4G4YA

Crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
molecule keywords Outer membrane protein Omp38
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4yA00
4ZHYB 3CYQA 5EAZA 4G4WA 2N48A 2MQEA 2W8BC 4G4YA 3S02A 3TD3A 4B62A 2AIZP 3WPXA 3S0WA 2HQSC 2KGWA 3S0HA 3TD5A 4ERHA 3S06A 2ZF8A 3S03A 2LBTA 1OAPA 2L26A 4PWTA 3LDTA 2ZOVA 3CYPB 2K1SA 2ZVYA 3KHNA 1R1MA 2LCAA 4G4VA 3IMPA 4G4XA 3OONA 5EB0A 4G4ZA 3TD4A 4G88A 4B5CA 4ZHWA 3S0YA 5EB1B 3WPWA 4ZHVA 2ZVZA 4RHAA 4R40B
chains in the Genus database with same CATH superfamily
3WXMB 3OBWA 4C82A 1W5EA 1K73H 3E20B 4O4HB 5GIPC 3FD6A 1DT9A 4I55A 4ERHA 3UT5B 5J2TB 3SIVA 3S0WA 3KJJA 3LDTA 4DRXA 4C8IA 3HKEA 4M8IA 5LYJA 1KC8H 4EI9A 3JARB 4BT3A 2OHWA 4BT4A 5LXTA 1VQKF 2UYNA 4TV8B 5CB4B 4IIJA 4X3MA 4HNAB 2HRUA 3HTNA 3F6MA 4R40B 4BVQA 4ZHYB 1UI9A 3CCVF 2DYYA 1VHAA 3TD3A 1SDSA 3CB2A 4HNAA 3JAKB 4X1YA 2CZWA 3S06A 4NQ3A 3CMEF 3S03A 5C8YB 4X20B 3U0OA 5FNVA 3CC7F 3FFMA 3CPQA 4E6EA 4EB6B 3D01A 5IYZA 3MCAB 3T80A 1U3LA 3FPIA 5EB1B 3CCUF 2HS4A 5JCOA 2GVIA 4X1YB 1SZQA 2FGYA 3RYHB 2OTJF 1W42A 4KWEA 5CA0A 1CLIA 3HWUA 3O85A 4B62A 1VQPF 4B45A 3K14A 4ZOLA 5MN6A 2OTMA 4ZOLB 2L26A 2NMUA 2K1SA 3JATA 2VAMA 3CG6A 3JARA 2KG4A 2Z1EA 5ITZA 2EWCA 4IHJB 3LWQC 3IMPA 4O4JA 3RYFA 3J80M 1VQ7F 3HKEB 2Z1FA 2LBXA 3OW2F 4ZHWA 3LWVC 5IJ0A 1W57A 5J2TA 5EYPA 3DC2A 5HXZA 5A2QM 4I55B 1Q86H 2VGMA 2PMPA 2VXYA 2ALEA 3N4YA 3G6EF 5LOVB 5FNVB 2R6R1 2HS3A 3ELCA 1ODEA 4ZHQB 3K0TA 1CN7A 4WBNA 1IV3A 2Z01A 1PXWA 5BMVB 1W2BF 1YITF 2HP0A 1RA4A 4TUYB 2CW4A 5LP6C 2OTLF 1JD1A 1T0AA 4YJ2B 4ZI7A 3IR9A 3HJWC 5FJ4C 5EYPB 4U39A 1TVKA 3CC2F 5IJ0B 5EAZA 5CA1A 2R751 2P6YA 1RLGA 4XCQA 1CK2A 2YXZA 1VQ4F 1COMA 2BTQB 2UYJA 3JATB 3N2KB 3R0PA 5J2UB 3PLAC 1FNKA 1H48A 3CCEF 4U3JA 3F0FA 1W5AA 3ON1A 4G4ZA 1ONIA 2HP0B 2IQQA 3IKEA 4G88A 2Z1UA 3NVIB 3KE1A 3RYHA 1KD1H 4BY9D 1KQSF 1OFUA 5GINC 4BVSA 1GZ0A 3D54A 2HP3A 3CMAF 4I50A 5IYZB 3JASA 5LOVA 1J7HA 3WJQA 1T0KB 5HY4A 