2RHLA

Synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
305
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 101
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhlA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhlA01
5EYPB 5EZYA 5J2TA 4KWEA 4X1YA 4X20A 4DXDA 3M8KA 4YJ3B 3WGMA 4FFBA 4I50B 5MN4A 3WGJA 4I4TB 3JASA 3CB2A 3JARB 3RYHB 5JQGA 5IJ0B 4ZHQA 4TV8A 5EIBD 2RHJA 4FFBB 3HKCA 4O4HA 3RYCA 5J2UA 2VAMA 4TV9A 3JASB 4IHJA 5JQGB 5JCOC 4O4LB 2XKBA 3N2GA 4ZHQB 1W5FA 2RHLA 5LOVB 1FFXA 4O4HB 3RYCB 2VAWA 5J2UB 3RYFB 3RB8A 2RHOA 4TV9B 3RYIB 4IHJB 4B46A 4YJ3A 1W5EA 5JVDA 4I50A 5EIBC 3JARA 4U3JB 5IJ0A 5JVDB 5LP6A 3HKDA 4X1IB 5LXTB 1TVKB 1W581 3JALB 5IJ9B 2RHHA 4O2BB 4O4LA 5M7EA 5LP6B 3HKDB 4F6RB 3C8LA 5LOVA 3VOBA 3RYFA 1JFFA 3RYIA 3WGNA 4HNAB 5IYZA 3ZBQA 3HKBA 2Q1YA 1W59A 4TUYB 1RQ7A 2R751 2VAPA 3UT5A 1JFFB 3JAKB 4I55B 4ZOLA 4WBNA 4U3JA 3HKEB 3JAWA 4YJ2B 4XCQA 1RLUA 5IYZB 5LXTA 4X1IA 3HKBB 5ITZA 1FSZA 3UT5B 1TVKA 3JALA 4ZOLB 1SA0B 2BTQB 5C8YA 4WBNB 5IJ9A 3JAWB 4O2BA 5GONA 5BMVA 4O4IA 3N2KB 4F6RA 4O4JA 5ITZB 5CA1B 2R6R1 5KX5B 4ZI7B 1W5AA 4M8IA 5C8YB 5GONB 5BMVB 4HNAA 5LA6A 4TUYA 2VXYA 4O4IB 4O4JB 4IIJA 3JAKA 4I55A 1W5BA 2GVIA 3HKEA 3WGKA 5LYJB 4YJ2A 5LP6C 3VO8A 5JH7A 1Z5VA 5LA6B 4DRXA 4IIJB 3JATB 1SA0A 2BTQA 3E22A 1TUBB 5JH7B 3N2KA 1OFUA 5KX5A 5KMGB 5JCOA 4DRXB 5CA1A 4ZI7A 4EI7A 3M89A 3ZBPA 4B45A 3E22B 3VO9A 2Q1XA 4X1KA 5J2TB 5EZYB 4X1YB 4X20B 5FNVA 4EB6A 4U39A 4LNUA 5CA0A 4EI9A 3VPAA 5LYJA 3V3TA 4X1KB 5CB4A 2BTOA 4O2AA 5FNVB 4EB6B 4TV8B 3VOAA 3R4VA 3JATA 4LNUB 5CA0B 2XKAA 3HKCB 5MN6A 3ZIDA 4EI8A 1TUBA 5EYPA 4E6EA 3WGLA 5CB4B 5MN5A 1RQ2A 4O2AB 5KMGA 3N2GB 4I4TA 1FFXB 3RYHA 1Z5WA
chains in the Genus database with same CATH superfamily
2TS1A 3ROMA 2G88A 2NVUA 2ZRFA 3R44A 2OCDA 3EC7A 4MK4A 2EARA 1P5JA 5HE9A 3N75A 3NTOA 3HDYA 3SI7A 3WP0A 5AW2A 2BLNA 1KMMA 2GLUA 2ZQ5A 2IIPA 1T4GA 1XA4A 3NHAA 2RB9A 1PZEA 1COMA 1ZOIA 2OT3B 2YMMA 2AVNA 4FDUA 1XEWX 5DK6A 1JTFA 2PIAA 2V6GA 3R0IA 2Y6UA 2FP4A 3AY0A 1JU4A 2OCIA 1BXKA 2KYRA 4HNQA 4IHJA 1AF7A 1GG8A 4P84A 3VDQA 1TQHA 2OZEA 3OWXA 4LX0A 2X8JA 3L8GA 3WPWA 3EH1A 4NFLA 1DC8A 3VUFA 1WQ4A 1ZOOA 1GDHA 3EXHB 3NASA 3U2QA 2QSUA 3WLRA 2DYYA 3WK5A 4LXIA 1V48A 5JVDA 3B1WA 3BYZA 5FXMA 4EARA 4Y2UA 3BDVA 5KTPA 3GN2A 3U0BA 3PWZA 4BWFB 2ETVA 2R68A 1RWKA 2YCBA 2Q3BA 4W5WA 4Z86A 5IKEA 1O5IA 2AQKA 4HRAA 4QBKA 1ULZA 2ISSD 5HA5A 1PFGA 4AY3A 1X86B 2DR3A 3FUUA 4MQLA 1L7RA 4Y2PA 1U81A 3DZCA 1JU9A 3E5MA 2NUAB 1NOIA 4NZMA 1MU0A 4PGHA 4RAOA 5G0SA 2XOKD 4G0OA 3H97A 4YCCA 1SVSA 1FNJA 2A0KA 4M1TA 3E9ZA 1NN1A 3DO8A 3WIOA 4HUJA 4P0PB 4UBOA 5FCDA 1YJCA 2GZLA 1T6NA 2EKLA 4R7ZA 1PKEA 2F9LA 3KFLA 1L9XA 4MV5A 3PNSA 4IDNA 2X76A 1XQ1A 3K5PA 2CHFA 4MWDA 5IAAA 1W29A 3E35A 1NW9B 3EXHC 4ZDJA 2APJA 4KMRA 5BVHB 3H5NA 3L01A 2M98A 4H6WA 3TD3A 1C1XA 1ST3A 1OXXK 2G76A 3FZEA 3LE8A 2FB9A 4PZZA 3S0JA 4QDUA 3OD5A 3ZDAA 2B34A 1W4LA 3F3MA 3PVZA 5JQGF 2ZAGA 3FYUA 1IUNA 3HBMA 3LPAA 3FCEA 5E38A 5KSWB 1HI9A 1Z8FA 2J7PA 2Q62A 3MRTA 1UBTS 2QRVA 4IIJA 3ZZMA 2F9ZC 3WLAA 3MAAC 2C3PA 3AP2A 4C4TA 8ABPA 3U1VA 1U31A 1NBMD 1WDKA 1LH0A 2QAJA 3B53X 1GPDG 1N8SA 1PFWA 1TU4A 2J3HA 4AJKA 1KGSA 2XGSA 1LS6A 4AZTA 3ZE9A 2QAIA 2PL5A 4JA0A 3PIRA 4LK3A 3M4NA 4UU8A 4F8JA 3LT0A 2L82A 3KB1A 3OWHA 3SHOA 2X2EA 5HXZA 3ACCA 1I2ZA 5FO0A 1IHOA 3BXPA 3U37A 1VRVA 5JY1A 3ETHA 3BB1A 3BTVA 1DI0A 2QP3A 3FFBA 4LKRA 4YVFA 1ODLA 1K6MA 1FDIA 2QRLA 3UAYA 2ODEA 5EJ9A 2Z2YA 3UGKA 4MVCA 3AM4A 5TQ0B 2D7DA 3B3AA 3KT6A 3RS3A 3GOQA 1P33A 1SVOA 5L53A 2JHFA 5NLLA 3ODGA 1YMUA 2JFXA 3QH4A 4DV7B 2KBFA 5EIXA 1HEYA 1G7RA 3JD1A 3N2LA 3Q12A 2BGWA 1E1DA 4RZHA 4RSRA 4XWWA 3TUJC 4XSHA 4MA0A 4LOIA 2XR1A 4ES6A 9ATCA 1PI3A 3LYHA 1P3JA 1VJRA 4BTVA 4ARAA 4D6YA 4AG3A 3NYWA 2NZUG 3JQPA 1QVAA 1YCHA 2O07A 4RPLA 2H1HA 4LYYA 4E03A 1DAPA 1OB5A 3RYHB 3C3AA 5EMKA 3SVZA 1YQGA 1BAPA 5COAA 1ODKA 3KE9A 1EZ4A 1NC1A 3WE7A 5K2MA 4U5QA 4ZOEA 3EF0A 4ZQHA 1EVZA 3OONA 2B25A 4X85A 1IPAA 121PA 3VU3A 3SICE 1UKVY 1NQVA 721PA 3UG7A 2NU9A 2DHCA 4U7TB 4QOJA 1CY8A 5D3ZA 3JVHA 3OIVA 1RP7A 3QUWA 3EMBA 2NLOA 3HS3A 4LW8A 1DXHA 1II9A 1I1QB 3VV2A 2WI8A 2AH5A 3A4NA 1VBNA 2O0LA 3FB4A 3WLLA 1VPEA 4O1IA 3VPHA 5JROA 2VP4A 1QU9A 1IPEA 2CMGA 2WNIA 1FUEA 3WDLA 3OO1A 4BEVA 1O2DA 1W7AA 1I3KA 4GR4A 4DLBA 1TLTA 4V38A 1JMYA 1M5RA 2G82A 3DKVA 3ESYA 3D1JA 1C7FA 1Y1TA 1NYRA 2GPSA 3D00A 1JHPA 3PAFA 3X2FA 5JNLA 3AVXA 3FD5A 2R11A 3I12A 2I54A 4IDPA 1AZWA 1Y80A 5DM4A 3ZZTA 5KJFA 1WXEA 3GEEA 4ENSA 3NHSA 3HA5A 2Q5LA 2X0IA 3LS2A 1CFZA 3H9QA 4W8GA 4B80A 1YFJA 4CTMA 3G0HA 5BPHA 3CC7F 4L02A 2PD6A 3BHMA 2HQSC 4EPWA 2Y99A 1JT9A 2ZYRA 1UOOA 2X7HA 3KL4A 3INRA 4ZYVA 5IT4A 4E6PA 5IYZB 3BF7A 5JI2E 1C9NA 3SXJA 4FFOA 1SD2A 1WVMA 1AKWA 1AUQA 1U4NA 2AXEA 4YR7A 1OJ7A 3HAXD 5KYWB 1Z73A 2AN9A 2EBWA 3NVKI 1VXRA 1YS2X 1PJZA 4KXQA 3KPWA 3IB3A 4TYNA 1AU9A 2RBEA 1VG0B 3BGOS 5DYIA 3NFRA 4GOJA 1QVGF 3LWNA 1W76A 3ZZUA 4L16A 1ZI8A 2ANBA 3I73A 4KCGA 4S1VA 4H27A 4OFXA 4L27A 1DL5A 4L5IA 4GDMA 2RHTA 4JJZA 3ELDA 4UU7A 3U09A 5LA6B 2Q6LA 2XSZD 4GHWA 4BE4A 4XLLA 