCHA 2I3AA 2HJRA 3PQ7A 3C4JA 4C7OB 2RK3A 1I6LA 4YRZA 1EQUA 2FPOA 1FA9A 1L7OA 2V7EA 3D0RA 5LR6A 1QUEA 3E20B 2Y0CA 3A4LA 1H2WA 2GKOA 1KVRA 2YMQA 4CIVA 2PUJA 4BQPA 2F3TA 2PS9A 4O29A 4F91B 5JS8A 1DIAA 3E4CA 5GINE 5EB1B 3R4CA 1L4NA 3SM3A 2NPIA 4JHXA 1G5PA 3SYNA 5HQ3A 5SZHB 1THZA 1K66A 2LNDA 1T26A 2FMXA 3LCVB 3UWSA 2FN9A 3VJMA 1VI2A 2ARKA 2CSUA 4HVTA 4FMDB 7GPBA 1XZPA 5FYDA 3IR9A 2R66A 4GI2A 1SVIA 1OZGA 1VL6A 4G1UC 1P31A 5CVUA 5A6SB 1I7QB 1APBA 3JQQA 2CFIA 4LJ7A 4A6DA 1L9KA 1JJ7A 4DLAA 5ADVA 3H5AA 2VT7A 4B7CA 3BZWA 3AHGA 1VKOA 4EGFA 1REQB 3A4IA 4RF5A 1B3BA 2R00A 5EZSA 3MJEA 4CI0B 4K6HA 3R09A 1CDOA 4OL0A 1XRSB 2QLLA 4M76B 4CU2A 2VNAA 2I34A 5B1HA 4U7WA 5DSZA 3FPJA 4HTFA 1SXJD 1XVIA 2YJ6A 4FYHA 4LSGA 5GOZA 4MQ5A 2JFNA 2V59A 4XIGS 5LQCA 2Q6VA 1SG6A 1SXJA 3EMBA 3C2QA 4O1IA 4R3WA 5FBZA 6YASA 3AM1A 1PCXA 1SWWA 1UKYA 4DB2A 5JECA 1YUNA 3FSRA 3LQFA 2UDPA 4GNRA 1K86A 1DB3A 1QO7A 1FMTA 2EF1A 3E5NA 2NTJA 4JJZA 4MARA 4WL0A 5NLLA 1Z2NX 3V1YA 5CHEA 3EK2A 1U6IA 2JGIA 3QPVA 3RADC 1YF3A 3AY3A 3V1TC 1DBVO 4ROTA 1KO1A 2NO5A 3A4TA 4QARA 1XPOA 3OQPA 2BKAA 3CRZA 1YDFA 2WFLB 4IAOA 1UM8A 5EJ2A 3S1AA 2WZQA 1RACA 1W30A 2GN9A 1AQNA 3DJYA 2VQFB 4CBVA 2DYYA 1UWVA 4RSHA 1ZI8A 3AX6A 3DAHA 3B12A 3QXCA 4RFSB 5HIMA 2WJIA 1DAEA 5KHAA 2GCOB 2FFRA 1RRKA 3GGGA 1GLNA 2W2XA 3L8GA 4QL3A 4DVGA 3NDJA 5HHTA 5KTOA 2PLFA 3F7NA 4DZZA 1OB2A 4F6RA 1N5LA 1P4SA 4RC9A 3ABZA 3EULA 4O33A 5JQGF 2K7ZA 2HR1A 4PX2A 2G28A 1WZEA 1M9NA 4RV4A 5TSDA 3I1JA 3NKVA 4FFNA 4KYIB 5A4FS 3K6SB 1U81A 5JJCA 1ZCJA 4UHBA 3AL3A 4FDLA 1K5PA 4YRTA 1GT91 2PZJA 5CA0A 1VJTA 4M6WB 3UWMA 4NHEA 1XXLA 1DUVG 4H7KA 4BGVA 2FA9A 2OXEA 1TD9A 3E05A 3THYB 3Q2OA 5KTRA 1EFHA 5F1OA 2IZ1A 2Q9AA 4RVUA 5G4UC 2VF8A 4P9NA 3B48A 1JIVA 1Z28A 5JS7A 5KKNB 1HV8A 2FSVA 2HC9A 3MILA 1XVLA 2X8LA 2FI1A 5C8YB 3FE2A 