4G4YA

Crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein Omp38
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4yA00
3OONA 4G4WA 3CYQA 3LDTA 3KHNA 4G88A 2HQSC 2ZVZA 3WPXA 2N48A 4G4VA 4ZHWA 3S0HA 3S06A 5EB1B 4G4XA 4PWTA 2L26A 3TD5A 1OAPA 2ZVYA 3S02A 3TD4A 2ZOVA 4RHAA 1R1MA 3CYPB 2KGWA 3TD3A 4G4ZA 4ZHYB 4ERHA 3S0YA 5EB0A 3S0WA 2K1SA 2W8BC 2LCAA 4ZHVA 5EAZA 3WPWA 3S03A 2AIZP 2LBTA 4B5CA 4B62A 4R40B 4G4YA 2MQEA 2ZF8A 3IMPA
chains in the Genus database with same CATH superfamily
2PHNA 2HX0A 1VQPF 5LA6A 5FLXM 1IV4A 4ZK7A 3VYSC 2HQSC 1W59A 2Q1YA 1XV2A 1YJ9F 4I4TB 2HS0A 1RLUA 1W581 2ZAUA 4LNUA 5G4VC 5B8FA 4ZHQB 1QU9A 2Z1FA 1W5FA 3CCSF 3G71F 3I7TA 3HKDA 2OHWA 4BT7A 1QVFF 2DT4A 1Z5WA 2AIZP 3P4EA 5J2TB 3VMFB 3FD5A 4KWEA 1N8RH 1VK3A 1SDSA 1FFXA 5HWEA 4ZOLB 1VQNF 2N48A 1JFFA 5IJ0B 3F0FA 4IHJA 3RYFA 3WGKA 1GO0A 2L26A 3K14A 2VXYA 3SIUA 1DT9A 2JNBA 2Z1TA 3ESJA 3GYQA 4X1YA 1XBIA 5HY1A 3NMUC 1TVKA 3JAKB 1H47A 5C8YB 4X3LA 3JCMM 3HKCB 5EYPA 5KX5A 3MQWA 4BW0B 3OONA 3M84A 4ZI7A 3CYQA 3VI6A 1ODEA 1U40A 1RLGA 5JH7B 3KJJA 1X52A 3CXCF 3C9SA 3ZO8A 2Z1UA 5HY4A 5HY0A 3HJWC 3HAXD 3TD5A 4F6RA 5LOVA 1VQLF 3S02A 3TD4A 3IEWA 2ALEA 3CYPB 5ITZB 3NVKE 1TUBA 1GX1A 2UYKA 4TV8B 2HVYD 3JATA 2HRUA 3N4ZA 3C9RA 3I3FA 1SA0A 3CCUF 4U3JB 4U39A 3WGJA 5EIBD 1XRGA 3ERNA 5HY2A 4BT3A 4YJ2B 5JQGA 2Z1EA 1W5BA 4G4VA 4LCKA 3RYHA 3C9TA 3G4SF 1M1KH 5GONB 3FD6A 1ONIA 1YGYA 3IKEA 1IV2A 3LMEA 1U43A 5CA0B 3CMAF 3IKFA 2FC3A 3CPQA 1NQ3A 3F0DA 4I4TA 5EIBC 1OAPA 3FFMA 4B45A 1YIJF 3VO8A 3JVHA 4O4IB 4E6EA 3F0EA 4BVTA 4ZHQA 4EI9A 5EO3A 4X3MA 3JASB 3ZOPA 1M90H 3LFOA 1VQKF 5G4UC 4BVSA 2IQQA 1KNJA 2ZOVA 3JAWB 1Q8RA 2YYEA 3ZP7A 5J2TA 2LBXA 2KGWA 4C82A 3J80M 3S0WA 3CB2A 2VGMA 4X20B 4ZOLA 5A2QM 5IJ0A 4TUYB 2H6LA 4B62A 3FBAA 3E1YA 3CCEF 2KTVA 5IT9M 1U3LA 3T80A 2CHSA 1JD1A 4NUTA 5HXUA 5MN5A 5IYZB 2I6RA 3CC7F 3JAKA 5C8YA 3HKBB 5LP6B 3N2KB 2CWJA 3NK6A 2HP0B 3CCQF 3LWVC 3S0YA 3V7QA 3JARB 2HP3A 1QD9A 1VQ8F 1T0KB 3ELCA 3RYIB 2RHHA 5JH7A 2HS3A 4WBNB 3CCMF 4O4JB 2UYPA 4G88A 3WPXA 1VQVA 4B46A 