3JQ7A 2MINB 4N47A 2WB2A 3K4HA 2NU7B 3BXGA 3L6CA 1HTBA 2HIGA 5BYKA 2D1QA 1GGKA 1RM4A 4DCOA 1R27A 2QK4A 4NPHA 1LSUA 3E8SA 4R9VA 2VXBA 1PT9A 4R5MA 4NBTA 2FRDA 1NV9A 2C78A 1XE3A 2CB9A 1KTVA 3AFHA 3ZBTA 3I9V6 3QMMA 2R44A 4HGYA 2WVAA 3WWCA 3OJFA 3HYLA 1NQ5A 3NBZC 1LV8A 1W75A 5DNWA 5ALRA 3HVIA 1GSOA 5EJMA 3QUBA 3ZLBA 5I48A 5AT1A 4KRFA 2WYUA 5AVUA 4BE7B 3COWA 4IHQA 4BGIA 2WM9B 1FFYA 5AM2A 2CEAA 2CF5A 2FMXA 1SHLA 3I01M 4DQVA 4NOKA 2PCJA 3B3QA 1AZTA 2E9SA 3QMVA 3ZHCA 4QFCA 4EKNB 1CSEE 4X1OA 1J2TA 3GA7A 2JZCA 3DZDA 2O0HA 3O21A 3FWHA 2P1DA 1W36B 3K8QA 4N40A 2AWOA 3I9OA 3IV7A 1OH8A 3AEUB 4AJ1A 1EUCB 3AGQA 2W90A 3HA7A 1NOKA 3UUEA 2QLJA 1ZJ6A 4Y0AA 4GMXA 2NG1A 3L49A 1UOQA 4PO8A 1XCJA 1CZNA 3H4MA 3ODPA 3WMGA 2ZOVA 2GAJA 1KC8H 2R66A 5BUQA 2R7LA 1X70A 3NAZA 2YZKA 3RYCB 2WIJA 4Z9BA 4E31A 3IDOA 5KWEA 2GN1A 4HH3C 5AESA 4A1OA 3UV6A 1Q1BA 4BN5A 2VWHA 3H2KA 3JZDA 3M6VA 4R9NA 4U2DA 4OM7A 1TIBA 1Y82A 2BV3A 1XTKA 3BWDD 3IVAA 1IRXA 2R1VB 3LX8A 3O90A 4GM0A 4HK4A 2JJQA 2FLWA 3CR3C 2AHRA 4J0FA 4XSGA 5IEJA 4FYMA 1S89A 3GEPA 1SDSA 4IMIB 1K08A 1MFZA 2W2LA 3P9KA 2O8CB 1KPGA 1JR3E 2WABA 1OZHA 1IY2A 3NT5A 3T5CA 3CMEF 4RPIA 4DM7A 3KQUA 2EFCB 3BL8A 3K31A 1NE2A 3IPXA 2BP7B 2NVBA 2CNWD 4L8WB 4MGZR 3RTDA 4JXZA 1VJDA 2BE9A 1JG6A 2DFPA 3GJRA 4MWBA 4YAJA 5JAQA 3KUCA 3KZOA 3UHJA 1PU2A 1F6DA 2H52A 2HWWA 2IEAA 3GG2A 3OPYA 2EERA 2WJYA 1I3NA 1I6LA 3D59A 4JBYA 3U40A 2CXNA 3ZYZA 1E3IA 4KH0A 4F11A 4JEHA 1V9SA 1R6XA 2HCJB 1JZTA 2AOXA 2ZWMA 3IJPA 1IPFA 5TQJA 3SC4A 4F4JA 4KLRA 2DY1A 5CITA 1NP3A 5BWNA 1FTGA 3MQ2A 4I66A 5AI5A 3QOXA 4GECA 1IZZA 3EJWA 3QV2A 1RPNA 4MEAA 1ZD8A 3PGXA 4I3HA 3UOGA 1E3TA 4FT2A 5ALYA 4BZZA 4RDIA 4OK5A 5K8CA 4P0TA 2V7QD 2IPOA 3N2KB 2P11A 2DEUA 1P19A 4UBIA 4AJJA 5B64A 2ERYA 4MCAA 4MZDA 5D00A 5J5VA 2CUZA 5KQGA 5KVCA 1CCWA 3IEVA 1JTEA 2BJVA 5K4AA 4QGAA 3SN6A 3ZPXA 4EYKA 4Z0HO 4DWOA 1N5MA 5K8IA 1O3YA 1JJBA 3OT4A 4GGPA 1VK3A 1Z07A 2XVXA 4ZK6A 1QCDA 1J49A 2Y1OA 4LWZA 4ZGBA 2E49A 1P6XA 4GI2A 4Z3OA 4HDNA 3QEBZ 3FBGA 2KPOA 1NKSA 1L8OA 1UBUS 3KSUA 1OROA 1QO0D 4BJ3A 4E4TA 2EZ9A 4BNVA 2I4IA 3UHAA 3D3WA 3QP9A 5AVRA 4Y2TA 1BNCA 3DYIA 3HCWA 5JRJA 3PKJA 3G8AA 3I04M 3LT2A 1Y5LA 1IWPB 2XKJE 3EXFA 5HDBB 3F73A 4XPIB 2F9FA 4MITA 5BV2P 4QOGA 4JP1A 1K4YA 5KNCH 3P9IA 3ZE6A 4V0RA 2PUAA 3EEOA 3ZLVA 3AVOA 4Y30A 3U7HB 5KINB 1G8YA 1ONSA 3M5DA 4I6EA 3QEMA 5FHRA 4R8RA 4S24A 1ZLYA 5FNVB 1ZW1A 2P4EA 5TQ2A 3VZPA 1TKRA 4L3WA 2VOEA 3B6ZA 2BFFA 1UZAA 5LYYA 1HMPA 1FW8A 2PWZA 3DS8A 4RKRA 3RTCA 4X93A 4RZIA 1QK3A 4C05A 2ZAUA 2QYSA 4F2WA 1UBNA 4AI6A 1WCXA 3H6GA 4HYTA 4L51A 3CCRF 2YWFA 4X20A 1X7DA 2MDTA 3D7LA 1JKFA 3FMPB 1UPCA 3GAAA 4JUAA 5EXPA 4P4UA 1ZM7A 1AN0A 4FS3A 4QTZA 4HQ0A 4L0MA 3FTPA 2HNBA 5AI4A 2YV1A 5DBIA 5FBZA 3KNZA 1JFLA 1ENPA 3EZ9A 1GL7A 1T8UA 4HHEA 1UDBA 5FNZA 4D0NA 1V7QA 1XNHA 4MH0R 4XWYA 2ENWA 2BEUA 1ISGA 4B17A 3HDTA 1M1YB 1WLYA 4Q4HB 4Z0NA 2CT8A 4JGGA 2J5RA 4B8YA 2IL1A 3WADA 4D45A 4F86A 3PC8C 1KI8A 3OEWA 4ER0A 4KPGA 1T5SA 2JCYA 3S8EA 1CF9A 3MXTA 4AYTA 1OF1A 4R2LA 2FR8A 4DA6A 1N32B 1YWGO 2OCAA 2R8YA 3IGFA 5GMOA 4OLHA 5D3QA 2C1ZA 2L69A 3LOUA 4C08A 3L1IA 3N2IA 3IR9A 2IZ1A 5AI8A 4OVKA 4LTNA 4BQQA 1OXUA 3RASA 3A7EA 4HN2A 4YDSA 3VKWA 3MFQA 2I9KA 4D46A 4KH1A 1OU4A 1CU1A 3CSDA 4FD2A 4M1OA 1XDUA 1BFUA 1R0KA 2FMFA 2Q28A 4MVJE 4YH1A 4GM1A 5IU6A 3ZW8A 1NVXQ 1U1IA 4JZYA 1T8PA 5AW8A 4ZVVA 2C83A 3NBKA 3HWX1 1GTVA 4ER7A 3HRHA 3M70A 1K86A 4PICA 4NAVA 4EITA 3KSAC 3O94A 1CUUA 4RXMA 5SZIA 2P91A 2F8TA 3I6MA 2AA3A 4DDUA 5F5XA 4Z4EA 2V7EA 5CYFA 1SC1A 5ITWA 4PHHA 1L6RA 3ETGA 3HKBB 5ALSA 2CGEA 2Z3WA 1E9DA 4GP6A 3CMMA 3EVNA 1APBA 5ELXA 1IJKA 4UHCA 2IODA 2WB4A 1C30B 1M2KA 3C6BA 4EJFA 4Q5IA 4DJFC 3SVTA 1RIIA 1A4IA 4OKIA 3UHOA 1IHPA 2VQEB 1SQ5A 4G36A 1T3HA 3HNPA 3QLVC 4OL9A 4X3OA 4K9NA 4CDNA 2RG7A 5HE8A 2VQSA 1W96A 1RKUA 1X7XA 1D0VA 1UFYA 3CCUF 1VQMF 4BLSA 1NG9A 3ROQA 1J2JA 1JLHA 2POCA 5EZ5A 3VGJA 5JFTA 4YO8A 3R7AA 1KR5A 1GCAA 3AVTA 2EDCA 4FW8A 2O4UX 3G0BA 4Q4AA 4E1VA 1EGMB 2F64A 3OLVA 4YIHA 1FF9A 3HE3A 2B8WA 3PR3A 3TTUA 4TWZA 4RGVA 1S3FA 5EE9A 2H1CA 4H59A 3QPCA 4NKRA 3RLFA 5JZOA 4BW0B 4JJ8A 1Q82H 2OWDA 3TECE 2OAEA 2VJNA 4PAOA 2QB5A 1VLZA 3ZZ1A 2HB6A 4AJOA 3GL9A 5U9CA 2AOTA 2BIFA 3EXIA 4IZIA 2V7PA 2XNCA 4YP1A 5DVZA 1EBFA 4ZHVA 3VR2A 4PSCA 4D8WA 1R0YA 3SSNA 4GP7A 1NPYA 2FRXA 4DARA 2R0QC 3KD2A 4NMHA 4KSBA 4FN4A 4RLFA 2JFBA 3N7AA 4QUEA 2OO5C 1E7SA 2WMOB 3BRQA 4H3VA 4MIKA 3VOTA 3IHTA 1M67A 3OOJA 1HFKA 2AMVA 3RIXA 4JI3B 4BYMA 3W8DA 3B3GA 1FX0B 4BQNA 4KXUA 2XWJI 3BJIC 1BJKA 3KOXA 2VNAA 4IMPA 4P86A 3N58A 3PCRB 2PRSA 4LVOA 4OQEA 4YRDA 5FL7A 4G5RA 2HRRA 4D80A 3SJZA 4MA5A 2OZPA 2PXCA 2OHFA 5L9AA 4DLRA 2BFPA 1IHUA 2AI1A 1Q1ZA 1XMQB 2J0UB 2ZB4A 2J6HA 3D6JA 4IDQA 4RL4A 3U80A 3IDSA 4NV3A 3RVPA 5LQKA 1J8FA 4GX0A 3DBHA 3JTMA 1KY4A 4QG7A 1E3WA 5DTJA 4BVEA 2DC1A 4JQSA 4QVIA 4RSGA 5HP7A 5F1KA 3KBOA 3GFBA 4LDRA 4RTLA 1U8YA 4JLVA 1M8JA 2QQEA 3HFSA 3L4SO 4MR7B 1Z15A 4KYVA 1I94B 1Z18A 3BIJA 1E2BA 4GSLA 4D5EA 3RE3A 3RBZA 5G0VA 3H19A 2GB4A 5CEEA 2BISA 1H6CA 1TQDA 1UPTA 2H92A 4RH3A 3EIQA 3GD7A 1K88A 