2J67A 1SQGA 2B3TA 2GCNA 3BB3A 1QKJA 5DYWA 3HJTA 1WXEA 4BN0A 1GPMA 1ZSYA 2H3EA 3IIIA 4MLCA 2X0DA 3STTA 3GFPA 3OJ0A 3ANTA 3FROA 1XNRB 4ZALA 1FVFA 1VPVA 2ST1A 4RU1A 3MN1A 2V54A 4I5IA 3ZR4B 1NDHA 3LLSA 1DGQA 2HPAA 1TZ2A 2L19A 3WPWA 1SU8A 2AZMA 1DC6A 1WB4A 3R6LA 3DEKA 2R8RA 3B8HA 2ECPA 1Y8QA 1IYZA 1ECBA 3I8XA 1E5VA 4N5IX 1SRQA 4MWDA 1KYZA 1TYCA 5IABA 1TYDE 2V03A 4YAKA 3RYCB 5AXDA 1Y6FA 3OTGA 3A6KA 4M38A 3ZKWB 4WOPA 4WXHA 2VP3A 5JRDS 1Y3FE 2AFHE 3COPA 2BIFA 2VUSA 3QX3A 1SC6A 4DV6B 3TNJA 3L6CA 3GRFA 3OCWA 3H5NA 4YRJA 3IAM6 5C0OE 2BOVA 3QVOA 1UBRS 4OAOA 3Q3HA 3SD7A 4L72A 1VHJA 2C3PA 4N5HX 3EEFA 4C05A 1BHQ1 1K7FB 1ML4A 3C3MA 4L27A 3WRXC 4JCOA 4PC6A 2LZ0A 1QQ5A 3GBPA 2XKKA 5F2NA 4F12A 4PNHA 2PLWA 4DPMA 2A9QA 3K31A 1KK3A 4C4AA 2RHMA 2FVXA 3ISJA 1F2VA 3L0SA 3MYRA 2CZGA 4TN5A 4WKPA 1XXHA 5AI0A 2RAFA 4ZTUB 5EUBA 1CUFA 3WWOA 4IMJB 1S6YA 8GPBA 5KYUB 3G9UA 1HNXB 1X7XB 1X92A 1Y33E 2X0RA 4N9QA 4C3ZA 4JU9A 4E5UA 5BQPA 3G2IA 4J94A 5HCNA 1CDEA 4RNCA 3HM9A 1KYVA 1N7GA 2V9ZA 4XWGA 2I6RA 1ZRHA 2XPCA 1TYEB 2YV1A 3M6LA 5SY4A 1W36B 3JSAA 3GJ3A 3A10A 4LGYA 1X7YB 3PD1A 4QUIA 1E9EA 2HH9A 1C7ZA 4XWWA 1MU0A 2Z56A 4WZAE 2QTVA 4EJ6A 3TF5A 2EU8A 4LSZA 3HGTA 4RZQA 2HRQA 3J80M 3WL7A 1SUSA 3ETNA 3KVNA 1R4MB 5EUMA 3WQBA 2I2BA 2WB4A 2I80A 1JKIA 4JB0A 5HILA 4CUKA 1ZW1A 2FZ4A 3A26A 3CLSD 4W5TA 2Q3JA 3TAUA 4MO2A 1M6VA 3OC6A 4MQFA 1JHOA 3KJQA 1VKHA 2NW6A 2RC6A 2ZOSA 3PPYA 2ZETA 4RQBA 1CUYA 4FYMA 1ADFA 4DTCA 4RH0A 5IBPA 1KP2A 1BCRB 4IIYA 1P6QA 1SHUX 3VU3A 1MQSA 4MINA 2VQSA 1FVXA 2Z2YA 3ZY2A 5IK2A 1I30A 1YJBA 2A94A 2F2TA 4OCZA 2Q4TA 1K7YA 4PIVA 3GN2A 5EOVA 5G4LA 1XP5A 1J2YA 4AUKA 3NCTA 1RXVA 3G1UA 2G8NA 1YFJA 1R0SA 2ZRAA 4NYIR 2AG0A 4KR7A 1DMRA 1HDYA 2O8CB 4YMLA 1OZAA 1TQ6A 1ZRSA 4IIUA 2QE7D 4A73A 3CC4F 1B6RA 4DLZA 1CY1A 2YS7A 3O83A 1E66A 