1J7HA 5KMGB 5ITZA 4O2AB 4BY9D 3HTNA 1NJIH 4I50B 1JY8A 4TV8A 4TZZA 2V9YA 1W40A 1KNKA 3WXMB 3JAMM 4BT2A 1COMA 1PF5A 4U3JA 1Q81H 1W5EA 5HP8A 3UT5B 2R6R1 3WGMA 4YJ2A 2VAPA 2QTPA 4EI8A 5GANK 4BT6A 5LYJB 1OFUA 3MCAB 1RQ7A 3KHNA 5GONA 5JVDB 2QEXF 4C8EA 1VQ5F 1W42A 5CA0A 1Q7YH 4O4LB 5LA6B 4I55B 1K8AH 1DBFA 4BVQA 3I55F 4EB6B 1IPAA 1FSZA 2ZVYA 2B33A 3GHZA 4O4IA 2I6DA 2UYNB 1VQ4F 2OTMA 1Q82H 1VHAA 2UZHA 4G4YA 3JASA 5CA1B 1PXWA 3LYBA 3JAWA 1X7PA 1NMUB 3MBMA 3LWPC 5LXTB 2F9ZC 1VQ7F 4BT4A 1W55A 5CB4B 1IV3A 4TUYA 2H8CA 1R1MA 1ZWZA 5GIOC 2RHLA 2RHJA 4FFBB 3DC2A 3RYFB 5FNVB 1T0AA 2KG4A 3PLAC 4C4WC 3K12A 2KTUA 5IYZA 5J2UB 5JCOC 2ZF8A 1XHOA 3GTZA 5GIPC 3HKBA 5LP6A 1QAHA 1U3PA 2ZVZA 3D01A 3N2KA 5EYPB 3CC4F 2HS4A 2HP0A 3VTIC 5EB1B 3QHDA 3JARA 3HWUA 2FGYA 3CCJF 4TV9B 3RYIA 1W2BF 3OW2F 3WJQA 4WBNA 4C8GA 2AIFA 2PMPA 4O4JA 4EI7A 3KJKA 5AVMA 5JCOA 3RA6A 5DCVA 4DXDA 5EAZA 3AGKA 5HP7A 5KMGA 4O2AA 3D54A 4I50A 3IMPA 1E7KA 4X1IB 5MN6A 2QI2A 1W3EX 3JALB 4RQOA 5BMVB 1KD1H 2IG8A 3CPWF 2RHOA 4YJ3B 4DRXB 3D00A 4NWOB 2NMUA 2Q1XA 5IJ9B 4O2BB 1CN7A 3HKCA 3BYQA 3ZP4A 2GLZA 2GVIA 5LYJA 1CK2A 4IIJB 1VQ9F 2Z01A 3LWRC 3WPWA 4X1KB 5JVDA 1X25A 1YJWF 1IV1A 1H7MA 2LCAA 1CLIA 4O4LA 4I55A 5EZYB 5HXZA 1YJNF 3QUWA 1YQNA 4EB6A 2OTLF 1W41A 1KQSF 3M4SA 2OZBA 2YXZA 4BT5A 2CZWA 3WGLA 3S06A 3NVIB 3LWQC 3RE3A 2UYNA 2G9IA 1FNJA 3R0PA 3N4YA 4M8IA 3N2GB 4HNAB 3P0ZA 3MCQA 3QTYA 5CA1A 4ERHA 1X7OA 2P6YA 3K0TA 5EB0A 1VH8A 3WJPA 2QA4F 1UFYA 4C8IA 2H8EA 3VYTC 3RYCB 2VAWA 5LXTA 3F6MA 2IAFA 5CB4A 1RQ2A 3C9UA 3LDTA 1SZQA 3HKEB 2BTUA 3L7QA 4FFBA 1VQMF 5FNVA 2R751 3E22B 4O4HB 3U0OA 3O85A 3G6EF 3J81M 1KC8H 1K9MH 3CCLF 4NQ3A 1YHQF 3OBWA 5J2UA 3KIZA 1W57A 4ZHYB 3LWOC 2RB9A 3F0GA 2ZODA 4LNUB 1VQ6F 3J7AR 3CG6A 3RA5A 3VYUC 2CVLA 4G4WA 3VOBA 1FNKA 3HKDB 4TV9A 1Z5VA 1YITF 1JJ2F 1K73H 2CSLA 2VAMA 3CD6F 2OTJF 3ON1A 3S0HA 3FPIA 2UYJA 5LP6C 4X20A 3V3TA 1VQOF 2VGNA 3E20B 3WGNA 1FFXB 3CCRF 2AMTA 4XCQA 3VCZA 3P10A 4C81A 3CCVF 1S72F 1JFFB 4G4ZA 4X1IA 1Q86H 5FJ4C 1YI2F 5BMVA 3DDNA 1RA4A 3JALA 4IHJB 4ZHVA 3SIVA 