3VTAA 4AS2A 4DPKA 3LI2A 3M83A 4X94A 3BMNB 1RP1A 5A0FA 4OAOA 4TTIA 3TVTA 4J7AA 3V1TC 5HGJA 3VDRA 1R64A 4XIJA 4IEIA 1QKKA 1TAQA 2ZI5A 5EAIA 4C0QC 2VI5A 3IP3A 3SYRA 1I01A 4F85A 5JNWA 1QXSA 3KJNA 4JLWA 3ADKA 4JXJA 4C4RA 3RVNA 1KNKA 4ZQGA 1YR7A 4XWOA 5KU1A 1B0PA 1FNDA 3WL6A 4B44A 2GCIA 1NNEA 4PQEA 1OGIA 3KTFA 1D2CA 1NULA 1PN3A 3GRRA 4JYMA 2R1TA 3H4IA 1Q50A 1JYSA 2NUAA 4BRZA 1Q0LA 3Q9NA 1MX3A 1QH9A 4YFVA 2ODAA 1R6DA 3ZHXA 4C43A 4B84A 2YXNA 2DQSA 3RU3A 5BV1A 5LMCA 4RWZA 3LC2O 3CR7A 3B6IA 1U2TA 3PIIA 4MZXA 1Z06A 1DXYA 3INYA 5DLDA 2OE2A 4K9MA 5GONB 1GT6A 4HPWA 3PEYA 5LPNA 2RHDA 1B74A 1NYTA 5HIJA 4BKOA 5KWSA 2PO7A 2D0IA 3D0RA 2H1SA 4TV9F 5HF6A 5TGDA 5K9ZA 1LI7A 3F6CA 1ZDMA 4MINA 1B8OA 5A0TA 4ZEWA 3T7AA 4L4YA 3VI3B 1B26A 1PEYA 3I6BA 2XB4A 4XWKA 1XKQA 4D3XA 4URUR 4AYWA 5T3YA 1QZXA 5BVHA 1Q15A 2GASA 3O2QB 4RD2A 4W7SA 4QJIA 3UT0A 4BFLA 3OMLA 5HFAA 2HGZA 3BSYA 4CW7A 4Y6SA 4OYHA 3CF2A 1AZLA 1N4DA 2WAMA 5L7WA 1G3UA 3FOEC 4X1KA 5J2TB 1I2BA 2LCQA 3TZQA 3AVWA 2JIZD 1EUDB 3ZUGA 1Q3HA 3U62A 1J23A 4B5LA 1HE8B 4DKXA 2ZSBA 1ESEA 2B99A 3I01A 3VHRA 3WNZA 3S44A 3GT0A 1GO0A 4HDKA 1E6MA 4A6XA 3VI6A 2W58A 3QEOA 3QKWA 2WYWA 1JIUA 3ELCA 4BP1A 2QM8A 3K6KA 4QECA 3U7EB 2XQGA 5JR3A 1MB2A 4JVLA 5FOTA 4AJLA 4K6MA 5EXDA 2ZIFA 3ANMA 1AS3A 1KH3A 5IXYA 1TT7A 1UJ4A 3KT3A 4GSKA 3L04A 1Z8HA 1UWVA 3NBQA 5REQA 1AN9A 3DE6X 1PQ4A 3PP8A 5AQEA 1OI4A 1EVKA 1UDRA 2QTRA 3R9WA 1TYBE 2O2CA 2C7RA 4I14A 1J06A 1JEJA 3F8SA 1YL7A 3H3XA 1R50A 1WP9A 4O4HA 3CUWA 4BKRA 3IPRA 1A71A 1XZBA 1M1ZA 2NXCA 2Z01A 3FPKA 2XMQA 4L0CA 3I9JA 3OPXA 4X60A 2GD0A 1A7UA 3LC1O 3ZJ5A 3TLEA 3L8YA 2QN1A 3I0NA 1YI1A 4ID3A 4WPGA 3HCEA 2W5UA 4X84A 1PWZA 2D5BA 3T7SA 1P81A 5EP4A 3W7AA 1WMFA 2H51A 2ZSEA 4HZIA 4DUYB 2AUMA 3K3PA 2FJ0A 4PINA 3WLTA 2HA6A 2NO5A 2BF4A 2V6JA 3G6KA 5B3KA 4ZALA 4RDHA 4D8VA 3FJYA 4HAUA 5ALFA 1SIBE 1Q0RA 3IIEA 2YWHA 4Q1CA 3DFUA 4NG4A 3HC7A 1I33A 1Z0UA 3B2NA 4D4GA 3LUPA 5FBWB 4J76A 1T3TA 2W2OA 3NGMA 4CDMA 4JB0A 2OK7A 2JAUA 4HQ6A 1G5TA 1D03A 4LXQA 5EUQB 4AO8A 4KYTA 1AHHA 1RLJA 2BFEB 2WV9A 4GM4A 2Y77A 3HWWA 1GQQA 2I62A 4MV3A 3V48A 2E6KA 3H5AA 3JZIA 3R7DA 2X0RA 3HJNA 3IP1A 2VQFB 1UZLA 3HU1A 1PUJA 4D9GA 2COKA 2PUWA 5A2GA 2XNDA 1GKYA 4AUEA 4J0KA 2CSXA 1BCRB 3BC1A 1IY8A 3AILA 3WRVA 3FDXA 2E1PA 3EA4A 4DTCA 2GLTA 4F84A 3BK1A 5DP1A 1KI2A 4Y1EA 4X97A 5DMHA 5IM4A 3F67A 2VXOA 1U9IA 3QU5A 1ONIA 1DT5A 2ODNA 1XLWA 2OUIA 5CDTA 6LDHA 3I04A 3HR4A 2GA8A 5E9QA 2O8DB 1D6NA 3CKMA 1GNSA 2ACKA 2IYQA 4RQOA 1HA3A 1SUCA 1KQOA 3AV0B 2HU5A 3QU2A 4IFBA 1XR3A 2RSLA 2Y0CA 3EQ7A 4Q3CA 5KYWA 3IOBA 1TT5A 4R6WA 5HRUA 3N86A 4HEJA 2BRUC 3ZGVA 4OYRA 3ZU5A 2QIPA 3DVQX 1KQSF 4U9IS 5BT9A 1XMPA 1KOJA 2FG5A 5F73A 5HVNA 3NDBB 2R96A 3PBKA 3URKA 3RSQA 2PMDA 3WKCA 2J30A 1IQRA 3H04A 1J5PA 3H0CA 4XARA 4FHEA 2DB3A 1ZN9A 1JMKC 1G16A 1YGPA 4LY6A 1HNZB 1VI6A 1LBSA 3VNRA 1FMTA 3O84A 4E21A 2OILA 3ESZA 2V4ZA 2ZSDA 4XTCS 2OLKA 1VE7A 5LLDA 5I7WA 2MINA 3QSGA 3QWFA 3GFPA 3OPVA 2W2NA 2E5LB 3O31A 1DG1G 1WY7A 3CLHA 4KIGA 4WZAE 5KC8A 4KXXA 4HAOA 2VYND 2B1IA 3FIUA 3NR2A 2A7XA 5AR1A 4W9NC 4GGOA 3L4EA 1FMFA 4CIYA 4Y2HA 3HP1A 1EJ2A 3A70A 4K81B 1U40A 2NQTA 3PNKA 2G7ZA 4GS5A 3UCFA 5HQTA 1ARZA 1I4EB 2HL6A 1NRJB 3O2NA 3X0DA 4BQPA 5C7YA 2BHRA 1UBHS 1PVDA 4K9LA 2FPPA 3CZCA 3CCJF 1UT5A 4QQFA 5E9JA 1OKKD 3ILXA 2OGZA 1C41A 1C2YA 1IUOA 2GBLC 2H4JA 2JCVA 2VJOA 4FXPA 3UMGA 3AL2A 2D3WA 2AF3C 1N75A 3B5JA 1LRLA 3G1WA 4B46A 4UDOA 3W2TA 4BCBA 2PX2A 4C6HA 1OB2A 3I55F 3O0TA 4DWJA 2VZLA 1HPLA 4JMPA 4BNWA 1P77A 2YHIA 1T2VA 2YWDA 3ETNA 2DWOA 3LWOC 1QIGA 1ZGBA 5K3SA 4BO0A 5A4MS 3HN2A 4HDOB 4CG3A 1ZVVA 4NK4A 1EHCA 3GGGA 3QBJA 3ZE2B 5BQXA 2O2SA 2FN9A 4LJ5A 5EESA 2RIPA 3C5VA 4N4AA 3IEUA 3C15C 2D6FA 3FPCA 2IXDA 4M38A 4BKPA 1VOTA 4Z9AA 4YUWA 2VTEA 2QU7A 1Z2PX 3V1YA 5B7PA 4O3MA 3TVYA 2MMCA 1U5AA 4W7IA 1MJHA 1SGWA 3A0UA 1FK8A 2NSDA 1O54A 3OUTA 5C5CA 4BVSA 3CXCF 1E3SA 2QROA 2QVBA 3EQ8A 3OTOB 4A03A 2MOKA 2VDNB 3EIFA 4JB8A 3JAWA 1T2DA 8OHMA 4LCEA 4B31A 2X8AA 3CT4A 3ST7A 5KJ1A 1CUXA 1YK0A 3IAM6 4M1ZA 4EIWA 1RQXA 4OKSA 5LR6A 4YLEA 2XGMA 1O97D 1RAFA 3IEKA 2BP7A 1Q12A 2QJTA 4O4JA 1NBME 1H0KA 1M1KH 3QY9A 2RH8A 3ZH9B 3ZIUA 3VC3A 1IOVA 3ZHBA 2AMLA 1IULA 4EA9A 5H3LA 3FCXA 3WI7A 1O94C 4ESHA 3H9CA 1NJ1A 1NBWB 1SFRA 3PUJA 1F38A 1Y6QA 3QTTA 5M3BA 1HT2E 4UAVA 3CYPB 3DT9A 1L6IA 4MV1A 3ADDA 3I62A 4BZXA 4IF4A 2QZ9A 2BMAA 4WUTA 2A1TR 2HDHA 4CMEA 3Q2KA 1NE7A 4U63A 4RHEA 5F64A 2FPIA 3C85A 2I6SA 4NI5A 3O9VA 3BG5A 4Q34A 4UNQA 3N05A 3S7ZA 3VR4H 3N2KA 1T0JB 4E4YA 2HS0A 4Z51A 5HBGA 4YFYA 4JBLA 1PIWA 2PUHA 1Q1NA 3UXHA 4LZAA 1UINA 1J9ZA 1AQ6A 1QZTA 1JAIA 1SC3A 4EB6A 1XAIA 1P2GA 1DOAA 1HXHA 3DMGA 2E87A 1NL3A 3HEBA 2WYOA 2HXYA 2RK4A 3KIPA 4JROA 1E1CB 4JXXA 3Q8XB 3RKUA 1KP9A 1G0OA 4EPTA 3BRCA 2QX9A 1T9DA 1CUGA 3TR0A 3DULA 1XPUA 1C2TA 1BX0A 2XA2A 1OR8A 3EEFA 1LTKA 4UEKA 5IYZF 4JU9A 2DKNA 3TE6A 3H2YA 4F97A 4XPIA 2FWRA 4KK4A 1J42A 1PL0A 2D06A 2JI6A 3L05A 1WD5A 2VPPA 2GYVA 3QHQA 2DPHA 2VRCA 2XT6A 2UUCB 2QLLA 5L3ZA 2JK0A 2XUKA 4JT4A 2QQFA 3WGJA 4M0EA 5CFZA 3ULKA 2YBDA 2WTNA 3D2CA 4MQ6A 3M9WA 