4WZBA 3W9YA 1VQ7F 3I2IA 1EB8A 2EC5A 2F8TA 3RUIA 5D7NA 1W9HA 2PKYX 1FDRA 5G3YA 3T5AA 2H85A 1GGHA 1OBCA 1E7KA 2ZWAA 1ZZEA 3DV9A 3O9ZA 3JARB 3MWKA 2Q2VA 3HBMA 1QFJA 3PQ6A 1CJTC 4OI2A 2W2PA 4IQ0A 3H9CA 5ETJA 5BMVB 4Q7QA 4IZIA 2CEAA 1CZLA 1VE6A 2GK7A 4MVJD 4DSAA 3HXMA 3QLUA 4LBYA 5GGXA 1CEQA 3E48A 3QMPA 4KK3A 3U3RA 3X1MA 1Z63A 4XQ0A 1V0JA 3QGMA 3CH7A 4PC7A 2WUDA 3VOAA 2C2BA 1Q17A 3ENQA 4JBXA 3OX1A 4C4TA 1YQNA 1N7IA 1FFGA 1N5JA 2R48A 3FBGA 5JNRA 2ZB3A 1PJBA 1A9PA 5P8WA 4JMPA 1XIVA 5AI8A 1HURA 2XAUA 3W8EA 1OBFO 2ZIZA 4IGIA 1FJGB 3BBLA 3DXXA 2VPQA 3CX4A 2HCRA 1KJIA 1VMKA 2VP0A 4LDZA 4WASA 4E2FA 4Z4FA 2C29D 2REBA 4LQCA 5IVHA 2B37A 5I4CA 1AGNA 1U40A 1WABA 5KNCH 3GRPA 2NU7B 2XOXA 2UV8A 4KO8A 1SO8A 3NGXA 4NDZA 1JEQA 4YP9A 2P2LA 1SIUA 5C52B 3S99A 3TSYA 2NVBA 2B0CA 1OI7A 1ZN2A 4NYIQ 4PE5B 4AJKA 3I9KA 3UMJA 1JLKA 2W7TA 3GFFA 1ZJZA 3AH8A 1B15A 3DHWC 2OG1A 3PQ2A 3LK6A 3DOCA 4X7MA 2X8JA 4Z1MA 3HB5X 2QD5A 2FGKA 2XWPA 3VR3A 5JAIA 4RHTA 3O9VA 1W5SA 5FH9A 1HEIA 3JD2A 2P9GA 1O96B 4NV3A 4NIMA 4W1PA 2XRFA 3OQ1A 4TXJA 3K14A 1EK6A 1PQWA 3SYMA 3U4MA 2AMFA 4W5WA 1IXRC 3E3AA 4YUAA 2FG6C 1L7QA 1X1TA 3UJCA 3QBDA 1WXWA 5CIYA 4TV8B 2UAGA 4LF7B 3H1TA 5JJLA 1RHJA 1XTBA 1H8HA 3JRWA 1JBQA 1NXVA 3CNHA 3W77A 4EA8A 5CFQA 4R2KA 3SSAA 2MDTA 4MRMA 5IKMA 3QA9A 3KBBA 4MQ4A 3PV0A 1AXEA 2X8AA 4QPPA 4IO1A 1J22A 3TIGA 1SXPA 2ZYHA 2GF2A 1CUEA 3CXUA 3OLQA 4K6MA 2ZOVA 4R68A 5H83A 4GVLA 1JS1X 1LWOA 1O2DA 2EX4A 2OB1A 1GQ2A 3RF7A 4CCWA 4F5WA 1DPGA 3R7WB 3R3WA 2PMDA 3PJEA 3QK7A 2EXXA 4UPDA 4Q48A 5L3QB 4UTXA 1JU4A 4LSMA 1Z6PA 2HSWA 4M1ZA 4CF7A 5AW9A 4AY5A 2X23A 2B5WA 3LVBA 1D6NA 4I9NA 1U1FA 2WWRA 5IUNC 1LW6E 3FH0A 1JDTA 3M4YA 4KLRA 3HG7A 3LNCA 5EYPA 3L0OA 1NASA 5MGBA 3EBLA 4JQCA 4Y6GB 4J0CA 3LYLA 2K87A 1D0VA 1C0KA 1UL1X 1QQTA 3GEHA 4B35A 3L8EA 1PO7A 3VKVA 