2BO1A 1GZ0A 4YJ3A 4DRXA 4X1YB 3OBYA 1W5AA 5IJ9A 4O2BA 3MDOA 1TVKB 2BTQB 5MN4A 2CW4A 3B6NA 4ZHWA 5GINC 4IIJA 5KX5B 3Q8HA 3EORA 3M1XA 3NK7A 3VOAA 2BTOA 2EWCA 2DYYA 4X1KA 4ZI7B 4RHAA 3TD3A 1QVGF 5EZYA 1JN1A 2CHTA 5GAPK 3I56F 3PAFA 3S03A 4BVRA 2LBTA 4F6RB 5LOVB 2GZLA 4R40B 2MQEA 2WALA 1TUBB 3CC2F 3IEQA 3KE1A 3N2GA 4HNAA 3JATB 1GO1A 1SA0B 4G4XA 4PWTA 3UT5A 2HRYA 3IR9A 1UI9A 3RYCA 3CMEF 3V7EA 3C8LA 3VIUA 5JQGB 3WJRA 3RYHB 2LBWA 3V4DA 2K1SA 2W8BC 3HKEA 5EWRA 4B5CA 3E22A 4O4HA 3K2XA 1H48A
chains in the Genus database with same CATH topology
3OONA 4G4WA 3CYQA 3LDTA 3KHNA 4G88A 2HQSC 2ZVZA 3WPXA 2N48A 4G4VA 4ZHWA 3S0HA 3S06A 5EB1B 4G4XA 4PWTA 2L26A 3TD5A 1OAPA 2ZVYA 3S02A 3TD4A 2ZOVA 4RHAA 1R1MA 3CYPB 2KGWA 3TD3A 4G4ZA 4ZHYB 4ERHA 3S0YA 5EB0A 3S0WA 2K1SA 2W8BC 2LCAA 4ZHVA 5EAZA 3WPWA 3S03A 2AIZP 2LBTA 4B5CA 4B62A 4R40B 4G4YA 2MQEA 2ZF8A 3IMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OON A;  4G4W A;  3CYQ A;  3LDT A;  3KHN A;  4G88 A;  2HQS C;  2ZVZ A;  3WPX A;  2N48 A;  4G4V A;  4ZHW A;  3S0H A;  3S06 A;  5EB1 B;  4G4X A;  4PWT A;  2L26 A;  3TD5 A;  1OAP A;  2ZVY A;  3S02 A;  3TD4 A;  2ZOV A;  4RHA A;  1R1M A;  3CYP B;  2KGW A;  3TD3 A;  4G4Z A;  4ZHY B;  4ERH A;  3S0Y A;  5EB0 A;  3S0W A;  2K1S A;  2W8B C;  2LCA A;  4ZHV A;  5EAZ A;  3WPW A;  3S03 A;  2AIZ P;  2LBT A;  4B5C A;  4B62 A;  4R40 B;  4G4Y A;  2MQE A;  2ZF8 A;  3IMP A; 
#chains in the Genus database with same CATH topology
 2PHN A;  2HX0 A;  1VQP F;  5LA6 A;  5FLX M;  1IV4 A;  4ZK7 A;  3VYS C;  2HQS C;  1W59 A;  2Q1Y A;  1XV2 A;  1YJ9 F;  4I4T B;  2HS0 A;  1RLU A;  1W58 1;  2ZAU A;  4LNU A;  5G4V C;  5B8F A;  4ZHQ B;  1QU9 A;  2Z1F A;  1W5F A;  3CCS F;  3G71 F;  3I7T A;  3HKD A;  2OHW A;  4BT7 A;  1QVF F;  2DT4 A;  1Z5W A;  2AIZ P;  3P4E A;  5J2T B;  3VMF B;  3FD5 A;  4KWE A;  1N8R H;  1VK3 A;  1SDS A;  1FFX A;  5HWE A;  4ZOL B;  1VQN F;  2N48 A;  1JFF A;  5IJ0 B;  3F0F A;  4IHJ A;  3RYF A;  3WGK A;  1GO0 A;  2L26 A;  3K14 A;  2VXY A;  3SIU A;  1DT9 A;  2JNB A;  