4G4YA

Crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords Outer membrane protein Omp38
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4yA00
1R1MA 3LDTA 4PWTA 3CYQA 5EB0A 2LCAA 2L26A 3WPWA 4G4XA 4B62A 2ZVZA 4ZHYB 2N48A 2ZF8A 3WPXA 2ZVYA 3S02A 4ZHVA 2W8BC 1OAPA 3TD5A 2LBTA 4G4YA 3S03A 4RHAA 3OONA 4ZHWA 2K1SA 2KGWA 3IMPA 5EAZA 4G4WA 4R40B 3S06A 3S0WA 2MQEA 2HQSC 3TD3A 3S0YA 2AIZP 4G88A 3CYPB 3KHNA 4G4ZA 4ERHA 5EB1B 2ZOVA 4G4VA 3TD4A 3S0HA 4B5CA
chains in the Genus database with same CATH superfamily
4EI9A 3NK6A 1QAHA 3VOBA 5GINC 2HP0A 2LCAA 3N2GA 3WJQA 2HP0B 2HRYA 3N2GB 1JFFA 4C8EA 1VQPF 5G4VC 3WPXA 4U3JA 1E7KA 1IPAA 3GHZA 3I3FA 1OAPA 3FD5A 3N4YA 3HJWC 3WGJA 4G4WA 2JNBA 3WGLA 3KJKA 1W41A 1FFXB 3JALA 3U0OA 1QU9A 4LCKA 3RYFA 1W42A 2IAFA 3CCJF 1H48A 1CK2A 1VQKF 3RYFB 3V4DA 4LNUA 3P4EA 4LNUB 4ZHQA 4BVQA 3ZP7A 5CB4A 1M1KH 2UZHA 1XBIA 2KTVA 2RHHA 4I55B 5CB4B 2ZF8A 4C4WC 3CMAF 2VGMA 2QTPA 2FGYA 2KGWA 5HWEA 2HQSC 2CW4A 3MCAB 2Q1XA 2AIZP 3LWQC 3C8LA 4ERHA 4TUYA 3ZO8A 4TUYB 3HKBA 3LWRC 3HKDA 2QEXF 3HKBB 3JVHA 3CG6A 3HKDB 5J2UA 3OW2F 1XRGA 5B8FA 3V7QA 2P6YA 3D01A 5BMVB 2Q1YA 4B45A 3OONA 2Z1UA 3IMPA 4NWOB 3WXMB 1QD9A 3LFOA 1GX1A 1JY8A 3IEWA 4RQOA 3E20B 4DRXB 4O2BB 2PMPA 3TD4A 4HNAA 5J2TA 4O4LB 4BT4A 2OTMA 5J2TB 1ODEA 3JAMM 3F0FA 3KJJA 3CD6F 3JASB 4G4XA 3WPWA 5HY1A 5KMGA 1VQ5F 4IIJA 4B62A 3T80A 2FC3A 2ZVZA 4IIJB 1K9MH 2ZVYA 3L7QA 4BT2A 3M1XA 3VTIC 1J7HA 5EWRA 3Q8HA 4YJ2A 1CN7A 3K2XA 4O2AA 3CC4F 3CYPB 5GONA 3RE3A 4O2AB 5CA0A 3JATA 4BW0B 5GONB 3BYQA 2ALEA 4G4VA 4E6EA 2OZBA 3IKFA 3RA6A 1VQ8F 1IV2A 4B5CA 1IV4A 2Z1TA 2CZWA 4BY9D 1W3EX 5FNVB 1K73H 2KG4A 3FFMA 3HWUA 1Q7YH 3QTYA 1VK3A 2AIFA 3ERNA 3I55F 5AVMA 5HY0A 5KX5A 1KNKA 5EYPA 5LXTA 5KX5B 3C9TA 3NVKE 5LA6A 5JVDA 1U43A 2H8EA 4X1IA 2IQQA 4X1YA 5JVDB 1KD1H 4X1IB 4X1YB 3E1YA 2LBXA 4WBNB 3CCSF 4TV9A 3K12A 3MBMA 2AMTA 1W57A 3ZP4A 1SZQA 3VYUC 4X3MA 5IYZA 2BTOA 3G6EF 1RLGA 1YJWF 2IG8A 3GYQA 4O4JB 3VI6A 1X25A 3FD6A 4X20B 5EYPB 1VQNF 1ZWZA 1SA0A 4C8IA 5FLXM 3C9RA 1SA0B 3QHDA 4C82A 1YQNA 5GAPK 