2PYIA 3DE1X 8ADHA 5DV9A 5AVMA 1POXA 4PXYA 4BBZA 1MC5A 2B30A 2OCXA 3AHJA 3MTJA 4OGLA 3MWDB 3VR2D 3PA8A 1YZLA 1XZKA 5LA6F 3RROA 4BNHA 4DWVA 1U0LA 3IHWA 5A9TA 4MKFA 3S2GA 3OLWA 4F2GA 5CBPB 3AY6A 3HXQA 4XI9A 4PFJA 1Q20A 4KXNA 1EJ0A 1N1GA 3H2BA 1Y7LA 5T67A 1WW2A 1HZZC 4MW5A 1HY3A 2WK1A 4N5HX 4R1SA 4X0EA 1TRHA 4YYEA 2KM1A 3SQWA 1X3SA 2WHPB 3P4EA 4UNIA 5TVKA 2FETA 4OGFA 1NJ6A 4G4WA 1XTUA 1TQ2A 3KZXA 1H2BA 1YFKA 2V65A 1FFAA 2PHNA 1E6KA 1U0BB 4JLUA 4KQ1A 5EP1A 3AEYA 3LK7A 1DAOA 1FFDA 4IZ6A 3FPHA 4Q4HA 3ZDQA 5LP6B 2JAHA 1GM5A 2ID7A 3WWYA 5HXUA 2VF2A 1XGKA 5ICCA 1EB8A 3NALA 5F3WB 2CWWA 2GXQA 4JJ4A 2ZRPA 2CZCA 3WAJA 4F71A 1D1SA 1GKUB 4LJ8A 4RIHA 1RQ7A 3H7AA 4BBAA 4Q47A 3R0VA 1ONPA 1Z4NA 2Y6VA 5K1ZA 3KQKA 4FFLA 4MDFA 4UXHA 4GC9A 4LN1A 3UH1A 3WHPA 1M0EA 1PJAA 1WSBA 2ZIAA 1KMCA 1C1YA 4HNSA 4HR7A 4RD1A 4AWAA 4IF6A 3LK6A 4BMXA 2BTQB 3WLQA 2ZU0C 4D0SA 4PFSA 4EG6A 3DT6A 4O4IA 5CVUA 2D5AA 4N5NA 1W5AA 4Z9FA 1N0IA 2HTEA 2G1PA 1M83A 1XYVA 2FWAA 3BICA 4JJIA 3B6MA 2NV0A 3KHUA 1XMJA 3VC1A 1NN0A 2PXAA 2FCRA 2O2ZA 1WOMA 4LC1A 3DEYX 5J58A 3C1UA 3P32A 2HN9A 2QD2A 3A9TA 4WUVA 1RE0A 4C14A 5LP6C 1OJLA 5JH7A 2CXUA 1E2PA 1JKJB 2ZPTX 4IIXA 3ZWAA 5JCXA 1KK3A 3BRWA 2HWXA 3HCOA 3DW1X 3OC6A 4RORA 4QXMA 4YJFB 4RS3A 1C30A 1GR1A 1M2OB 3MDOA 4UNNA 1HDEA 1EFCA 2R85A 4Y1RA 2EZ4A 4J0EA 3CCCA 1FJ2A 3A2NA 5HZGA 4B74A 1HEIA 3AO0B 4HPXB 3RVLA 4U39A 3OM8A 5JHHB 2VIIA 3OZAA 5JPDA 4NDNE 4BT6A 2UZHA 1ZXXA 1R1MA 1LZLA 3U7GA 1ESNA 5IH7A 2DETA 1VQ8F 3WJ7A 5K6AA 1EVEA 2BTOA 1KOFA 1LJ8A 3H11A 5E7MA 1OYYA 1JLLB 5C1DA 2Z5FA 4YJGB 1B73A 2YZ2A 1LW7A 4A0QA 5ESXA 4L95C 1NVGA 1JKXA 2AXPA 3WGUA 2GERA 2JGDB 1RE1A 3CC4F 1P8JA 4AJPA 3USZA 5HRAA 3HY6A 3QA9A 3QWAA 1CQIB 4QPJC 5K03A 5AVYA 1TK2A 3ZCUA 3IAAA 4C4XA 2CL5A 1UAYA 3EVAA 4GNRA 1U2QA 1ZU4A 4PAMA 5TMDA 4LV8B 1IY1A 1B2LA 1P74A 4I7EA 1QVRA 2G70A 1P0MA 4REMA 1GNLA 3KV3O 1SBIA 2CL0X 5FPTA 3ZCPA 3R4CA 2V6BA 4DY6A 4QA9A 5DLYA 2AL7A 2Y1LA 4F7WA 2C7GA 5FQNA 2G40A 4HEHA 3FRHA 4A2QA 1YS4A 3OLXA 5HIMA 2CXOA 3UW3A 4ZK7A 3L7AA 1FLAA 3R7LA 3O3CA 1FX0A 5DISB 5I7FA 2O0MA 3FA2A 2P30A 4I46A 4TTSA 2YFHA 1V2HE 2J67A 4GZ5A 4LE2A 3V55A 9ABPA 2H7VA 3QVXA 4Y7DA 3UWMA 5BSGA 5L3QB 2XPCA 3P9CA 1LVGA 1W93A 2WJ3A 1ABFA 1WP4A 4YJHB 3GQVA 1JY8A 1Y8ZA 2H17A 1UMBA 3FH0A 5CT8A 3KBBA 2OXIA 2FAXA 3KHNA 4B4DA 1NIJA 4QHTA 3U3MA 2ZJFA 2PZLA 4URYR 4LJSA 1LVUA 4GUDA 4CHTA 2NO4A 3DOEA 4CI9A 1EFVB 1YC5A 5FNVF 2VGMA 4LF5B 3OT1B 5TT0A 4U7GA 2ANCA 5L51A 1SZQA 4NCAA 3R75A 3A2LA 1CW2B 4A7PA 3V8BA 1TPZA 2Q8NA 2YVUA 3ABSB 3FLBA 4YRZA 3A6LA 1JV2B 1Z13A 4FHCA 3ORQA 3DFIA 1VKZA 1NZDA 3G13A 1D2AA 2DHRA 2XEDA 4NULA 4HJXA 1ENYA 1L5RA 5IJAA 2VQ6A 3LFTA 1FS6A 4MULA 4YLYA 2AN3A 3DD1A 5LQRA 2QAGB 3NJRA 3TQTA 3UA4A 4LFAB 1K7SN 3BMNA 2HK6A 1WMSA 1WJGA 2Y05A 3TW6A 1Z0IA 3VNVA 4YV1A 2B0JA 3OCJA 1IQPA 4N8DA 4D41A 3ZVRA 2IY7A 2XECA 5C7OO 1DUSA 4DBVO 2XVAA 3KQNA 4K2AA 1SZCA 2NWQA 4YUAA 1XMOB 5HS6A 4CV3A 5IF3A 3LLSA 2GLXA 1GFWA 1BKYA 3FPLA 3CRW1 4G0QA 3M4ZA 4G5HA 1MQ9A 4INAA 3IAS1 2XUOA 3KEGA 3FD8A 1SIUA 3G17A 1U6IA 4WESB 2PNFA 1E3LA 3QI2A 2ZT5A 1OXVA 5JXJA 3NATA 3QX3A 1B8UA 1YQDA 4PCAA 4DC9A 4KREA 5CDFA 1D5CA 2XNDD 2YN4A 1T10A 2CXSA 3H5TA 5CVCA 4U00A 4I2NA 5K7SA 3IAFA 3OE7A 2YV2A 3HJUA 1T2AA 2ZCUA 4LGCA 4ZYXA 4OREX 4K6KA 3DMDA 4WKOA 5A5VA 1FDVA 5ICMA 4YAUA 2I6RA 3EDMA 2IAFA 2C4KA 5TGTA 4R01A 4AAYA 1HORA 3LP8A 5IDVA 2R8ZA 5C7LO 3ZIDA 3DG9A 2B8NA 1U94A 4QFBA 3UCXA 1ZAKA 1VCIA 2QN8A 1PX2A 1G8SA 2A94A 3GZ4A 3CKKA 3MUEA 4P98A 3ROEA 4QKQA 5B7NA 1K6JA 2C2GA 1RABA 3KRTA 2C82A 5BN5B 3RE1A 1S5PA 3CHYA 4TVBA 2PNJA 1QF6A 5J2TA 3AM5A 4KWEA 4ZQIA 5DSTA 1PT5A 4UEQA 1EUDA 2DPGA 2WF7A 2ZSUA 5CW1A 1RAGA 3FROA 1MNQA 1KAGA 2V59A 3CUKA 4OMDA 1R18A 2D59A 4UATA 3LQQA 5LB2A 2Z83A 1ZWLA 3H4VA 4RC9A 1J09A 2RC6A 4FGJA 2G5PA 1OLXA 5TLSA 2FFQA 2FX5A 2K7FA 4GAEA 5EFOA 2Q1WA 3D6FA 3UC9A 2FPSA 1UFKA 3EBLA 1TVMA 3G7UA 3SOPA 5JADA 3LFOA 4ZVRA 4WN9A 4IJKA 3FLEA 4DDKA 2OKGA 5E0KB 3TLJA 1GCOA 1W1WA 3WLFA 1M6HA 2VR1A 4NQZA 3ZXSA 2FHSA 2QGZA 3QKIA 5E7QA 4KR6A 1OZGA 1MZPA 3WDMA 3U0VA 1ACJA 4NONA 1E99A 3U9LA 4PG8A 1A1VA 3VSBA 1JB9A 2XMDA 1G38A 5EUBA 3QVKA 4ZD6A 1C50A 2GEDA 1NLYA 4FWIB 1WB9A 3DC2A 1Z45A 3WXMB 1MHPA 2EYUA 2HI0A 2XB2A 3DHYA 2ZDHA 1Y6FA 2RHBA 1CWUA 4AJEA 2P3LA 4JUBA 1VB5A 2YR0A 3HDQA 4BVGA 1PSDA 2QRUA 4Q3KA 1IVYA 4N5DA 3AJEA 2X0EA 5ECDA 2Q5OA 3L0DA 5F76A 4F06A 4YMVA 4B40A 5KQRA 2O7RA 1M8FA 1NBHA 2QZJA 3TSZA 1W44A 2A0XA 4HGNA 3SZRA 4ZV9A 3RK4A 4EK9A 3ESJA 1K8YB 2GHIA 4G5XA 4NICA 2WJIA 4TX1A 5H5JA 3V4SA 1W36D 3OCZA 4HZUA 3D8NA 3I4FA 2OFOA 4XQEA 5M34A 1CERA 1YZGA 3PC3A 1AB5A 1SCBA 1O95A 4GXNA 4Y1GA 1ZWKA 3P5BA 1IL0A 2JIOA 3TMYA 3TGWA 1IV3A 2BWJA 1JAZA 4WSOA 3PYXA 3QE0A 3DTYA 1KMNA 4E5YA 2X5JO 1QX4A 3INTA 4ZO4A 2BFEA 2BE7A 1QSGA 1X9IA 2WPDA 1IUPA 3LHFA 1QAMA 3FGPA 3AR4A 3T38A 4HFMA 2EX0A 2LBTA 3F4KA 1VQNF 4ZOCA 4BZPA 3VO8A 4JLAA 5CXQA 2C7OA 1EFHA 1U8FO 2BT4A 5T6BA 4HJRA 4ILKA 4C81A 3OJWA 2ZQYA 4NTZA 1XTIA 3DDCA 3CLUC 4MVJI 4QAJA 3E4DA 3H9GA 4XUGB 3VMMA 1IEQA 1BCRA 2ATCA 1PZNA 2HLPA 4Q24A 5JAHA 3LO5A 