2Z1T A;  3ESJ A;  3GYQ A;  4X1Y A;  1XBI A;  5HY1 A;  3NMU C;  1TVK A;  3JAK B;  1H47 A;  5C8Y B;  4X3L A;  3JCM M;  3HKC B;  5EYP A;  5KX5 A;  3MQW A;  4BW0 B;  3OON A;  3M84 A;  4ZI7 A;  3CYQ A;  3VI6 A;  1ODE A;  1U40 A;  1RLG A;  5JH7 B;  3KJJ A;  1X52 A;  3CXC F;  3C9S A;  3ZO8 A;  2Z1U A;  5HY4 A;  5HY0 A;  3HJW C;  3HAX D;  3TD5 A;  4F6R A;  5LOV A;  1VQL F;  3S02 A;  3TD4 A;  3IEW A;  2ALE A;  3CYP B;  5ITZ B;  3NVK E;  1TUB A;  1GX1 A;  2UYK A;  4TV8 B;  2HVY D;  3JAT A;  2HRU A;  3N4Z A;  3C9R A;  3I3F A;  1SA0 A;  3CCU F;  4U3J B;  4U39 A;  3WGJ A;  5EIB D;  1XRG A;  3ERN A;  5HY2 A;  4BT3 A;  4YJ2 B;  5JQG A;  2Z1E A;  1W5B A;  4G4V A;  4LCK A;  3RYH A;  3C9T A;  3G4S F;  1M1K H;  5GON B;  3FD6 A;  1ONI A;  1YGY A;  3IKE A;  1IV2 A;  3LME A;  1U43 A;  5CA0 B;  3CMA F;  3IKF A;  2FC3 A;  3CPQ A;  1NQ3 A;  3F0D A;  4I4T A;  5EIB C;  1OAP A;  3FFM A;  4B45 A;  1YIJ F;  3VO8 A;  3JVH A;  4O4I B;  4E6E A;  3F0E A;  4BVT A;  4ZHQ A;  4EI9 A;  5EO3 A;  4X3M A;  3JAS B;  3ZOP A;  1M90 H;  3LFO A;  1VQK F;  5G4U C;  4BVS A;  2IQQ A;  1KNJ A;  2ZOV A;  3JAW B;  1Q8R A;  2YYE A;  3ZP7 A;  5J2T A;  2LBX A;  2KGW A;  4C82 A;  3J80 M;  3S0W A;  3CB2 A;  2VGM A;  4X20 B;  4ZOL A;  5A2Q M;  5IJ0 A;  4TUY B;  2H6L A;  4B62 A;  3FBA A;  3E1Y A;  3CCE F;  2KTV A;  5IT9 M;  1U3L A;  3T80 A;  2CHS A;  1JD1 A;  4NUT A;  5HXU A;  5MN5 A;  5IYZ B;  2I6R A;  3CC7 F;  3JAK A;  5C8Y A;  3HKB B;  5LP6 B;  3N2K B;  2CWJ A;  3NK6 A;  2HP0 B;  3CCQ F;  3LWV C;  3S0Y A;  3V7Q A;  3JAR B;  2HP3 A;  1QD9 A;  1VQ8 F;  1T0K B;  3ELC A;  3RYI B;  2RHH A;  5JH7 A;  2HS3 A;  4WBN B;  3CCM F;  4O4J B;  2UYP A;  4G88 A;  3WPX A;  1VQV A;  4B46 A;  1J7H A;  5KMG B;  5ITZ A;  4O2A B;  4BY9 D;  3HTN A;  1NJI H;  4I50 B;  1JY8 A;  4TV8 A;  4TZZ A;  2V9Y A;  1W40 A;  1KNK A;  3WXM B;  3JAM M;  4BT2 A;  1COM A;  1PF5 A;  4U3J A;  1Q81 H;  1W5E A;  5HP8 A;  3UT5 B;  2R6R 1;  3WGM A;  4YJ2 A;  2VAP A;  2QTP A;  4EI8 A;  5GAN K;  4BT6 A;  5LYJ B;  1OFU A;  3MCA