5E6UA 4E88A 2MMGA 1JTVA 2CHSA 4MKGA 2WYVA 1C9YA 5FFFA 5G0TA 4RF2A 4DLVA 3NBMA 1L5HA 3P19A 2OQ2A 2Y6VA 1KO7A 2QN1A 3C16C 3RNOA 4HYEA 1TM4E 3GAMA 3W8DA 1FJ2A 5FUMA 2YZ2A 3KJKA 2CLIB 2HQSA 3DH0A 3PNMA 5AWFC 4B9AA 2CLOB 2VRCD 3VKHA 1TL7C 2BT4A 3LOUA 4NVRA 4GOKA 4JJ4A 2QTGA 1Y1RA 3E1KA 3KYDA 3AGPA 3DKRA 1UT5A 1JA1A 2IXGA 4NZPA 4BBAA 3U16A 2EP7A 3KQTA 3ADOA 4G26A 4QOIA 9ATCA 2QL6A 4NMLA 1BGWA 4I3HA 3HTNA 4PLPA 5G41A 5HJ5A 1K06A 1M90H 3M4JA 2GAJA 3P10A 1T0BA 2CLMB 2YV2A 3BOSA 4FSDA 1G4AE 5C2JB 3H2BA 4QQFA 2ETVA 2XCRB 3SXJA 3JAWA 3PXUA 3IUJA 2PX0A 4IJUA 3VPGA 3CH6A 1EVYA 1WZCA 2FF7A 3DEHA 4Q01A 5T6MA 3DBIA 2H6LA 2E4XA 3MUFA 4Q4JB 4NJEB 3PC4A 3GJ6A 4F4DA 3WK4A 4YAGA 2I1QA 3QHDA 1NUPA 5JYBA 3TUZC 1Z2EA 4M1TA 2HV9A 4GOLD 3CZ9A 4BQOA 4BNMA 1D2CA 3E70C 4M9CA 4CXMA 3EWSA 4FJ0A 3GVCA 3A4YA 4KFTA 2AL7A 1PQYA 1ZJJA 1Z5UA 3WYGA 3PUZA 4DM7A 4Z9XA 5KWEA 3N2EA 3TGPA 2ZXUA 1K5DA 1U63A 2WYOA 3V4FA 2IK8A 1N3BA 2PTHA 4QDKA 1IUKA 1VI5A 4MCAA 1P9NA 2H48A 2GNPA 2EFHB 4MV5A 1T1EA 2I4MA 2GPWA 1U2PA 3M6MD 4HWOA 4L8LA 1LF5A 1HLFA 4OAQA 2XWQA 1TADA 4G2TA 4CUZA 3PGJA 2VRBA 3R7DA 2YWFA 4XM2A 3TQOA 4BVAA 3WGVA 4CM4A 4N7JA 1NVAA 1XD8A 5U4XA 1SZCA 3ZQ6A 2J6IA 2Z83A 3FYDA 4Y6OA 3AETA 5C5DA 1UJ4A 4AQDA 3W5AA 3IEXA 4FSHA 4O2AF 2ZPTX 3BGVA 4JLSA 2WI8A 2R6ZA 4N9WA 5BRNA 2D5AA 3SCZA 5A7HA 4G6ZA 5IJXA 2NIPA 3A3YA 3HVIA 2HUNA 4QASA 3OFJA 3WWYA 2OHVA 3BHJA 2VUHB 1VA4A 5JSQA 3IXQA 1NHWA 4CKCB 1C7EA 3C8UA 4JI7B 1IPEA 3UT5B 1AZSC 1NU8A 5TX7A 1WCYA 1KIMA 1O9HA 3S0JA 3LY8A 1IPAA 3U3OA 4J7CA 4MUIA 1F2TA 4JEUA 3EG9B 4MZXA 4ARBA 1RDFA 1V1MA 2KGWA 1H0KA 3OZDA 4KDRA 4ALLA 1C9EA 3FMFA 1QHHB 2WK1A 2BKEA 2W0MA 2ZSAA 1Z3CA 3DDHA 1G4HA 1WDLA 1K1EA 1EK0A 4KSYA 4RS4A 5KKAA 4WCFC 1Y5IA 4QU8A 3ZI0A 1JBEA 2FYTA 5HS6A 1VMDA 4CRWB 2FMKA 3ESRA 4TKMA 3SJCA 3O8OB 