1OAPA 3KHNA 2LCAA 3ZP4A 5JH7B 3M4SA 2H6LA 3WGKA 3RYIB 2KTVA 5HY2A 3MDOA 5KMGB 5ITZB 1VK3A 2AMTA 3S0YA 3F0EA 1YI2F 4LNUA 1M90H 5LP6A 3B6NA 1W40A 3S02A 3P4EA 5GANK 1N8RH 1XHOA 1NMUB 3MCQA 2AIZP 5LYJB 1TUBA 2BO1A 3WJPA 5IJ9B 1Q81H 4O2BA 3KIZA 3CCJF 4DRXB 3JALB 3V7QA 3VTIC 3GHZA 3QTYA 2VAWA 1YGYA 3C9UA 4X3LA 3UT5A 1ZWZA 4EB6A 2HX0A 5JQGB 2ZAUA 2ZODA 2LBWA 2DT4A 1VQOF 1W5BA 4X1IB 4BVTA 3WPWA 5EZYA 3JAWB 4ZHVA 2ZVZA 4RQOA 3C9SA 5GONA 1Q8RA 2QTPA 3CYQA 1IV2A 1JFFA 4G4WA 5LP6B 3SIUA 2RHLA 3BYQA 3RYCA 3CCQF 2CHSA 2HRYA 3S0HA 3ZP7A 1JJ2F 3IEQA 4BT5A 1Z5WA 1E7KA 4F6RA 1VQVA 1YJWF 1IV1A 1SA0A 5EZYB 1FSZA 2CSLA 3N2GB 4I4TA 3MBMA 4B46A 3P0ZA 1FFXB 1XBIA 2MQEA 3VOBA 3CPWF 1X7PA 3M1XA 4YJ3A 3I56F 3OBYA 3E22A 2I6RA 5HXUA 5EIBC 3JCMM 3RE3A 1S72F 1GX1A 4ZK7A 2JNBA 3J7AR 3RA6A 4PWTA 3CYPB 4FFBA 3FBAA 2V9YA 1YHQF 1U40A 1VQ8F 3IKFA 4TV9A 2UYPA 4O4IB 5GAPK 3P10A 1XRGA 5HWEA 4O4LB 3GTZA 4DXDA 3HKDA 4RHAA 3HKBB 2N48A 1QVGF 2YYEA 3CCSF 4O2AB 1KNKA 4X1KA 3V3TA 3WPXA 3TD5A 3L7QA 1Q7YH 4I50B 5HP8A 4TV9B 2PHNA 4WBNB 1JFFB 1JY8A 3D00A 3VYTC 3I3FA 2RHJA 5LA6B 3JAWA 3LYBA 3CC4F 1KNJA 1IV4A 3WGMA 4X1IA 3QUWA 3E22B 3E1YA 5IT9M 2QEXF 2HS0A 4NWOB 2G9IA 3FD5A 1JN1A 5EWRA 3M84A 1K9MH 3IEWA 5EIBD 4O4LA 3N2GA 1VH8A 3CD6F 3MQWA 3WGLA 2ZOVA 3K12A 1R1MA 3HKCB 3HAXD 1X25A 1TVKB 4BVRA 1U43A 3G4SF 4F6RB 3C9TA 5EB0A 3VOAA 3LWOC 3V4DA 4C8GA 3TD4A 2Q1YA 3G71F 4B5CA 4ZI7B 5G4VC 1QD9A 1RLUA 2B33A 3ERNA 5KMGA 5LA6A 1W59A 3JAMM 5EO3A 5BMVA 5HY0A 4G4YA 3J81M 3VMFB 4BW0B 1FFXA 1W5FA 2CVLA 2FC3A 1VQ6F 4I4TB 2OZBA 4EI8A 3NK6A 3F0GA 5JQGA 4O2AA 3JASB 3NK7A 1VQ9F 4NUTA 5C8YA 4G4XA 2QA4F 1VQLF 4EI7A 3QHDA 1UFYA 1YIJF 3RYFB 3I7TA 3LFOA 2GZLA 3RYCB 1XV2A 1QAHA 1IPAA 2W8BC 3K2XA 3LMEA 3LWRC 3AGKA 5AVMA 3N2KA 3CCRF 2HQSC 1GO1A 5LXTB 3CXCF 3HKCA 5G4UC 1VQNF 4BT2A 4G4VA 3RYIA 2KTUA 3PAFA 2QI2A 5MN4A 3NVKE 2Q1XA 3JVHA 2CHTA 1W581 3OONA 1NJIH 5HP7A 3V7EA 5FLXM 1QVFF 2CWJA 1Q82H 3JALA 2H8CA 4O4HA 5JCOC 