B;  1RQ7 A;  3KHN A;  5GON A;  5JVD B;  2QEX F;  4C8E A;  1VQ5 F;  1W42 A;  5CA0 A;  1Q7Y H;  4O4L B;  5LA6 B;  4I55 B;  1K8A H;  1DBF A;  4BVQ A;  3I55 F;  4EB6 B;  1IPA A;  1FSZ A;  2ZVY A;  2B33 A;  3GHZ A;  4O4I A;  2I6D A;  2UYN B;  1VQ4 F;  2OTM A;  1Q82 H;  1VHA A;  2UZH A;  4G4Y A;  3JAS A;  5CA1 B;  1PXW A;  3LYB A;  3JAW A;  1X7P A;  1NMU B;  3MBM A;  3LWP C;  5LXT B;  2F9Z C;  1VQ7 F;  4BT4 A;  1W55 A;  5CB4 B;  1IV3 A;  4TUY A;  2H8C A;  1R1M A;  1ZWZ A;  5GIO C;  2RHL A;  2RHJ A;  4FFB B;  3DC2 A;  3RYF B;  5FNV B;  1T0A A;  2KG4 A;  3PLA C;  4C4W C;  3K12 A;  2KTU A;  5IYZ A;  5J2U B;  5JCO C;  2ZF8 A;  1XHO A;  3GTZ A;  5GIP C;  3HKB A;  5LP6 A;  1QAH A;  1U3P A;  2ZVZ A;  3D01 A;  3N2K A;  5EYP B;  3CC4 F;  2HS4 A;  2HP0 A;  3VTI C;  5EB1 B;  3QHD A;  3JAR A;  3HWU A;  2FGY A;  3CCJ F;  4TV9 B;  3RYI A;  1W2B F;  3OW2 F;  3WJQ A;  4WBN A;  4C8G A;  2AIF A;  2PMP A;  4O4J A;  4EI7 A;  3KJK A;  5AVM A;  5JCO A;  3RA6 A;  5DCV A;  4DXD A;  5EAZ A;  3AGK A;  5HP7 A;  5KMG A;  4O2A A;  3D54 A;  4I50 A;  3IMP A;  1E7K A;  4X1I B;  5MN6 A;  2QI2 A;  1W3E X;  3JAL B;  4RQO A;  5BMV B;  1KD1 H;  2IG8 A;  3CPW F;  2RHO A;  4YJ3 B;  4DRX B;  3D00 A;  4NWO B;  2NMU A;  2Q1X A;  5IJ9 B;  4O2B B;  1CN7 A;  3HKC A;  3BYQ A;  3ZP4 A;  2GLZ A;  2GVI A;  5LYJ A;  1CK2 A;  4IIJ B;  1VQ9 F;  2Z01 A;  3LWR C;  3WPW A;  4X1K B;  5JVD A;  1X25 A;  1YJW F;  1IV1 A;  1H7M A;  2LCA A;  1CLI A;  4O4L A;  4I55 A;  5EZY B;  5HXZ A;  1YJN F;  3QUW A;  1YQN A;  4EB6 A;  2OTL F;  1W41 A;  1KQS F;  3M4S A;  2OZB A;  2YXZ A;  4BT5 A;  2CZW A;  3WGL A;  3S06 A;  3NVI B;  3LWQ C;  3RE3 A;  2UYN A;  2G9I A;  1FNJ A;  3R0P A;  3N4Y A;  4M8I A;  3N2G B;  4HNA B;  3P0Z A;  3MCQ A;  3QTY A;  5CA1 A;  4ERH A;  1X7O A;  2P6Y A;  3K0T A;  5EB0 A;  1VH8 A;  3WJP A;  2QA4 F;  1UFY A;  4C8I A;  2H8E A;  3VYT C;  3RYC B;  2VAW A;  5LXT A;  3F6M A;  2IAF A;  5CB4 A;  1RQ2 A;  3C9U A;  3LDT A;  1SZQ A;  3HKE B;  2BTU A;  3L7Q A;  4FFB A;  1VQM F;  5FNV A;  