4C8GA 2VAWA 3JCMM 3MQWA 3G71F 1RQ7A 1VQ6F 1JFFB 2R6R1 1IV3A 4BT6A 4U3JB 1JD1A 1Q81H 2CVLA 1YITF 1W40A 4M8IA 1T0AA 2KTUA 1X7PA 3VOAA 3CC2F 1DT9A 3KE1A 2CHTA 3G4SF 4C81A 3JALB 3M4SA 1Q8RA 3QUWA 1R1MA 3P0ZA 3I56F 2OHWA 5MN4A 3F0GA 3HTNA 2H8CA 2F9ZC 1UFYA 3ESJA 3HKEA 4BT3A 4XCQA 4ZHYB 3HKCA 4ZHQB 3RYHA 2Z1FA 3RYHB 2DT4A 1YJ9F 5EO3A 5EAZA 3CCVF 1RA4A 1CLIA 1KQSF 3E22A 4G88A 4TZZA 4O4HA 1COMA 2R751 1XHOA 3SIUA 3UT5A 1YIJF 1VH8A 3VYTC 3LDTA 2DYYA 5J2UB 3IR9A 4BVSA 2OTLF 4TV8A 5G4UC 4TV8B 2VXYA 3CPWF 5LP6A 4G4YA 2B33A 2YXZA 3VMFB 1Z5VA 3WJPA 5HXZA 3S0YA 4HNAB 2UYJA 4PWTA 4ZI7A 3CXCF 4ZI7B 1VHAA 5KMGB 2UYKA 1TVKA 1W55A 1QVGF 1TVKB 4IHJA 1VQ7F 1W5FA 3K14A 2I6RA 3S06A 1JN1A 2I6DA 1Z5WA 3WGNA 4BVRA 4YJ2B 3K0TA 4DXDA 2UYPA 3KHNA 5FJ4C 5LOVA 5CA0B 3JATB 4X3LA 3J80M 3IKEA 4BT7A 5CA1A 1FNJA 5EB0A 5HP7A 2ZAUA 3RA5A 3CMEF 3I7TA 3JAKA 1X7OA 3LWOC 3DDNA 3JAKB 3CCMF 5JCOA 2W8BC 1YHQF 4ZHWA 5LXTB 1NJIH 3RYIA 5LA6B 1GO1A 1ONIA 3RYIB 1Q86H 5IJ0A 3CCEF 5JH7A 3WGMA 5JH7B 4TV9B 4F6RA 1H7MA 1YI2F 4ZOLA 4ZOLB 5IYZB 1RLUA 5JCOC 3F0DA 1FSZA 5EIBC 1VQ4F 2BO1A 3VCZA 2UYNA 2RB9A 2VAMA 3CYQA 2UYNB 1XV2A 5EIBD 3B6NA 5MN6A 5C8YA 2HRUA 2V9YA 3FPIA 3LYBA 3CCLF 3JARA 2LBTA 2CHSA 1DBFA 3C9SA 5LYJA 5LYJB 1RQ2A 1H47A 5JQGA 3PLAC 2BTUA 5JQGB 4I4TA 5DCVA 3CCRF 3V7EA 3OBWA 1U3PA 3CPQA 4EB6A 2RHOA 1VQLF 4EB6B 1W5BA 3MCQA 1OFUA 2GVIA 3HKEB 4BVTA 5GIOC 1IV1A 1UI9A 3CB2A 3TD5A 2HS4A 3ELCA 3HKCB 1QVFF 3VO8A 3N2KA 3NVIB 4B46A 1FFXA 3N2KB 3S0WA 4R40B 3WJRA 1KNJA 3JAWA 3PAFA 3N4ZA 3JAWB 3IEQA 3P10A 4G4ZA 2Z1EA 3E22B 1T0KB 1X52A 4O4HB 1YJNF 3S0HA 1W2BF 3C9UA 3FBAA 2ZODA 1S72F 3UT5B 4O4IA 3O85A 3DC2A 4I55A 4O4IB 1W581 1PXWA 2EWCA 3AGKA 1VQOF 1VQVA 5MN5A 3F0EA 4ZHVA 3S02A 2HVYD 3S03A 3GTZA 2GLZA 3RYCA 5LP6B 2HP3A 1PF5A 3TD3A 3RYCB 2WALA 4EI7A 3HAXD 3V3TA 5HXUA 1W59A 4BT5A 5IT9M 1VQ9F 2RHJA 1U3LA 5GANK 5LP6C 3ZOPA 4NQ3A 1JJ2F 4I50A 1GZ0A 3KIZA 4I50B 5BMVA 2VGNA 3SIVA 2LBWA 1W5AA 5ITZA 3WGKA 1FNKA 5ITZB 2G9IA 4IHJB 1N8RH 1SDSA 3MDOA 2MQEA 3NK7A 5A2QM 5GIPC 4DRXA 3NMUC 4O2BA 2PHNA 4ZK7A 