2DXIA 2YVAA 4TMFA 4NBKA 2C1XA 5I3ZA 3HRHA 3HBNA 5H16A 3M1LA 3HCPA 1CUDA 2CNWA 1C9KA 2IP4A 1N9GB 4AYXA 2BKLA 2H9YA 2BMEA 2JRLA 4RTKA 1HT0A 4MMZB 1FFBA 2GGSA 1KFKB 1ZJYA 2ALJA 4V03A 3AKZA 4EI2A 2XDAA 1SK9A 2RK4A 4DMKA 3S3TA 1TA0A 2V6FA 1CN7A 1D1QA 3IOMA 4B6JA 2A78A 1TD1A 1W2WB 1W57A 2LKDA 4CQMD 4IXWA 3WYDA 4A0HA 1ZR4A 2Y1KA 1D1PA 2A5GA 3HZHA 4I46A 1OMOA 3MRTA 1EFPA 2H8EA 1A95A 2TRSB 3LPAA 5B37A 3X1ZA 5LMCA 4TM8A 5EJEA 1TZKA 2J5RA 3TE6A 2GNAA 2BFFB 3NP9A 1DC4A 5FBLB 2AGVA 4MW0A 1RXIA 5K0SA 4HXFB 2B4RO 4TS4A 4B7ZA 3ZDAA 3Q3GE 2ZTSA 1LTKA 4P33A 4AY3A 2JFXA 3WICA 4BFTA 2CC2A 3PDCA 4HGPA 4PFJA 2GH1A 2ISSD 3WZLA 1E3MA 4H1TA 3MWGA 1JQEA 2GUWA 4PLVA 4RTOA 3GJYA 1DCKA 5LDDC 3V6MA 4TMYA 1CUXA 3DOIA 3T5BA 3I4CA 4RD1A 1GWNA 4KR0A 4YO7A 5BSTA 4IPTA 3KHKA 2VJMA 5TNXA 3F5SA 4DGQA 5DASA 1CQWA 2JFWA 1WS6A 2OD2A 2N42A 2YINC 3N53A 3DLBA 5TC4A 5K4AA 3GZNB 4EELA 4ESOA 5H8WA 1U2GA 5AXAA 2DAPA 1R8QA 1JIIA 2FR0A 2FLWA 4OHMA 4C4XA 1SA0B 3IP3A 4FDUA 4EPXA 1VQPF 1VCNA 3A6DA 4PLCA 5DNDA 4YYEA 4R40A 2HXGA 3BWDD 3CRW1 3JVDA 3E1YA 1GSHA 1TMGE 2CWWA 2XTNA 3C6BA 5FA6A 4E3ZA 3CIOA 1FC0A 1JXMA 2XODA 4WY5A 4TLLB 5DWQA 1UMCA 4W1RA 4DY4A 1UIMA 3PPIA 3QTBA 4MR8A 4I1UA 2QN9A 4HD8A 2P9EA 3KZNA 4B0OA 4YS6A 3KLOA 2OCGA 1XK7A 1YNSA 2WJ6A 5H3HA 1SQ5A 1IOWA 1TJNA 2OZEA 2ZW9A 4NR0A 3G9TA 1ENPA 2X14A 1RJWA 3FFTA 5JCPA 4PYNA 2ZUSA 1YVRA 3TZHA 4I4TB 2Y1WA 3UGJA 2PRYA 3IDQA 1N7HA 2MYPA 3SAJA 2P67A 1G59A 3ESAA 4Z4GA 4TKVB 4K26A 2YJ5A 2PU5A 4HC4A 3HYRA 3MZ0A 3MBMA 3ZU2A 1Y3BE 3OZXA 5JYCA 4QDXA 1HNWB 1O0SA 1TAQA 3OEED 2G83A 4OQPA 1UXGA 1B2LA 2C00A 2GESA 1X7YA 4FDVA 4I9FA 4RELA 5FFNA 1GCOA 3I0MA 3IP1A 1QGAA 3LP8A 4GVXA 4XCXA 1K88A 3ZXSA 1LPOA 1UOQA 2NADA 3V4OA 5B3LA 5ITWA 2FPIB 3NTLA 4ZHWA 4ARVA 3L4JA 2H4HA 1QYVA 1IK6A 3DUFA 4F3KA 2EBFX 3OX3A 1X7ZB 1E9BA 