4CKBA 3TSWA 1JHOA 2Y1EA 4PYIA 3DOHA 4L4XA 2JFQA 5FV7A 4GPAA 4H6XA 4UW9A 4BMCA 1LF0A 4UE3S 2QN6A 3BA1A 3X1MA 1X7ZB 3MJVA 1C5KA 2A4KA 3AF1A 1Z7WA 1XRGA 4YEDA 3NBYC 2YWEA 2ZBPA 1OIXA 1Z62A 2FR8C 2VXCA 2Y1GA 4S1OA 4ZJUA 1R0RE 2P78A 2DP4E 1DUIA 1UEIA 2D1YA 2R00A 4G9GA 4QD3A 2LDBA 3T1NA 3U39A 4KN8A 5EYPA 1JVSA 3H9EO 2PUCA 4LGMA 1BQEA 3R23A 1D2RA 3QSYA 2V9CA 3KLOA 2I2AA 2PCLA 4TXMA 3DP7A 4MYDA 5CBKA 4AJIA 5LL6P 2P6OA 1JUDA 1Q7CA 1Z83A 2N1BA 1B0AA 2YDXA 1D09A 1XZIA 4M54A 1PT8A 3WQBA 5I7UA 3KWMA 3E2MA 3NCHA 2FRVA 4LMPA 4JP8A 3WTBA 2QA4F 4ZPJA 3SHQA 3YASA 1AS0A 1BEZA 1I6KA 3D8SA 2I22A 5B2ZA 4TL7A 5GONF 4D4LA 1ESMA 3BA6A 3CG4A 3F1KA 2MU1A 4G4ZA 2YRFA 4G37A 4IS2A 4HVTA 2N75A 4LWPA 4CL3A 3M82A 2C1XA 4I9GA 3LUJA 2NZYA 3A1EA 3ZHQA 4C7OB 1T5HX 3MYRA 5E3JA 1SXJC 1ZCAA 2I1LA 2I1QA 2OXCA 2OYSA 1KZYC 4CIAA 2HT6A 2ZWAA 1DBVO 2CK3D 3FR7A 1R0CA 1MAUA 3DUFB 2HCTA 5LQCA 2P6MA 2P4HX 2DSTA 3L1UA 5J2TF 2FG7C 3EMVA 4HXFB 4JX8A 3ZE8A 4ESOA 2QPLA 4PS1A 2I6XA 3UUWA 3Q6MA 4IGAA 1B8VA 4QQKA 2F8LA 2KI5A 4R1QA 2QIOA 3MCAA 4XE5A 2MIIA 4ZCSA 4F21A 5BSKA 4UTNA 1THGA 3FCAA 2P5UA 2JA2A 3ZXXA 3OPNA 5E3HA 4B6JA 1FFWA 1SR8A 4NBNA 3ZWDA 1K27A 1KAOA 1KQPA 2D2IA 3ANYB 2CE7A 2IH5A 1Q77A 3CU5A 3UXYA 1Y34E 4FYJA 1K2VN 2Z56A 3Q85A 4M7WA 3AR3A 1DO2A 2I1WA 3T1TA 2DWPA 5EXSA 1D4ZA 1XZMA 3KM0A 2H11A 4JVMA 3E61A 4MUNA 4WLVA 3NIGB 4OP2A 3TSAA 4CNBA 4MV0A 5T6MA 3L43A 5HJ2A 1N3LA 3D2AA 3KWJA 3A9CA 2ZJ6A 1PTKA 1RM5A 3A6FA 4TWIA 1W40A 3W6ZA 4DNOA 3N7UA 2Q2VA 1ZRNA 3H65A 5KX5B 1E6UA 4NABA 1Q1AA 1NUQA 2IHZA 3H1EA 2R8XA 2AD5A 3TOVA 4KR3A 1M6WA 5JI3E 3LWQC 2UU9B 5FA5A 1NF3A 2CUNA 2FFAA 4HMPA 1T4DA 1NASA 2C77A 3ORRA 1O6FA 2SNIE 4CF3A 3ZOPA 4MW4A 2ADMA 1FVXA 1ACMA 1IQ0A 1JJVA 2QTVB 2BMJA 1VL0A 3GNLA 1VFPA 3NZEA 3QMWA 2WC1A 2J9ZB 1EZ1A 5AVOA 2WALA 2FDCA 2XCSB 4BQFA 4HOYA 2GFIA 1ILWA 1WAMA 4WXYB 3TL3A 1KC3A 2CYAA 4MKIA 5FUBA 4JI2B 4JY7A 3LX6A 2AVDA 2PZ8A 4PY2A 1QP8A 4WCDA 3TLAA 5KHLB 3QOYA 3ELUA 3CWZA 3SBEA 4PSUA 4YP6A 5HG0A 2AJCA 3EZFA 4I5DA 3COPA 4UHBA 5KB3A 5TMEA 4ND6A 1NUTA 1KDZA 4RZ2A 2JHPA 2RD2A 5A3SA 4KPYA 4RKQA 1IY0A 2O3QA 4F3TA 1AIPA 3R5FA 2D00A 2G63A 1YJ8A 2WT4A 4JT2A 4MX8A 3DGEC 3EEIA 4L5BA 1U9ZA 2PBRA 4NBUA 3UWKA 1Q86H 4HTFA 3HJAA 3VR6A 4H6VA 1T13A 2AHOA 5KSOA 2HH9A 3WRXA 4LMRA 1M5TA 4BT7A 2PM8A 4Y18A 3BRWD 3A9VA 1KEVA 4ZQFA 1MJGA 3CEMA 3PICA 4FGKA 1Z47A 1C7QA 1JSLA 2C99A 2UVPB 3P45A 1QQTA 4LHYA 3AF5A 4QWWA 1GGVA 4WECA 5EIWA 1EFPA 1C9MA 3CC8A 1Z3IX 3EFOB 2IYTA 4KIFA 1TUEA 1E1CA 3KU4A 4ZV7A 4BBJA 4CKEB 2NQ2C 4OJNA 1XJ0A 3VR5A 1MC4A 2Z9DA 1N7IA 2Z4RA 2G5GX 1VKJA 4X91A 4Q6WA 4H17A 1Y5NA 1WPRA 3SHTA 2EF1A 1GTSA 2ZYIA 5EJGA 1WVGA 1FTSA 2A67A 1VA4A 1E7QA 2TMYA 4RHFA 2EOAA 4CMCA 4CTJA 4PZCA 2CLMB 3PJEA 4LZLA 3HRIA 4CCSA 1I0IA 1YRQA 1LQTA 1ADFA 4QU9A 1LDEA 3DJFA 5AXCA 2Z30A 1W2GA 3GH3A 5JY6A 3HU5A 2W2TA 2BKXA 4EH1A 1NLUA 5LMNB 3HK2A 5HK8A 3A9RA 2JJ8A 2AV6A 2ORIA 3OOEA 4EA8A 1B1AA 1PQUA 3F4BA 1RI1A 3IT3A 3DDWA 4YRMA 3E9DA 3G0IA 4TKVB 5B5SA 1JEDA 1R0SA 4KQ9A 4RABA 1X92A 2X19A 3EJ6A 2RBGA 5CRIA 3M1IA 1F51E 3IUJA 3VPDA 5CBPA 2WTBA 3ON5A 4KX3A 5EPEA 3GLGB 4RNDB 1IBRA 4HT3B 5HJ7A 3CYQA 1P2FA 3AHFA 4LJ4A 3E1GA 2LCFA 3DXZA 2QM0A 3G0DA 2H2GA 4QTTB 5CGZA 1C3XA 3IMKA 1U8ZA 3RS8A 5C81A 2ILVA 4XCQA 1ZIYA 1RKXA 1C0PA 1W85B 1EA5A 1LUAA 4LYEA 4OAPA 4PG4A 4QODA 4TMFA 3D5QA 3KYJB 5DTIA 4C7XA 4XD7D 1DCMA 3EZ7A 1P9OA 3AFIA 2PL9A 3EVBA 5CCDA 2ZRDA 2X0NA 1IG3A 3B9RA 4LXHA 4Q9KA 4MKGA 1G4AE 4EG0A 1MPXA 5BMVB 3ECCA 4B1FA 2IU6A 4RVOA 2V7VA 5CCEA 1ZR2A 5KC9A 4OFZA 2QY6A 1E4OA 1W55A 2XYHA 4CDGA 5DKFA 2EEPA 1ZUD1 3BWXA 2CD9A 3B1YA 3BB4A 2B20A 1NSTA 1GA4A 1Z34A 3UJHA 1MABB 1UXHA 5SICE 3MGAA 4UUAA 3AR2A 1PZHA 3FIJA 5TF0A 4DEXA 1T35A 4R7GA 3WICA 2BTQA 5B6PA 2AQIA 2UZ3A 5FWXA 4CIWA 5JXGA 4QGGA 2C57A 4NARA 5AHKA 3FWPA 3NP9A 4K2HA 3V42A 4BKUA 3DFKA 3W0LB 1T8YA 4UTZA 2HHHB 2D1TA 3MW8A 2I03A 4BFUA 5H7XA 2MSLA 4CCWA 5AH0A 4L08A 4BUZA 2AXQA 4EP1A 1Q19A 3HV0A 3PHJA 3FZYA 4NWIA 3S0HA 1R1DA 4AY5A 1QIJA 4EUEA 5C1OA 2ENUA 4PZPA 2HA5A 4AF7A 2OVFA 1VKRA 4TZKA 3AESB 1T26A 3E8XA 5J40A 3HWUA 1JA0A 3QKUA 4B6QA 4DG8A 4F7DA 1EUQA 3ZJ4A 1AH2A 1QV9A 1V7PC 3CR8A 4EI8A 3H4TA 3Q0IA 1FP2A 1LBEA 3CBQA 4MRSA 3DAHA 5KI6A 3QQ5A 4NMMA 5NULA 3UKJA 3ZK9A 1H23A 4RADA 4DLWA 3F49S 1Z4MA 1M2OA 1RMQA 1SZJG 4E2XA 5FDFA 1LC0A 1Z88A 1H1LB 1O9GA 2C5BA 1R6TA 3GW8A 4PLPA 5FO1A 4CMGA 1YZFA 4EJ2A 1KSHA 4BOYA 1NVBA 3NH6A 1H2AS 4JKOA 2VK1A 3NWJA 2QZPA 4KN6A 2HEGA 3SYKA 3QYFA 1GDDA 2NO1A 3OE7D 1F8UA 2C4WA 3O8OB 3AQIA 5H82A 1KFKB 5I6DA 3E0QA 5JJCA 1GPMA 3B70A 1X38A 1JLLA 1TM4E 2OXEA 5C53B 4YJGA 1M6EX 1YR8A 5K3EA 1WF3A 1W3EX 1H2FA 2QS9A 4I5GA 4TQUS 2HJHA 3F90A 3MUOA 2PVCA 5IANA 3S1LA 4XWAA 3W4IA 1ORVA 1RHJA 2ZUDA 4P4TA 3AP3A 1I10A 1U3LA 1IBCA 1KYWA 2JGNA 4HGRA 3PC6A 1CQIA 1KEUA 2MYTA 1T0HB 1XX6A 2W2VA 4FVTA 2ZAIA 1RXSA 2DUWA 5A06A 1UKAA 4U7DA 1F6WA 4N8EA 1TZ2A 2HDWA 2FWJA 3A26A 4BB9A 4L2IB 5JTTA 3ESDA 2VBCA 4B48A 3FHLA 2GUWA 4ETIA 3P9SA 3KZVA 3L8HA 5I5EA 4Z7OB 4KHZA 3O7WA 3PDIB 2NMVA 1M54A 5FI5A 1BQ4A 4KIJA 2SECE 5FUXA 2B82A 3V7QA 