2HS3A 3EORA 4O4LA 1K8AH 1Q82H 2QI2A 3ON1A 5LOVB 4U39A 2OTJF 3VYSC 3J7AR 2Z01A 3JASA 3J81M 3CC7F 4KWEA 2NMUA 5CA1B 4FFBA 1M90H 4FFBB 4YJ3A 2N48A 3D00A 4YJ3B 2BTQB 5HY2A 4RHAA 2K1SA 3M84A 3CCUF 1KC8H 2H6LA 5IJ0B 5EB1B 2ZOVA 1W5EA 3OBYA 4EI8A 2RHLA 4F6RB 5FNVA 2HS0A 3LMEA 2QA4F 3CCQF 3F6MA 1VQMF 2L26A 3D54A 3VIUA 2CSLA 3LWVC 1NQ3A 4NUTA 1U40A 5C8YB 2HX0A 5IJ9A 2VAPA 5HP8A 3JARB 4WBNA 5IJ9B 3LWPC 3R0PA 5EZYA 2CWJA 4X1KA 1YGYA 5HY4A 1NMUB 5EZYB 1TUBA 4X1KB 1GO0A 2YYEA 1TUBB 2GZLA 4I4TB 4O4JA 4X20A
chains in the Genus database with same CATH topology
1R1MA 3LDTA 4PWTA 3CYQA 5EB0A 2LCAA 2L26A 3WPWA 4G4XA 4B62A 2ZVZA 4ZHYB 2N48A 2ZF8A 3WPXA 2ZVYA 3S02A 4ZHVA 2W8BC 1OAPA 3TD5A 2LBTA 4G4YA 3S03A 4RHAA 3OONA 4ZHWA 2K1SA 2KGWA 3IMPA 5EAZA 4G4WA 4R40B 3S06A 3S0WA 2MQEA 2HQSC 3TD3A 3S0YA 2AIZP 4G88A 3CYPB 3KHNA 4G4ZA 4ERHA 5EB1B 2ZOVA 4G4VA 3TD4A 3S0HA 4B5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1M A;  3LDT A;  4PWT A;  3CYQ A;  5EB0 A;  2LCA A;  2L26 A;  3WPW A;  4G4X A;  4B62 A;  2ZVZ A;  4ZHY B;  2N48 A;  2ZF8 A;  3WPX A;  2ZVY A;  3S02 A;  4ZHV A;  2W8B C;  1OAP A;  3TD5 A;  2LBT A;  4G4Y A;  3S03 A;  4RHA A;  3OON A;  4ZHW A;  2K1S A;  2KGW A;  3IMP A;  5EAZ A;  4G4W A;  4R40 B;  3S06 A;  3S0W A;  2MQE A;  2HQS C;  3TD3 A;  3S0Y A;  2AIZ P;  4G88 A;  3CYP B;  3KHN A;  4G4Z A;  4ERH A;  5EB1 B;  2ZOV A;  4G4V A;  3TD4 A;  3S0H A;  4B5C A; 
#chains in the Genus database with same CATH topology
 4EI9 A;  3NK6 A;  1QAH A;  3VOB A;  5GIN C;  2HP0 A;  2LCA A;  3N2G A;  3WJQ A;  2HP0 B;  2HRY A;  3N2G B;  1JFF A;  4C8E A;  1VQP F;  5G4V C;  3WPX A;  4U3J A;  1E7K A;  1IPA A;  3GHZ A;  3I3F A;  1OAP A;  3FD5 A;  3N4Y A;  3HJW C;  3WGJ A;  4G4W A;  2JNB A;  3WGL A;  3KJK A;  1W41 A;  1FFX B;  3JAL A;  3U0O A;  1QU9 A;  4LCK A;  3RYF A;  1W42 A;  2IAF A;  3CCJ F;  1H48 A;  1CK2 A;  1VQK F;  3RYF B;  3V4D A;  4LNU A;  3P4E A;  4LNU B;  4ZHQ A;  4BVQ A;  3ZP7 A;  5CB4 A;  1M1K H;  2UZH A;  1XBI A;  2KTV A;  2RHH A;  4I55 B;  5CB4 B;  