3L7IA 3LYHA 1YUMA 4Y1RB 1AUQA 1N2OA 3WWDA 4R8LA 3S1SA 5CB4F 3CVXA 4ZDIA 3FOZA 3FPIA 3UPUA 1RHRA 5BSKA 2Q1TA 4BMXA 5DKFA 5B2EA 4OM8A 1XLVA 4NBLA 4S1NA 1V43A 4C5AA 16PKA 1PR4A 3U3DA 4CG1A 3AMVA 3IMKA 1IU9A 3A1UA 2YIJA 3GYBA 3LDTA 1V1RA 1QQ6A 3T5DA 2QLTA 4EYSA 3MXTA 1MABA 2W22A 3INNA 4S3MA 1UINA 1GIAA 4UMDA 1AQUA 2G3YA 3QQ5A 4K9NA 5D6NA 2ID9A 5HP8A 1U0SY 4IMIB 2OGTA 4RHFA 4UVDA 3H0KA 3KP1A 4Y9RA 4HPJB 5EPOA 4PYJA 2XRYA 5EQJB 3UN1A 1ICIA 1TTPB 1CW2B 1Y80A 2ZE7A 4TLAA 5E1MA 4YWJA 3SYKA 5BOSB 1UCFA 1EBUA 3OZEA 1Y1PA 2A0KA 3VH1A 5JNTA 2OXIA 1JQJC 1U02A 3CYFA 5ALFA 3W1VA 4BC1A 4DPLA 2C4VA 5CTJA 3GZJA 2P8JA 4BEVA 5KI6A 2LKCA 3T34A 4M1QA 5IDXA 3O1JC 4YY3B 3K0FB 2Q6TA 5EJGA 2M98A 1E1QA 5CVEA 1QTQA 1F8FA 2WHPA 5BV7A 1YDEA 1X74A 1QC5A 5DGIA 3T6KA 3V80A 2BGTA 5F78A 5L4SA 4Z9BA 3R20A 4TX1A 4HPXB 1WXQA 2G08A 4IFIA 4ZREA 3CCFA 2DBRA 1QHYA 1Y4DE 1Z8HA 1Y3CE 4UHHA 3G7SA 1ZA1A 3S81A 1NP6A 1B00A 2G9ZA 3IMCA 4JJ6A 4COKA 1X94A 4DABA 4TYMA 4LV5B 3CCBA 4DSOA 1QE0A 3MJFA 3DLHA 1N2HA 1BXRB 2Q4BA 3PWTA 2CDCA 3OUZA 3I05A 3VOBA 4RDCA 4H3KB 3D7RA 4M60A 3KEOA 2GVIA 1G5FA 1G60A 3E9QA 5ERXA 2HBYA 2JGDA 3WLMA 4Q5IA 1PS0A 4EHJA 4R6WA 2XZOA 1F9EA 1SH7A 2B2NA 4KITB 1F8YA 4EHNA 1EK1A 1AKYA 4JLDA 1GPNA 1LPMA 2LDBA 3UZUA 3DZDA 1MVLA 1HZJA 1J2TA 1E4OA 1H6DA 2C4TA 1T5IA 4ZHQA 4RZ3A 4WX2B 3TBHA 2XLBA 3VNUA 1NX9A 4EMSA 1BVHA 4YCMA 5HOQA 1J39A 2DQYA 3INGA 5EJFA 1JVSA 1QOZA 1ELOA 3RI3A 2PX3A 1HE5A 5E6RA 3RHTA 1RHUA 3CW2A 4BFZA 1DG1G 3JRNA 4EH1A 1NF2A 3NWBA 4C3VA 4NDNE 3K0HA 2AFVA 2I3GA 1HLDA 2J3IA 3E7FA 4ZEXA 5K0ZA 1T9GS 4XSHA 4DT1B 4BO7A 4L1KA 4C76A 3COJA 1HGXA 4FLMA 5IAGA 4EG0A 4K1XA 4IOMA 1EWYA 4QEKA 2P9FA 5GZ3A 2WFZA 2XAAA 3BMQB 3C97A 4G4SP 1ZZGA 3SJAA 1PJLA 3VMMA 3KJEA 3LS2A 4DOMA 4L75A 4BXOB 1HL7A 1KPIA 4REQB 3TIVA 3B82A 4W7SA 1F60A 