2YASA 3HEMA 5BMOA 4TYWA 3GU3A 3TZCA 1KRHA 3DDNA 4X71A 2FOLA 5F5LA 4CNQA 5LB4A 5JARA 5D7NA 1TO6A 1Z2EA 4UM5A 1FNKA 1NKTA 3DC7A 5LP1A 2LZ0A 4JCCA 3R09A 3A6EA 3X1DA 5L3QA 4YJHA 4D26A 4IG4A 1M6VA 1SCUA 4TM7A 3DPSA 4LNHA 2Q9AA 1DTWB 3GC6A 3I30X 1T1GA 2FP3A 2X40A 2ZI9A 3BE4A 3PJGA 3K92A 2YHUA 3FFXA 3H0EA 3NTQA 3W2GA 3B1JA 1GO1A 1EFVA 1QVFF 2OP0A 2O19A 2AKEA 3TEFA 3OT1A 3OFND 1X6VA 2NNLD 2GRAA 4TKZA 2VPTA 1JRLA 1WUJS 1HO3A 4FDTA 4G5GA 4ZYLA 1PR1A 3DV0B 3CVXA 1TJNA 2W6JD 3IIIA 2P6NA 3CCQF 4B5CA 3P0ZA 1T8SA 3L06A 3LUKA 4KW7A 5JS2A 3WNVA 1ZU5A 3ZWXA 5JT1A 5AKEA 5FL3A 4KXLA 1ETUA 1J9EA 1TCBA 2JAXA 2QTTA 2C96A 3H2HA 3NHMA 4MICA 4R8VA 5FTNA 4ZXFA 2QMYA 3K5IA 3QVUA 4L74A 5TRTA 4GL4A 4ZDKA 4LF6B 4CR6A 4WINA 1T8TA 2GBIA 1LS1A 4X3PA 1AT1A 1DVRA 4XGIA 1X1QA 2ZYTX 3PV0A 4S1PA 1BOFA 4ZVNA 3ZBPA 3Q2OA 4RW0A 4YP7A 4C0KA 2JVKA 4IGKA 3IEMA 3E1YA 4FONA 5LP6F 3HO6A 3UK1A 4S05A 3M9XA 1QIHA 4PW0A 3O4IA 2O6HA 4LGYA 4WNIA 3HPQA 4Z3KA 3R7WA 5F7OA 4LF4B 3DZBA 2FVYA 2Z1MA 1ULTA 1LQ2A 2WPDD 3RR2A 3HFRA 2R8BA 3WWZA 5AM1A 1Y3FE 3F9RA 3WRYC 3K1AB 1R66A 1E0JA 2NW6A 2IPNA 1HL7A 1KK0A 2EJUA 2G4CA 1HOTA 1EE2A 4JUDX 5C0OE 2QMEA 4YRRA 2ZSAA 5ILQA 3BWBA 2BO1A 2ZIGA 4IMRA 4DIUA 2JKZA 4YJKA 3SR4A 4BRUA 4J2HA 3WGMA 4EQZA 3WA7A 3RUFA 2UYNB 3SX2A 2IF0A 1YZUA 2RB4A 3KKQA 1YZ3A 3NFYA 1D7OA 3QM1A 1FUYB 3CC2F 1BTOA 1C8KA 2LCIA 3E48A 1AK9A 2A4MA 4PWTA 1V6SA 1X2BA 2VWQA 2WYHA 1OAKA 3FAKA 4HF7A 2YVAA 3EAFA 4DLVA 5B6JA 5LU9A 4DIEA 1JQKA 4CEIA 3BGWA 4LYAA 4F96A 2ONCA 4DADA 4RTQA 1EM8B 1OSNA 1R2QA 2DECA 5BSMA 2XRFA 3F5SA 3UQZA 4MI9A 1VFNA 3R3XA 4KFCA 4TL9A 1U8UA 4NNPA 3K14A 2CF6A 4IQ4A 4XDHA 3CB4A 3N39C 3V1LA 3ITEA 2OZLA 1T5LA 3REQB 1U28A 1K4KA 3CCVF 5E6UB 3TD5A 1DJLA 4MQFA 2XBMA 1XN4A 2Y1DA 4KQIA 4PPGA 4TXJA 1C1DB 3VPFA 3H2ZA 3U60B 2IT1A 2JFWA 6REQB 1LPBB 2FPXA 5F4ZA 4FHGA 3IL2A 5M7EA 2BBTA 5HS4A 1AUXA 3VNQA 1KEPA 3PVSA 4XGQA 4HATA 1OBCA 3MS7A 3WXBA 1FMCA 1UQUA 3LWDA 4L4RA 4E7PA 1QTIA 5HX7A 3CVVA 1P2UA 1WHTB 1WDTA 5H80A 4BNLA 4QUDA 4I55B 4ZVTA 2ZBGA 1XQXA 3NVMB 1EG2A 4JNCA 3AOEA 5C8ZA 3LWZA 4FI3C 4LZOA 3EE6A 3ASUA 3EVGA 1IXYA 2VLBA 2WKWA 4U0JA 5KAPA 1V11A 3GEHA 4I1SA 4OSPA 5EG5A 4GVXA 4XGRA 1J1ZA 3RBXA 3TXXA 4EFDA 2GVZC 1DLIA 4UVEA 5EJ5A 2I3BA 4KPEC 4BT4A 3Q7IA 4J0CA 2M6RA 5HYVA 2QYHA 2CHEA 1B93A 2YHAA 3LDUA 3DAGA 3V7YA 3KQYA 3U49A 5B2FA 4U8HA 1L1QA 4DV3B 1R10A 4YCLA 1MIOB 5JPCA 1W41A 2J7KA 1QHEA 1J07A 1SMKA 1T1SA 2O2HA 2OGTA 2Q2QA 1XTVA 3DKIA 4H1HA 4KU4A 3SS8A 1TIPA 3JQAB 3NHBA 3D2LA 4C82A 1M74A 3PUYA 3AXTA 2J85A 2IWHA 4AFNA 1RD4A 2LUOA 1XD9A 2P9QA 3EA0A 4PO1A 1KXJA 4O0MA 1TAHA 221PA 5JXWA 2QUBA 2WIKA 4K88A 3W34A 5A05A 3IEPA 3NW9A 1AE1A 1JL3A 2GN8A 3RIHA 2H1LA 1ZL2A 4KQ6A 1R4MB 2OA0A 2A5JA 5KO2A 4LTDA 1ZVQA 1M9NA 3TLCA 4DHWA 2B92A 5B1IA 1Q7GA 1QG6A 2R8EA 2DG2A 1Y4SA 2XTMA 1KU0A 2HQBA 3KKMA 4M0MA 2O50A 1NRXA 3PKIA 3T3EA 1CK2A 3K73O 4ISBA 1V1JA 2I6FA 4XX1A 3U6BA 2H16A 4V1CB 5I7HA 3VX3A 2YXEA 2SKEA 4O2AB 3ANTA 3BFXA 4PXSA 1KE2A 4PVDA 5K3FA 3HJHA 4XVRA 4Q4JB 1SVUA 1U3WA 3RRJA 1MAWA 1LFAA 3BFPA 4N6NA 1EVYA 1HDCA 5B1HA 3UY4A 1R0XA 2GJ9A 1N2BA 1SUDA 3FPJA 1HDIA 4Y3UA 1CVIA 1SH7A 1K3UB 1Y8CA 2W83A 5FT9A 1X15A 3TW8B 2ZSJA 4OQFA 4C3VA 4CV1A 4X9XA 1UXOA 5ER9A 1V8OA 1JAYA 5D1HA 2HAEA 4DMRA 5BYAA 1M3SA 3OZRA 2G7MC 4LJKA 4LVUA 3V4PB 2RK3A 3NV7A 2XQIA 3V7WA 2H5LA 2HDNB 3LP5A 1MOZA 4F5EA 1OYVA 1JFSA 4E3ZA 4GPZA 1IJEA 3D31A 4N7MA 3UENA 1YDHA 4NHEA 3TZHA 5DW0A 2IYWA 4JL8A 4P35A 1S8NA 4M76B 4DCTA 3QBEA 4UQPA 4HRVA 1ZK0A 3FPEA 3OX4A 5EP2A 4PHCA 3WIEA 1JNXX 1Z25A 1FB5A 4Z8XA 2V5VA 3K0FB 4DCMA 4ZC1A 4KXWA 1CKEA 2V7UA 4C4YA 1Q11A 2EX1A 4JMLA 5FEUA 4F3NA 2XXAA 3VR5D 1NJIH 2ZRGA 1MOQA 2ZR8A 3WY9A 4D2IA 2H1OA 1BVHA 2Q5IA 1PSZA 1S0UA 4UZEA 1E4VA 1XVAA 2N0SA 4WY8A 2BCEA 4EECA 5MF6A 2BGUA 3BS4A 4Q3DA 4YXFA 3HDGA 3QWIA 4V0KA 2E0IA 2IYOA 5J1SB 1N7JA 1P5HA 4XSVA 1SC4A 1PG0A 3V8EA 4ZI3A 4EEKA 2WQ6A 4C88A 2W00A 1OBHA 4BNNA 4NVRA 1RYFA 2NU8A 3VU8A 1CK4A 1EUZA 1J2YA 1RYNA 1GNPA 3IA2A 3KAKA 4JD5A 1MVNA 1KU6A 4KVAA 2IV2X 2ZTLA 3ZK8A 1Z9BA 3EEBA 3SIRA 3ESBA 3O8QB 2WU0A 3TXAA 3EBPA 5K6AC 3OLCX 2PJDA 4NU0A 1BE6A 1XHLA 3M81A 4QO7A 5YASA 2PE5A 1BGXT 1RNLA 1PQYA 2GM5A 3CD6F 4OEHA 5B3AA 2F9MA 1QOZA 1QP4A 5KNLA 4KV9A 1XZCA 4JELA 2QYTA 4Q4LA 6CHYA 5HF5A 1QONA 3OLZA 4ITUA 1XVUA 3DVSX 3DOOA 4JOSA 2OHHA 2EIXA 2E7ZA 5B53A 2QEQA 4U6NA 4FB4A 1O96B 2C92A 3UJ9A 1TYDE 3UG6A 2C84A 3SC6A 2P2DA 4G4SP 4N3NA 4QLBA 1R4NB 3W1WA 1KERA 7ADHA 2GHTA 1U0GA 8MHTA 4H7EA 3N28A 5LQJA 3UB2A 1EA7A 1XXLA 2GEFA 2VHVA 2AFHB 5KX5A 5E0OA 3TKAA 3WNCA 4LCKA 1I9CA 1IOLA 1IE3A 3U7QA 5I9LA 4NE7A 2IYZA 1S7GA 2HRUA 1KC1A 5FOUA 5BQOA 4D9NA 3WKEA 2FWBA 2IYRA 2GYUA 3BJMA 1OREA 2UYYA 4JIMA 1XZNA 3ZQ6A 4U2KA 3ZUPA 4DAEA 2QTVA 1ISFA 5E3IA 2ECQA 5FLXA 1VBKA 3LZ6A 1PGQA 1B8PA 1H4QA 5HWEA 1JG2A 3GLSA 5CB6A 2AW3A 4RCVA 4I1VA 1D2MA 3V2UA 2JRCA 1BOOA 5EAZA 5B8FA 3RCBA 5ES4B 4FINA 4YQFA 2FR0A 1PJ3A 2DMRA 2H2IA 3CEJA 3L93A 4KQEA 4PWZA 4FLFA 4Q19A 4TOIA 5AOBA 2F3SA 4CF7A 2I7XA 3DFFA 4FKBA 1G2PA 2VNSA 3PFFA 1PWXA 3O8DA 1U0NA 1JN1A 1GNTA 3Q5GA 1SCJA 