2ZF8 A;  4C4W C;  3CMA F;  2VGM A;  2QTP A;  2FGY A;  2KGW A;  5HWE A;  2HQS C;  2CW4 A;  3MCA B;  2Q1X A;  2AIZ P;  3LWQ C;  3C8L A;  4ERH A;  4TUY A;  3ZO8 A;  4TUY B;  3HKB A;  3LWR C;  3HKD A;  2QEX F;  3HKB B;  3JVH A;  3CG6 A;  3HKD B;  5J2U A;  3OW2 F;  1XRG A;  5B8F A;  3V7Q A;  2P6Y A;  3D01 A;  5BMV B;  2Q1Y A;  4B45 A;  3OON A;  2Z1U A;  3IMP A;  4NWO B;  3WXM B;  1QD9 A;  3LFO A;  1GX1 A;  1JY8 A;  3IEW A;  4RQO A;  3E20 B;  4DRX B;  4O2B B;  2PMP A;  3TD4 A;  4HNA A;  5J2T A;  4O4L B;  4BT4 A;  2OTM A;  5J2T B;  1ODE A;  3JAM M;  3F0F A;  3KJJ A;  3CD6 F;  3JAS B;  4G4X A;  3WPW A;  5HY1 A;  5KMG A;  1VQ5 F;  4IIJ A;  4B62 A;  3T80 A;  2FC3 A;  2ZVZ A;  4IIJ B;  1K9M H;  2ZVY A;  3L7Q A;  4BT2 A;  3M1X A;  3VTI C;  1J7H A;  5EWR A;  3Q8H A;  4YJ2 A;  1CN7 A;  3K2X A;  4O2A A;  3CC4 F;  3CYP B;  5GON A;  3RE3 A;  4O2A B;  5CA0 A;  3JAT A;  4BW0 B;  5GON B;  3BYQ A;  2ALE A;  4G4V A;  4E6E A;  2OZB A;  3IKF A;  3RA6 A;  1VQ8 F;  1IV2 A;  4B5C A;  1IV4 A;  2Z1T A;  2CZW A;  4BY9 D;  1W3E X;  5FNV B;  1K73 H;  2KG4 A;  3FFM A;  3HWU A;  1Q7Y H;  3QTY A;  1VK3 A;  2AIF A;  3ERN A;  3I55 F;  5AVM A;  5HY0 A;  5KX5 A;  1KNK A;  5EYP A;  5LXT A;  5KX5 B;  3C9T A;  3NVK E;  5LA6 A;  5JVD A;  1U43 A;  2H8E A;  4X1I A;  2IQQ A;  4X1Y A;  5JVD B;  1KD1 H;  4X1I B;  4X1Y B;  3E1Y A;  2LBX A;  4WBN B;  3CCS F;  4TV9 A;  3K12 A;  3MBM A;  2AMT A;  1W57 A;  3ZP4 A;  1SZQ A;  3VYU C;  4X3M A;  5IYZ A;  2BTO A;  3G6E F;  1RLG A;  1YJW F;  2IG8 A;  3GYQ A;  4O4J B;  3VI6 A;  1X25 A;  3FD6 A;  4X20 B;  5EYP B;  1VQN F;  1ZWZ A;  1SA0 A;  4C8I A;  5FLX M;  3C9R A;  1SA0 B;  3QHD A;  4C82 A;  1YQN A;  5GAP K;  4C8G A;  2VAW A;  3JCM M;  3MQW A;  3G71 F;  1RQ7 A;  1VQ6 F;  1JFF B;  2R6R 1;  1IV3 A;  4BT6 A;  4U3J B;  1JD1 A;  1Q81 H;  2CVL A;  1YIT F;  1W40 A;  4M8I A;  1T0A A;  2KTU A;  1X7P A;  3VOA A;  3CC2 F;  1DT9 A;  3KE1 A;  2CHT A;  3G4S F;  4C81 A;  3JAL B;  3M4S A;  1Q8R A;  3QUW A;  1R1M A;  3P0Z A;  3I56 F;  2OHW A;  5MN4 A;  