3WGJA 2RHOA 3VIUA 5B8FA 1SA0B 4X20A 3ESJA 3ZO8A 1RQ7A 2UZHA 3Q8HA 3F0DA 3WJRA 1U3PA 2ZF8A 2LBTA 1Z5VA 3N4ZA 5MN5A 1VQMF 2AIFA 3CCLF 4C8EA 1YQNA 1YJNF 1YJ9F 4X1KB 1GO0A 4U3JB 5JH7A 4IIJB 1H7MA 4TV8A 3VYSC 5CB4A 5HY1A 5GONB 1H47A 2IG8A 3VYUC 1W55A 2F9ZC 2BTUA 5GIOC 3CCMF 3VO8A 4O4JB 2RHHA 5CA1B 4IHJA 4O4IA 3WGNA 2UYKA 2BTOA 2KGWA 2Z1TA 2HVYD 3C9RA 4FFBB 2IAFA 4O2BB 4C81A 5JVDA 1TUBB 2WALA 5IJ9A 2ZVYA 2I6DA 3DDNA 4TUYA 5CA0B 3LWPC 4LCKA 5JVDB 1PF5A 4YJ3B 4LNUB 3ZOPA 5J2UA 1W41A 4ZHQA 3NMUC 1QU9A 3C8LA 1VQ5F 2H8EA 5KX5B 2VGNA 1X7OA 3KJKA 1X52A 4BT6A 4TZZA 3RA5A 1RQ2A 3JAKA 2VAPA 3HKBA 1FNJA 3I55F 3HKDB 1NQ3A 3GYQA 5KX5A 1K8AH 5DCVA 4YJ2A 4C4WC 3VCZA 1DBFA 2RB9A 1M1KH 1W3EX 2GLZA 3VI6A 2UYNB 3EORA 4BT7A
chains in the Genus database with same CATH topology
4ZHYB 3CYQA 5EAZA 4G4WA 2N48A 2MQEA 2W8BC 4G4YA 3S02A 3TD3A 4B62A 2AIZP 3WPXA 3S0WA 2HQSC 2KGWA 3S0HA 3TD5A 4ERHA 3S06A 2ZF8A 3S03A 2LBTA 1OAPA 2L26A 4PWTA 3LDTA 2ZOVA 3CYPB 2K1SA 2ZVYA 3KHNA 1R1MA 2LCAA 4G4VA 3IMPA 4G4XA 3OONA 5EB0A 4G4ZA 3TD4A 4G88A 4B5CA 4ZHWA 3S0YA 5EB1B 3WPWA 4ZHVA 2ZVZA 4RHAA 4R40B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHY B;  3CYQ A;  5EAZ A;  4G4W A;  2N48 A;  2MQE A;  2W8B C;  4G4Y A;  3S02 A;  3TD3 A;  4B62 A;  2AIZ P;  3WPX A;  3S0W A;  2HQS C;  2KGW A;  3S0H A;  3TD5 A;  4ERH A;  3S06 A;  2ZF8 A;  3S03 A;  2LBT A;  1OAP A;  2L26 A;  4PWT A;  3LDT A;  2ZOV A;  3CYP B;  2K1S A;  2ZVY A;  3KHN A;  1R1M A;  2LCA A;  4G4V A;  3IMP A;  4G4X A;  3OON A;  5EB0 A;  4G4Z A;  3TD4 A;  4G88 A;  4B5C A;  4ZHW A;  3S0Y A;  5EB1 B;  3WPW A;  4ZHV A;  2ZVZ A;  4RHA A;  4R40 B; 
#chains in the Genus database with same CATH topology