4KDRA 1J0CA 5AK5A 5KTRA 4BVAA 2DPLA 5GOZA 2B8TA 2BDTA 2QBYB 2JFUA 3WAKA 1RWNA 2EKPA 4H4EA 2HFKA 4EHKA 3CQ9A 3OZUA 4HMQA 4R98A 5IF9A 3IO5A 3K9NA 4TMKA 1Q1EA 2GYWA 4ETWA 3C98A 4ILEA 4YMSA 1MAAA 2QSJA 3WBFA 3MSCA 3N8GA 4NYMQ 5EP3A 4BVHA 5KUTA 1NU8A 3OZGA 2ZRQA 1T4CB 4IOMA 5LOVB 4JK3A 5CH5A 4AF8A 1X94A 2ORYA 4B2IA 3G82C 4H7DA 3CM0A 3OQ1A 1PFQA 1B41A 1B0UA 1DQPA 1NJ2A 3P2IA 1MTOA 4I0WB 5EJFA 2Y71A 3B38A 3CKLA 3PG5A 4GQBA 1SKUA 3JD0A 3L02A 4RIIA 3RS9A 4DW8A 1N6IA 1A9XA 2YV5A 3FG9A 1NRWA 3PNMA 5DI3B 5DZSA 4NWOB 3IPYA 5E1OA 4EA6A 4IJWA 3GNQA 3K2EA 1AQJA 2GZSA 3GROA 4BIIA 2I4TA 2ID4A 2H4FA 3I1IA 4C4ZA 4DIFA 4EHHA 2MJLA 2GWHA 5BRJA 1GPKA 3EAQA 3PRKE 2GFHA 1CF2O 2Z2XA 3C3YA 1BDJA 2RGAA 4CMIB 2WFLB 3BK7A 3O4VA 1T0AA 1QVZA 1G0NA 1GRQA 4B3DA 2BGRA 4A15A 1AQIA 2YJNA 4OHMA 1PGNA 4AC9A 3EARA 5A04A 5C51B 1SN7A 4B6PA 3TJZA 3M6WA 2D0OB 4FSDA 4EKDA 1A8SA 5K0ZA 1MX1A 2FPMA 3W3AA 1TTTA 3MJEA 3B82A 2XB8A 2J5BA 3Q1KA 3QXCA 2E4XA 3MJHA 4I08A 4N41A 4PPNA 2H4YA 4ZFNA 1YNOA 1FJHA 1QF9A 1QGDA 3G02A 5CB8A 4TKVA 1E6WA 4L78A 2J3DA 2OCBA 3NUQA 5FPPA 4YDHB 1PWEA 4EMTA 1GUYA 1YB2A 1XLTA 1OBOA 3N3AC 4QUBA 1GTZA 3X1WA 3GLGA 3OCXA 2OTJF 5C8YB 3NK6A 1O57A 3PDUA 4OFBA 4UU1A 1VHQA 4DR3B 3BIWA 3RK0A 3HG7A 3PA6A 2ZPAA 2AKYA 1KO1A 3GN1A 1UK8A 3L40A 3AFOA 1VLMA 2H06A 4TZ0A 1TEXA 4LTMA 1N9GB 3EDRA 5AVSA 1BC5A 1XRMA 3E9CA 3NHPA 4I9NA 2B98A 4CLOB 1Z7BA 1QLWA 4TS9A 3C3XA 2XCRB 3LZDA 1UMDB 2QXTA 1IN7A 1BO6A 3SIUA 1VHLA 2FEAA 5ANRB 4CM6A 1VI2A 3INGA 3GFFA 3OO0A 3GPBA 3Q41A 4TYMA 5ERYA 2C3OA 1K66A 4CLEA 1Z12A 1KZ9A 3WLKX 1ISSA 1SB8A 3U9TA 1VJ5A 3PHCA 3GPLA 1COWA 3PXEA 1QCYA 1YRYE 3BGSA 3GLUA 1UM8A 2QLMA 1DDGA 3AINA 3CZ9A 3QYPA 2JZOA 1OTHA 1DX4A 1UP7A 4PYOA 3STHA 4MUMA 1QX3A 2JD1A 3AR7A 3DR3A 1IDOA 4P3XA 3IAM1 2QG4A 4KQCA 3DP9A 1HFWA 5FWAA 4OBEA 2WWXA 2ZT7A 3PNYA 4PRZA 2ODPA 5TARA 5IFLA 3ZY2A 3EXAA 2I2FA 2FPUA 2QE7A 4D42A 2OD2A 3TDKA 4K9KA 1Q92A 2AE2A 5LQNA 4CHGA 3KKLA 1SBNE 3OZVA 1WNFA 4INOA 5JAOA 5KX5F 3VR3A 1JWLA 3G8DA 4NMLA 5DTRA 1KJYA 1SCKA 1TK9A 4QATA 4P2BA 2V8BA 4U6SA 1ORDA 1AMNA 5BQPA 3VJRA 5J3JA 1U6KA 1KEEA 3AESA 2H2WA 4GOKA 2VZ8A 5IAOA 1IVNA 2J0EA 3R6LA 4AKGA 1F2DA 1FYEA 5KSZA 1D1TA 1ZIDA 3DFMA 3GLRA 5KNBH 4W9MC 3GDGA 2WF8A 1PDOA 1NLZA 1UI9A 1XZLA 2ZBFA 2AC4A 2IYLD 3LPNA 2YC4C 3P9RA 4J43A 2WIDA 3USCS 1EWQA 4RTRA 1H1LA 3HWSA 3BXXA 3A6HA 2V03A 3NTUA 4G4GA 5DOVA 1P6UA 1M1UA 1RWVA 2QXYA 3PEFA 5DSXA 2QLFA 1AJEA 4DSZA 2XDQA 2HA7A 1T8RA 5EB0A 2GPNA 1PBNA 2ZAMA 4NG5A 4C4OA 1WE2A 2K6GA 1HT3A 5LQAA 3E4CA 3O8OA 3R76A 1VDZA 4H3HB 4BFZA 1P75A 2GDJA 4NZZA 2XGGA 2Y1FA 4GLFA 4K9PA 1L5HA 1JKIA 1EFKA 1HQKA 1UP4A 3MWFA 5LUBA 4AMYA 2I6GA 3GCGA 3DEJA 1ZHOA 1XROA 2IXEA 3KZCA 4G0UA 1YE8A 5F9HA 3B8EA 2HBZA 3BWMA 3BD8A 1UWLA 3EASA 1MFPA 2FPOA 3MBKA 1ZCFA 4RV9A 4D3FA 1Z2CA 5C8XA 1WZ2A 5EMJA 4PIPA 1JBKA 4BFCA 1VMIA 2IS2A 4B3FX 1H48A 3AZOA 4O25A 3WGHA 5AOCA 1DC3A 4NUTA 3JQFC 4IHAA 1DX6A 1V5FA 2IWRA 3W04A 2CC2A 3NJ8A 5TNXA 4EFNA 1V1RA 1EXVA 2CV2A 2AOUB 1PGOA 3A6ZA 1M1YE 4HVCA 2QQ5A 2XRZA 1JVBA 4FDAA 3TBKA 2C00A 2E21A 3NVAA 1FYFA 4V0NA 1KIAA 1P9NA 4S04A 1SU7A 3CCSF 2ZQZA 4MYUA 1LSOA 1TF7A 5HM6A 4DOMA 4EDHA 4MYTA 5JYEA 1XZPA 3GDOA 1V96A 1CLIA 1TNDA 3NP7A 4AROA 3I92A 5CJJA 4O3FA 2WDPA 4KXFB 2CBZA 2LBPA 4AZ0A 1U7UA 2P0AA 4J03A 4RVUA 5H4HA 1YR1A 1CY6A 1UK7A 1T9KA 4NIMA 3U3KA 4LDPA 3F9CA 4TLMB 4Q12A 4EG1A 3B9BA 4RVDA 5THKA 4A0SA 4EVSA 3QFFA 4W5TA 4LPKA 3MA0A 3M1XA 1U8EA 4RETA 3TFQA 2CFTA 3OZBA 4N0QA 1X1CA 2JFPA 4E5DA 1OVMA 2OLEA 5H0IA 2XT0A 1AKRA 1KDTA 3C5WP 1RHQA 3DV0A 4II7A 3WIBA 4PYJA 1OLSB 3I39X 3KAJA 1QFYA 4OHVA 4Z9XA 2G04A 5G0TA 4GIBA 1Q57A 4UKDA 3DDSA 1VGQA 3EPPA 4DCJA 2FFRA 4DILA 2CJXA 3T54A 3CLUD 4GI7A 1OX6A 2VDQB 1WOYA 3CUVA 4MLZA 4P3YA 3WGYA 5CFNA 4YK7A 4DWWA 5I47A 1M72A 2IEDA 4QJ4A 2BGNA 4G5QA 4LX8A 4KE6A 4NAHA 2V5UA 1PR9A 1FPQA 5JRDS 1HE5A 5K6TA 4KAFA 1KI1A 3OJCA 3PVCA 3RAJA 5JJKA 4RHUA 1RQ2A 2WFZA 3BDIA 3BPSA 5CLJA 2HLNA 2Z8YM 2Q2OA 4RIFA 2WU3A 2UZ0A 1XPJA 1H66A 2EJBA 2WW8A 5FPHA 4BJ1A 1XNJA 4TLAA 1MZVA 3R8XA 1VG9B 3TVDA 5DCYA 3UB4A 3D1VA 1ZI6A 4G41A 1XZDA 3EUWA 2C2BA 5EQTA 2CYBA 1KPIA 4FMDB 4IX1A 2QOEA 3PQCA 2IVZA 2HADA 4I5EA 1N77A 2YWBA 5BMVF 3CMCO 3SJAA 2JATA 1O89A 1YDFA 1VYVA 1R3UA 3K20A 1MB4A 4HLNA 4ZMSA 3GR6A 4HH4A 3W9BA 1R8QA 4R51A 1RXIA 2LTAA 4DVJA 1OFHA 1YBMA 4HQRA 5C1IA 1AMUA 1P0FA 3HUUA 2GUGA 2J08A 3EEYA 3O8BA 3P9ZA 3U4QA 3D2BA 5CX1B 1DBPA 2W2PA 3MIZA 1BKSB 5K0BA 1AC5A 1JDSA 2PU5A 2ZJYA 3KOUA 4MUYA 3WP1B 3MUNA 5BN3B 3GGSA 3O1IC 4QNRA 1Y8RA 3VTFA 3NVDA 1QOPB 1GZ0A 1AB6A 3KP1A 1YHYA 4F5ZA 2JG3A 2G71A 3B9PA 1TJ5A 3H8VA 3K96A 5HIIA 2FUNB 1RRPA 2XH8A 2Z08A 3QBVA 4L07A 4R2IA 2DFVA 4BB6A 3ZLTA 1YNSA 2Y2VA 5JEDA 3GLFB 1JIKA 1DRUA 5A5FA 2HPAA 3N5CA 2ZTSA 3FBTA 2F1RA 2CJYA 3R3SA 2YIDA 2NZ8A 2VUSA 3I8OA 1TD1A 4WXMA 4LMAA 4WKCA 3LT4A 4WH0A 5HKAA 2V8OA 1PK8A 1G18A 1SEVA 2I8LA 4ZVKA 3OMWA 1X1DA 2XF8A 2XOXA 3I2HA 2Q2NA 3CLRD 621PA 4QDOA 3V6LA 3ZX4A 3RUAA 3C6YA 2EKBA 2HU2A 2R6AA 2ZRAA 5E6UA 3SBOA 4D74A 3HB5X 2WD9A 3C14C 5ITZA 3AUYA 1N8TA 2VK8A 5TEWA 3WNBA 