3F0G A;  3HTN A;  2H8C A;  2F9Z C;  1UFY A;  3ESJ A;  3HKE A;  4BT3 A;  4XCQ A;  4ZHY B;  3HKC A;  4ZHQ B;  3RYH A;  2Z1F A;  3RYH B;  2DT4 A;  1YJ9 F;  5EO3 A;  5EAZ A;  3CCV F;  1RA4 A;  1CLI A;  1KQS F;  3E22 A;  4G88 A;  4TZZ A;  4O4H A;  1COM A;  2R75 1;  1XHO A;  3SIU A;  3UT5 A;  1YIJ F;  1VH8 A;  3VYT C;  3LDT A;  2DYY A;  5J2U B;  3IR9 A;  4BVS A;  2OTL F;  4TV8 A;  5G4U C;  4TV8 B;  2VXY A;  3CPW F;  5LP6 A;  4G4Y A;  2B33 A;  2YXZ A;  3VMF B;  1Z5V A;  3WJP A;  5HXZ A;  3S0Y A;  4HNA B;  2UYJ A;  4PWT A;  4ZI7 A;  3CXC F;  4ZI7 B;  1VHA A;  5KMG B;  2UYK A;  1TVK A;  1W55 A;  1QVG F;  1TVK B;  4IHJ A;  1VQ7 F;  1W5F A;  3K14 A;  2I6R A;  3S06 A;  1JN1 A;  2I6D A;  1Z5W A;  3WGN A;  4BVR A;  4YJ2 B;  3K0T A;  4DXD A;  2UYP A;  3KHN A;  5FJ4 C;  5LOV A;  5CA0 B;  3JAT B;  4X3L A;  3J80 M;  3IKE A;  4BT7 A;  5CA1 A;  1FNJ A;  5EB0 A;  5HP7 A;  2ZAU A;  3RA5 A;  3CME F;  3I7T A;  3JAK A;  1X7O A;  3LWO C;  3DDN A;  3JAK B;  3CCM F;  5JCO A;  2W8B C;  1YHQ F;  4ZHW A;  5LXT B;  1NJI H;  3RYI A;  5LA6 B;  1GO1 A;  1ONI A;  3RYI B;  1Q86 H;  5IJ0 A;  3CCE F;  5JH7 A;  3WGM A;  5JH7 B;  4TV9 B;  4F6R A;  1H7M A;  1YI2 F;  4ZOL A;  4ZOL B;  5IYZ B;  1RLU A;  5JCO C;  3F0D A;  1FSZ A;  5EIB C;  1VQ4 F;  2BO1 A;  3VCZ A;  2UYN A;  2RB9 A;  2VAM A;  3CYQ A;  2UYN B;  1XV2 A;  5EIB D;  3B6N A;  5MN6 A;  5C8Y A;  2HRU A;  2V9Y A;  3FPI A;  3LYB A;  3CCL F;  3JAR A;  2LBT A;  2CHS A;  1DBF A;  3C9S A;  5LYJ A;  5LYJ B;  1RQ2 A;  1H47 A;  5JQG A;  3PLA C;  2BTU A;  5JQG B;  4I4T A;  5DCV A;  3CCR F;  3V7E A;  3OBW A;  1U3P A;  3CPQ A;  4EB6 A;  2RHO A;  1VQL F;  4EB6 B;  1W5B A;  3MCQ A;  1OFU A;  2GVI A;  3HKE B;  4BVT A;  5GIO C;  1IV1 A;  1UI9 A;  3CB2 A;  3TD5 A;  2HS4 A;  3ELC A;  3HKC B;  1QVF F;  3VO8 A;  3N2K A;  3NVI B;  4B46 A;  1FFX A;  3N2K B;  3S0W A;  4R40 B;  3WJR A;  1KNJ A;  3JAW A;  3PAF A;  3N4Z A;  3JAW B;  3IEQ A;  3P10 A;  4G4Z A;  2Z1E A;  3E22 B;  1T0K B;  1X52 A;  4O4H B;  1YJN F;  3S0H A;  1W2B F;  3C9U