 3WXM B;  3OBW A;  4C82 A;  1W5E A;  1K73 H;  3E20 B;  4O4H B;  5GIP C;  3FD6 A;  1DT9 A;  4I55 A;  4ERH A;  3UT5 B;  5J2T B;  3SIV A;  3S0W A;  3KJJ A;  3LDT A;  4DRX A;  4C8I A;  3HKE A;  4M8I A;  5LYJ A;  1KC8 H;  4EI9 A;  3JAR B;  4BT3 A;  2OHW A;  4BT4 A;  5LXT A;  1VQK F;  2UYN A;  4TV8 B;  5CB4 B;  4IIJ A;  4X3M A;  4HNA B;  2HRU A;  3HTN A;  3F6M A;  4R40 B;  4BVQ A;  4ZHY B;  1UI9 A;  3CCV F;  2DYY A;  1VHA A;  3TD3 A;  1SDS A;  3CB2 A;  4HNA A;  3JAK B;  4X1Y A;  2CZW A;  3S06 A;  4NQ3 A;  3CME F;  3S03 A;  5C8Y B;  4X20 B;  3U0O A;  5FNV A;  3CC7 F;  3FFM A;  3CPQ A;  4E6E A;  4EB6 B;  3D01 A;  5IYZ A;  3MCA B;  3T80 A;  1U3L A;  3FPI A;  5EB1 B;  3CCU F;  2HS4 A;  5JCO A;  2GVI A;  4X1Y B;  1SZQ A;  2FGY A;  3RYH B;  2OTJ F;  1W42 A;  4KWE A;  5CA0 A;  1CLI A;  3HWU A;  3O85 A;  4B62 A;  1VQP F;  4B45 A;  3K14 A;  4ZOL A;  5MN6 A;  2OTM A;  4ZOL B;  2L26 A;  2NMU A;  2K1S A;  3JAT A;  2VAM A;  3CG6 A;  3JAR A;  2KG4 A;  2Z1E A;  5ITZ A;  2EWC A;  4IHJ B;  3LWQ C;  3IMP A;  4O4J A;  3RYF A;  3J80 M;  1VQ7 F;  3HKE B;  2Z1F A;  2LBX A;  3OW2 F;  4ZHW A;  3LWV C;  5IJ0 A;  1W57 A;  5J2T A;  5EYP A;  3DC2 A;  5HXZ A;  5A2Q M;  4I55 B;  1Q86 H;  2VGM A;  2PMP A;  2VXY A;  2ALE A;  3N4Y A;  3G6E F;  5LOV B;  5FNV B;  2R6R 1;  2HS3 A;  3ELC A;  1ODE A;  4ZHQ B;  3K0T A;  1CN7 A;  4WBN A;  1IV3 A;  2Z01 A;  1PXW A;  5BMV B;  1W2B F;  1YIT F;  2HP0 A;  1RA4 A;  4TUY B;  2CW4 A;  5LP6 C;  2OTL F;  1JD1 A;  1T0A A;  4YJ2 B;  4ZI7 A;  3IR9 A;  3HJW C;  5FJ4 C;  5EYP B;  4U39 A;  1TVK A;  3CC2 F;  5IJ0 B;  5EAZ A;  5CA1 A;  2R75 1;  2P6Y A;  1RLG A;  4XCQ A;  1CK2 A;  2YXZ A;  1VQ4 F;  1COM A;  2BTQ B;  2UYJ A;  3JAT B;  3N2K B;  3R0P A;  5J2U B;  3PLA C;  1FNK A;  1H48 A;  3CCE F;  4U3J A;  3F0F A;  1W5A A;  3ON1 A;  4G4Z A;  1ONI A;  2HP0 B;  2IQQ A;  3IKE A;  4G88 A;  2Z1U A;  3NVI B;  3KE1 A;  3RYH A;  1KD1 H;  4BY9 D;  1KQS F;  1OFU A;  5GIN C;  4BVS A;  1GZ0 A;  3D54 A;  2HP3 A;  3CMA F;  4I50 A;  5IYZ B;  3JAS A;  5LOV A;  1J7H A;  3WJQ A;  1T0K B;  5HY4 A;  1OAP A;  3KHN A;  2LCA A;  3ZP4 A;  5JH7 B;  3M4S A;  2H6L A;  3WGK A;  3RYI B;  2KTV A;  5HY2 A;  3MDO