2YZNA 2XYRA 1C1DA 2OBBA 1M34A 4G0PA 5IBQA 4EVIA 3SIWA 1NQAO 2OCKA 3EZYA 2XNSA 2P7HA 4UHKA 1CEYA 3FOCA 3U0OA 2PRJA 3PFCA 3PIDA 3SQNA 4E70A 4EYGA 3IUPA 4C3UA 2ZBEA 1AA6A 4OHXA 4B3GA 2IIBA 2H7YA 1R00A 5JWHA 3FPIA 1FPMA 1U7PA 4G2NA 1Y7PA 4IQFA 5DX1A 1IFXA 3U4IA 1WHTA 2PX3A 3FGNA 2QQGA 4I55A 1WM1A 5I8ZA 3G23A 4J2TA 2FEOA 2SCUB 4NXMB 1U1EA 2NO9A 4K5QA 4YI3A 3OLYA 4K9SA 4ZREA 4JAVC 4X24A 5AM3A 3TXYA 3VPSA 5JDIC 1GVNB 1QF7A 1W87A 3EGDB 4F1KA 3U5TA 3PCXA 1SZDA 3NRBA 3PFWO 1LPOA 3JYLA 3R6WA 2OGWA 4HN9A 3AUFA 4GBED 4UUPA 4Y6PA 3VYTC 1XMXA 3NDPA 4J9VA 2COEA 1LBHA 2ZVPX 4NYJQ 1II0A 3A06A 3PYMA 2C5FA 1V37A 1MIOA 3G2IA 2MHCA 4C4SA 2Q1UA 3A31A 4TS1A 5H9WA 5HKOA 3JQAA 2IYVA 4K6HA 2LNDA 3JSXA 3F4LA 1Q2UA 3GFSA 2A6PA 3K70C 4CQMB 4XQ9A 5T4BA 2DERA 2B1JA 4WV3A 4EG3A 4E6EA 3SEAA 3DDUA 1J9GA 1JE0A 3CZ4A 3OJXA 1XDBA 4YRLA 3RSSA 3ZE7A 1JHZA 7REQB 4B3RB 2X1VA 4FJ1A 3R0PA 3PRHA 4MO2A 4LYDA 3ZDCA 1PP4A 2PJUA 2VEOA 3LKBA 2G9NA 5K4GA 2PGOA 1TZJA 4PZUA 1FLNA 1TL7C 3NHKA 3C3KA 2NT4A 4BV2A 1UKCA 4FX5A 4MVJM 5MDHA 4OSOA 3PXBA 2IW1A 3D8RA 4RS4A 5E4JA 2AIZP 1G41A 3CPQA 1HC7A 4FBMA 3EDYA 3MT0A 1X14A 4H0FA 3DLIA 2XLBA 4JLDA 5A4DA 3ETJA 2BKUA 2NTNA 1TX4B 4JITA 3IOCA 2LE0A 1D04A 1VP3A 4V1CA 1FUIA 3FKQA 5IXJA 1KI6B 2ZVDA 3NBMA 4W1PA 4HDCA 1ORIA 3ZWYA 5L3VA 3OICA 4FZRA 3K0CC 3WG9A 1BG6A 4L73A 5GJBA 1RXVA 3FI9A 1NQXA 2H54A 2NZWA 4GPTA 2GZMA 3GJ3A 2ZIZA 4KQFA 5F5NA 4ZEXA 3ZW9A 3NYIA 3IHLA 5CXSA 3WB1A 4PZDA 3TW8A 3KDPA 1WMBA 1UDWA 2QG6A 3CFYA 3NXSA 3LCJA 2HRBA 1H69A 1Q6YA 4OHZA 3SM9A 2D13A 3D3KA 1AKVA 1U3VA 2Y1KA 5F35A 4CKWA 4QYIA 1JX6A 4LHXA 5BV0A 3I9FA 4P3OA 2BLLA 1YR2A 4UJ5A 4WGFA 1YO6A 3TQQA 5D5HA 7ABPA 1O6GA 3I56F 3CCFA 4FR2A 4UEJA 2IEGA 5EGSA 5CK5A 2H9AA 2NAPA 1UDXA 4KLCA 5HUJA 4YB8A 3QPDA 5I4KA 1PFUA 4BMPB 1E0AA 5JIBA 2XXJA 5IT9A 1RYDA 1RJ9B 1UC4B 5AKHA 5GIOE 1RFLA 4N0MA 3QVWA 3RFFA 4WBNA 4W5NA 4LXUA 3SFTA 5TQVA 1PAUA 1U0SY 2VRNA 1Q7YH 4JVOA 1ZN2A 3BCUA 3O9MA 3TJRA 4AECA 4DG5A 3W5AA 4LKOA 3D6NB 3GIWA 3OE1A 1VJTA 2BFDB 5ALTA 2PGDA 2W8BB 3WQRA 1ZK4A 4NLLA 5BRAA 1MV8A 4D97A 4XIFA 4XOIA 1TM7E 3R7NA 3WLJA 1GTRA 4NYMR 2HLHA 4GPBA 1XQYA 3U4AA 4MI6A 4RTJA 4HGZA 5ERGB 3WSWA 4HRXA 3RUHA 1UJ5A 1I5EA 4BU1A 4FI3F 2CL7X 5FLKA 4Z1MD 2SBTA 3FTDA 4QM7A 1CPYA 3WGKA 4LV5B 3UPTA 4AJNA 3BZBA 1BZYA 2WFAA 5KTKA 3ZIAA 2HKIA 3JRNA 1P1CA 1T4MA 2PN1A 2ZJ2A 4WLNA 3UXEA 3W3AD 4BNDA 1NUUA 4EF6A 5DN6D 3O8QA 3HXOA 3OZFA 5DGIA 1LFDB 2J9FA 4TKUB 1U8CB 1H9AA 4FMBB 1RLGA 3W6NA 2GT1A 3P97A 1Q95A 1AKYA 1QGED 2WD7B 3OSUA 3W9YA 2Z58A 2QPOA 2UV8A 4G0VA 4CGZA 2F1IA 1XZFA 4KXVA 3S03A 3G2LA 5CTJA 1R6BX 1QIMA 4WFQA 3VHQA 3R3WA 4D44A 2QTZA 2J0VA 4G65A 4PX3A 2G9UA 4NCBA 1O96A 1P29A 1TO2E 3AFMA 3KJQA 5CT9A 3ETDA 3QG1A 2MQEA 3V3TA 4KUHA 4US0R 4NBSA 1I4TD 3ZY5A 1TEHA 4H2DA 5KTOA 2B2CA 1ABBA 3A4LA 3L1KA 1EHYA 4HAIA 3S02A 4I55F 2ZI7A 4I9FA 1XMVA 2I99A 4MWEA 3U3XA 3UYLA 3ZHZA 1I7LA 5JV5A 5LKRA 2AFHA 1CB7A 1S8OA 1Y7HA 3BUSA 3F71A 3LC7O 2FPGB 4QDJA 5EPOA 2VHJA 5JCPA 4IAOA 2JLRA 3U61B 1QRSA 2C2MA 4GLJA 2R6JA 3KJGA 4LJYA 2Z9BA 2ONYA 4CIXA 1RWBA 1O03A 2CNLA 2GPJA 4DHEA 4AG5A 5G3YA 1EHIA 3ELWA 5EZQA 2R8RA 4HVLA 3RUPA 2UZ1B 3A28A 3OQBA 4NBWA 1G20B 4YN3A 1B15A 1V7ZA 1JSCA 2DT8A 4H60A 4F9GA 3HR8A 1G7TA 2FPKA 3SDBA 1QH1B 1K2WA 1QS0A 2RGNA 4YUXA 4HUQB 3P20A 4X6YA 3U3RA 2CLCX 1PUXA 3L0IB 2BSQA 2H2FA 1P3Y1 3AP1A 1VJ0A 3E7FA 4PG6A 3TF5A 4JB2A 1GADO 1O4VA 1P0IA 4PHTA 1T43A 1YCDA 4KFUA 4HQFA 4XVHA 4A73A 4K0KB 4WFIA 5CYOA 3T5GA 2Z8XA 2OBXA 3DMTC 1XFAA 2PGNA 4HAWA 4HNGA 4KR0A 4YP9A 1WLSA 2QBYA 2R5WA 3VR3D 1SUSA 3I0ZA 1QIIA 4PPFA 3K12A 3EORA 3M6XA 3OA0A 1TZKA 2NV2B 2ZJBA 2XGJA 2AN5A 4QVKA 1ZXLA 1RZRA 2GPYA 2QX4A 4MRAA 1D2EA 5E2AA 3KJIA 3VA7A 3GVIA 3OBWA 5LOVA 1JG3A 2J9RA 1U0RA 3DTVB 1GRNA 3TD6A 5AKJA 2DLNA 3QFRA 4RESA 4UU0A 3OD1A 3PR1A 5GVRA 3VTZA 4EYEA 4CKZA 4O2AF 2OVBA 1BKDR 4C6TA 1RPJA 3S81A 5DI3A 4WQMA 4YJ2B 1PZGA 5G40A 3U7RA 4YONB 2ISQA 1KO4A 3GYBA 1FSZA 1EDZA 4A5OA 2HIMA 1HL3A 1UAGA 4ZCIA 3V8MA 1QIFA 1YBHA 3JWHA 3OEEA 2W70A 1G5RA 4LK2A 4CKXA 1K3TA 3BEDA 2VSYA 1KF0A 3GH1A 4IDGA 2C5GA 5PGMA 4QBIA 1V3UA 3JY6A 5PNTA 3ZG6A 3THYA 1X7YA 1ELOA 1VYTA 1MF7A 4HS9A 4XLTA 4AUKA 1H85A 1E3EA 1BVRA 3DVAB 2I76A 3LCUA 1ZN7A 2ZUCA 4I4CA 5TS3A 2ZJ0A 5G4KA 3CXUA 3VAYA 2ZBVA 2J59A 1ZMTA 2W93A 3SC3A 3WJ1A 3TLZA 2MYUA 4MCJA 1INLA 1QHIA 1QKJA 2I3ZA 4MSUA 4RVGA 3O8CA 5H3HA 4P4SB 4TT3D 5F23A 4FYKA 1F4PA 1S2LA 2DBQA 3JWGA 1L3IA 1N2CB 2FOXA 3N0WA 3NC0C 4WLFA 2WKRA 4OJTA 1KZHA 3WZLA 1AVTA 2JGIA 3L7NA 3BN3A 4MIYA 1ZS9A 5DJ5A 5FP0A 3BCHA 4G0ZA 2FF7A 1GAWA 4CFZA 1DADA 4LF9B 2Z8YA 1N9GA 3ISTA 2R8OA 4G01B 4E4RA 3C5HA 2RKBA 5IJZA 1ZMXA 2I80A 1JR3A 3HXKA 5KREA 7YASA 2P5TB 2EWWA 4F1WA 3T34A 2VT3A 2NXNA 4GUAA 3E3MA 1N34B 1LNQA 1OILA 2P9FA 2X4IA 3BJZA 1G64A 1E66A 4ZVOA 4DPLA 5C37A 2LBXA 1LI5A 1QGAA 1WXXA 3EISA 4JUIA 4B35A 3L0YA 4BB5A 3EMDA 2QTMA 3IPAA 3IB6A 3KR9A 3OQIB 1IXRC 2BGTA 3IYLW 4BWGA 4ENQA 2F6RA 3E3LA 2Z0MA 3KETA 3DFZA 1BJRE 1IB0A 3AUTA 1X8XA 3HTXA 3B3JA 5F3DA 1Q7RA 1TUGA 2HV8A 3S68A 9LDTA 2P41A 2PBLA 3CX6A 5H02A 3ZBUA<