A;  3FBA A;  2ZOD A;  1S72 F;  3UT5 B;  4O4I A;  3O85 A;  3DC2 A;  4I55 A;  4O4I B;  1W58 1;  1PXW A;  2EWC A;  3AGK A;  1VQO F;  1VQV A;  5MN5 A;  3F0E A;  4ZHV A;  3S02 A;  2HVY D;  3S03 A;  3GTZ A;  2GLZ A;  3RYC A;  5LP6 B;  2HP3 A;  1PF5 A;  3TD3 A;  3RYC B;  2WAL A;  4EI7 A;  3HAX D;  3V3T A;  5HXU A;  1W59 A;  4BT5 A;  5IT9 M;  1VQ9 F;  2RHJ A;  1U3L A;  5GAN K;  5LP6 C;  3ZOP A;  4NQ3 A;  1JJ2 F;  4I50 A;  1GZ0 A;  3KIZ A;  4I50 B;  5BMV A;  2VGN A;  3SIV A;  2LBW A;  1W5A A;  5ITZ A;  3WGK A;  1FNK A;  5ITZ B;  2G9I A;  4IHJ B;  1N8R H;  1SDS A;  3MDO A;  2MQE A;  3NK7 A;  5A2Q M;  5GIP C;  4DRX A;  3NMU C;  4O2B A;  2PHN A;  4ZK7 A;  2HS3 A;  3EOR A;  4O4L A;  1K8A H;  1Q82 H;  2QI2 A;  3ON1 A;  5LOV B;  4U39 A;  2OTJ F;  3VYS C;  3J7A R;  2Z01 A;  3JAS A;  3J81 M;  3CC7 F;  4KWE A;  2NMU A;  5CA1 B;  4FFB A;  1M90 H;  4FFB B;  4YJ3 A;  2N48 A;  3D00 A;  4YJ3 B;  2BTQ B;  5HY2 A;  4RHA A;  2K1S A;  3M84 A;  3CCU F;  1KC8 H;  2H6L A;  5IJ0 B;  5EB1 B;  2ZOV A;  1W5E A;  3OBY A;  4EI8 A;  2RHL A;  4F6R B;  5FNV A;  2HS0 A;  3LME A;  2QA4 F;  3CCQ F;  3F6M A;  1VQM F;  2L26 A;  3D54 A;  3VIU A;  2CSL A;  3LWV C;  1NQ3 A;  4NUT A;  1U40 A;  5C8Y B;  2HX0 A;  5IJ9 A;  2VAP A;  5HP8 A;  3JAR B;  4WBN A;  5IJ9 B;  3LWP C;  3R0P A;  5EZY A;  2CWJ A;  4X1K A;  1YGY A;  5HY4 A;  1NMU B;  5EZY B;  1TUB A;  4X1K B;  1GO0 A;  2YYE A;  1TUB B;  2GZL A;  4I4T B;  4O4J A;  4X20 A; 
#chains in the Genus database with same CATH homology
 1R1M A;  3LDT A;  4PWT A;  3CYQ A;  5EB0 A;  2LCA A;  2L26 A;  3WPW A;  4G4X A;  4B62 A;  2ZVZ A;  4ZHY B;  2N48 A;  2ZF8 A;  3WPX A;  2ZVY A;  3S02 A;  4ZHV A;  2W8B C;  1OAP A;  3TD5 A;  2LBT A;  4G4Y A;  3S03 A;  4RHA A;  3OON A;  4ZHW A;  2K1S A;  2KGW A;  3IMP A;  5EAZ A;  4G4W A;  4R40 B;  3S06 A;  3S0W A;  2MQE A;  2HQS C;  3TD3 A;  3S0Y A;  2AIZ P;  4G88 A;  3CYP B;  3KHN A;  4G4Z A;  4ERH A;  5EB1 B;  2ZOV A;  4G4V A;  3TD4 A;  3S0H A;  4B5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...