2R75 1;  3E22 B;  4O4H B;  3U0O A;  3O85 A;  3G6E F;  3J81 M;  1KC8 H;  1K9M H;  3CCL F;  4NQ3 A;  1YHQ F;  3OBW A;  5J2U A;  3KIZ A;  1W57 A;  4ZHY B;  3LWO C;  2RB9 A;  3F0G A;  2ZOD A;  4LNU B;  1VQ6 F;  3J7A R;  3CG6 A;  3RA5 A;  3VYU C;  2CVL A;  4G4W A;  3VOB A;  1FNK A;  3HKD B;  4TV9 A;  1Z5V A;  1YIT F;  1JJ2 F;  1K73 H;  2CSL A;  2VAM A;  3CD6 F;  2OTJ F;  3ON1 A;  3S0H A;  3FPI A;  2UYJ A;  5LP6 C;  4X20 A;  3V3T A;  1VQO F;  2VGN A;  3E20 B;  3WGN A;  1FFX B;  3CCR F;  2AMT A;  4XCQ A;  3VCZ A;  3P10 A;  4C81 A;  3CCV F;  1S72 F;  1JFF B;  4G4Z A;  4X1I A;  1Q86 H;  5FJ4 C;  1YI2 F;  5BMV A;  3DDN A;  1RA4 A;  3JAL A;  4IHJ B;  4ZHV A;  3SIV A;  2BO1 A;  1GZ0 A;  4YJ3 A;  4DRX A;  4X1Y B;  3OBY A;  1W5A A;  5IJ9 A;  4O2B A;  3MDO A;  1TVK B;  2BTQ B;  5MN4 A;  2CW4 A;  3B6N A;  4ZHW A;  5GIN C;  4IIJ A;  5KX5 B;  3Q8H A;  3EOR A;  3M1X A;  3NK7 A;  3VOA A;  2BTO A;  2EWC A;  2DYY A;  4X1K A;  4ZI7 B;  4RHA A;  3TD3 A;  1QVG F;  5EZY A;  1JN1 A;  2CHT A;  5GAP K;  3I56 F;  3PAF A;  3S03 A;  4BVR A;  2LBT A;  4F6R B;  5LOV B;  2GZL A;  4R40 B;  2MQE A;  2WAL A;  1TUB B;  3CC2 F;  3IEQ A;  3KE1 A;  3N2G A;  4HNA A;  3JAT B;  1GO1 A;  1SA0 B;  4G4X A;  4PWT A;  3UT5 A;  2HRY A;  3IR9 A;  1UI9 A;  3RYC A;  3CME F;  3V7E A;  3C8L A;  3VIU A;  5JQG B;  3WJR A;  3RYH B;  2LBW A;  3V4D A;  2K1S A;  2W8B C;  3HKE A;  5EWR A;  4B5C A;  3E22 A;  4O4H A;  3K2X A;  1H48 A; 
#chains in the Genus database with same CATH homology
 3OON A;  4G4W A;  3CYQ A;  3LDT A;  3KHN A;  4G88 A;  2HQS C;  2ZVZ A;  3WPX A;  2N48 A;  4G4V A;  4ZHW A;  3S0H A;  3S06 A;  5EB1 B;  4G4X A;  4PWT A;  2L26 A;  3TD5 A;  1OAP A;  2ZVY A;  3S02 A;  3TD4 A;  2ZOV A;  4RHA A;  1R1M A;  3CYP B;  2KGW A;  3TD3 A;  4G4Z A;  4ZHY B;  4ERH A;  3S0Y A;  5EB0 A;  3S0W A;  2K1S A;  2W8B C;  2LCA A;  4ZHV A;  5EAZ A;  3WPW A;  3S03 A;  2AIZ P;  2LBT A;  4B5C A;  4B62 A;  4R40 B;  4G4Y A;  2MQE A;  2ZF8 A;  3IMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...