1N0IA 3K35A 3ANLA 1BWSA 2QY9A 4YQEA 4JYCA 4OH7A 1EQ2A 5D84A 2BMAA 2QTPA 2H92A 4C82A 1N2SA 2CVZA 3CCSF 1C7IA 3GRYA 3P9QA 4RTSA 4EHBA 3O26A 1LRLA 2WWHA 4NE7A 3AERA 1XTSA 5IAAA 5JZSA 4TKUB 1T1SA 3EGXB 1GZHB 4ATNA 1XYYA 1ODSA 4CLOA 2O8FA 4UCQA 3HFRA 4G89A 1JIJA 1SVSA 3WP0A 1ZOIA 2CHFA 1UEXC 2F62A 3ZY6A 1C0EA 3HYCA 1TM1E 1WUHS 2A88A 2WPNA 1N0VC 5ALNA 1F9AA 3I2GA 1E6KA 2VDRB 6REQA 1JDNA 1HDIA 3DQZA 4RYLA 3IMGA 3L7YA 1RZRA 1VL1A 4XEUA 3MQFA 5IH7A 2YHUA 1L7XA 3IURA 1W2GA 4IKOA 3VYVA 4A5OA 5HRAA 3TM4A 4KO4S 3BORA 1P1FA 4IGKA 4HN2A 2CXHA 2JI8A 2XMDA 3TLXA 3WLTA 2WQ6A 3EPJA 4QEZA 4RLHA 3ONNA 2G40A 3ZHUA 2QAGC 5AHWA 4KO2S 2GEBA 2YMMA 3BTUA 3JWJA 3N0TA 4OHKA 5EP4A 4RD2A 4FT4A 1N0HA 7YASA 1DBSA 2H8GA 4M0CA 1BIFA 1T0IA 4FYJA 4R0VA 1W5TA 3OM9A 3R76A 4EJMA 2ERCA 3VCZA 1NQAO 3F49S 3IESA 3LX5A 4J4HA 1P3Y1 1V8ZA 2LCAA 3NTUA 5G4KA 3D00A 4C03A 4MYTA 3SDSA 4RMHA 5LP6B 2YYEA 1B0PA 3CKKA 2C5EA 4H18A 2FP4B 4KGVA 4L8WB 3QQPA 1WBBA 2IU6A 3RAGA 4LY3A 5HBRA 2W6QA 4F5DA 1EGMB 2O50A 2JGJA 1A9RA 3W4KA 4QUJA 1JI3A 4MRRA 1GL3A 4Z0HO 3Q3EA 2EJUA 5ESXA 3KWLA 5EMKA 1L1QA 1RQNA 3NX4A 2NUAB 1I0LA 4V1CA 1JE0A 2ZJ8A 2WWGA 3IP7A 5CFPA 4B3XA 5E3HA 2VSOA 4HQLA 3OQHA 2DHEA 1QU9A 3WB2A 2IHKA 4F3YA 2HJWA 1UDBA 2YJNA 4FXPA 1LS6A 4L8YA 5C4IA 3THWB 3ZIUA 4PRLA 3M1YA 1JEYB 5M2QA 4JP5A 2WD9A 4ND2A 3HFSA 4ESHA 2Y99A 4GM4A 5TQVA 1UZAA 4FFDA 4WESB 5EXSA 3VOTA 1L4BA 2IYNA 3B1FA 4E6EA 1FP1D 3NHKA 1INLA 1DC7A 2WIGA 4NOMA 4RFSA 4CNBA 3E61A 3BL5A 2OV8A 3BSWA 3Q1KA 4YRLA 1ETUA 2J4CA 3WIUA 1C9MA 1W36D 3HP4A 4B3RB 2V7GA 3A36A 3P2EA 4P35A 2W2KB 3U3KA 3ORQA 2VOJA 1M2KA 3BXEA 5K0BA 3O0TA 1HQKA 3WJAA 4EJFA 4MVWA 1E0JA 2HPHA 4RH1A 4JC5A 3ZZTA 1F2UB 3N3AC 1R18A 3KLNA 4IWNA 4O2BF 4B6GA 4CTOA 2E4VA 1BXGA 3E35A 4GQIA 4HLCA 5HYVA 3Q10A 4NCKA 1OZHA 3M6VA 1ZNYA 4GICA 4H9GA 4MYSA 2PGNA 2O1SA 3K2EA 5TMDA 4D1YA 4QG3A 1MHPA 5KAPA 1W581 1E1CB 2GJAA 1R00A 5DI9A 1F3LA 3L0ZA 4N76A 2NUPB 3JQRA 1K6IA 3ZW9A 4B3GA 3ZDFA 1SCUB 3OQVA 2OCBA 2HEIA 3E8MA 3SYLA 2GARA 2ZUFA 1P18A 1UPUA 3A3OA 1G0NA 3P5BA 2A4KA 4D6YA 3KUDA 1AK2A 1WXDA 2QW0X 2H4FA 2YY6A 4GRDA 4JBYA 5FTKA 3G6KA 3MTIA 2ZBQA 1NBME 1Y7LA 2NACA 2IVFA 1YL5A 4Z0PA 1FVHA 1YS1X 1NUHA 4HH3C 1TM7E 4ZT3A 1RIFA 5LUAA 3FZGA 1O1YA 4FMPA 4B3IA 5AW7A 4A2WA 4XGRA 5EXXA 3FMOB 4HQKA 2QX6A 3HQ4O 1HETA 1MVOA 3AQ4A 3OQBA 3S27A 5F21A 4EG5A 4NENB 1RLMA 3DFZA 1D5CA 2HLPA 2FW7A 4X61A 1WZIA 6GPBA 5HKOA 1IN5A 3UA3A 1X7DA 4POAA 4RK7A 4EVSA 3MMXA 2Z1TA 1YDMA 2JJ2A 1Z83A 4HB3A 4LE0A 1ST3A 3COZA 2Z6AA 5EZQA 4Q9JA 3IOYA 1TTHA 1FDUA 3FCSB 4QOFA 4W82A 2PSHA 1XDZA 1SDSA 4QNNA 4WOBA 2O0LA 1P2SA 4U39A 2XQIA 5BNWA 3RB8A 1JILA 4YVFA 4AICA 2V3CC 4C7OA 5CM9C 2RB5A 2E85A 2R5WA 3L79A 4GOOD 1NFFA 2I6QA 1HFWA 3BIJA 3F6RA 4HNGA 4OSEA 4PO1A 3ZGYA 3A9RA 3FSGA 3P20A 2O8EA 2QROA 3ADPA 4L22A 4C4OA 4DRXA 1WDKA 2PSSA 5TMBA 5CVTA 5L45A 2A6PA 2E1PA 3DO6A 4IILA 5HF9A 2GRJA 4OU4A 2NGRA 1BN7A 4BMSA 7ABPA 1GA1A 4N18A 4IFEA 4EYEA 1X1QA 4OQXA 1VOTA 4YAUA 4G4ZA 1KP9A 1VG0B 3GLGB 2CYCA 3UJNA 2QEQA 2R85A 4G41A 1MG5A 4GLLA 4M2LA 5GM2A 2Y67A 4YRFA 4JI2B 4FKZA 1UBEA 1E3WA 3RS4A 2VHYA 4Y0NA 3STYA 3JQGA 3ZOZA 5M7EA 4JLMA 3SIWA 2ERXA 4FHEA 1WMSA 5EIBD 1XALA 1IY8A 5SZIA 1Y4UA 2GK4A 1TE2A 2FWRA 5AP9A 4D4KA 4ERNA 1PBTA 3GA5A 4MR8B 4PZPA 4BX0A 1QXSA 1SU4A 1IDOA 3RS3A 3KSBC 4LYGA 2VKQA 3ZEAA 4B3JA 3TZQA 2PMFA 1NSYA 3PC8A 4K86A 3OFSA 2G9NA 3RS8A 4YXFA 1BFDA 2OENG 3MJHA 3OZTA 5E8RA 2SKCA 5FLKA 3RS0A 3TW8A 4WCFA 2ID4A 3HDGA 4ACAA 4ZYZA 1EJ0A 4OYLA 3KWFA 4O4LB 3HAXD 2IF0A 1JPJA 4X7PA 2IEBA 2WAYA 4LWQA 1RHKA 2QJOA 3HVHA 4N65A 3TSZA 4BT5A 1XJ5A 2NVWA 4PSDA 5BSMA 1RM4A 1VM6A 4G9EA 4PYQA 4RTMA 1A8UA