A;  5KMG B;  5ITZ B;  1VK3 A;  2AMT A;  3S0Y A;  3F0E A;  1YI2 F;  4LNU A;  1M90 H;  5LP6 A;  3B6N A;  1W40 A;  3S02 A;  3P4E A;  5GAN K;  1N8R H;  1XHO A;  1NMU B;  3MCQ A;  2AIZ P;  5LYJ B;  1TUB A;  2BO1 A;  3WJP A;  5IJ9 B;  1Q81 H;  4O2B A;  3KIZ A;  3CCJ F;  4DRX B;  3JAL B;  3V7Q A;  3VTI C;  3GHZ A;  3QTY A;  2VAW A;  1YGY A;  3C9U A;  4X3L A;  3UT5 A;  1ZWZ A;  4EB6 A;  2HX0 A;  5JQG B;  2ZAU A;  2ZOD A;  2LBW A;  2DT4 A;  1VQO F;  1W5B A;  4X1I B;  4BVT A;  3WPW A;  5EZY A;  3JAW B;  4ZHV A;  2ZVZ A;  4RQO A;  3C9S A;  5GON A;  1Q8R A;  2QTP A;  3CYQ A;  1IV2 A;  1JFF A;  4G4W A;  5LP6 B;  3SIU A;  2RHL A;  3BYQ A;  3RYC A;  3CCQ F;  2CHS A;  2HRY A;  3S0H A;  3ZP7 A;  1JJ2 F;  3IEQ A;  4BT5 A;  1Z5W A;  1E7K A;  4F6R A;  1VQV A;  1YJW F;  1IV1 A;  1SA0 A;  5EZY B;  1FSZ A;  2CSL A;  3N2G B;  4I4T A;  3MBM A;  4B46 A;  3P0Z A;  1FFX B;  1XBI A;  2MQE A;  3VOB A;  3CPW F;  1X7P A;  3M1X A;  4YJ3 A;  3I56 F;  3OBY A;  3E22 A;  2I6R A;  5HXU A;  5EIB C;  3JCM M;  3RE3 A;  1S72 F;  1GX1 A;  4ZK7 A;  2JNB A;  3J7A R;  3RA6 A;  4PWT A;  3CYP B;  4FFB A;  3FBA A;  2V9Y A;  1YHQ F;  1U40 A;  1VQ8 F;  3IKF A;  4TV9 A;  2UYP A;  4O4I B;  5GAP K;  3P10 A;  1XRG A;  5HWE A;  4O4L B;  3GTZ A;  4DXD A;  3HKD A;  4RHA A;  3HKB B;  2N48 A;  1QVG F;  2YYE A;  3CCS F;  4O2A B;  1KNK A;  4X1K A;  3V3T A;  3WPX A;  3TD5 A;  3L7Q A;  1Q7Y H;  4I50 B;  5HP8 A;  4TV9 B;  2PHN A;  4WBN B;  1JFF B;  1JY8 A;  3D00 A;  3VYT C;  3I3F A;  2RHJ A;  5LA6 B;  3JAW A;  3LYB A;  3CC4 F;  1KNJ A;  1IV4 A;  3WGM A;  4X1I A;  3QUW A;  3E22 B;  3E1Y A;  5IT9 M;  2QEX F;  2HS0 A;  4NWO B;  2G9I A;  3FD5 A;  1JN1 A;  5EWR A;  3M84 A;  1K9M H;  3IEW A;  5EIB D;  4O4L A;  3N2G A;  1VH8 A;  3CD6 F;  3MQW A;  3WGL A;  2ZOV A;  3K12 A;  1R1M A;  3HKC B;  3HAX D;  1X25 A;  1TVK B;  4BVR A;  1U43 A;  3G4S F;  4F6R B;  3C9T A;  5EB0 A;  3VOA A;  3LWO C;  3V4D A;  4C8G A;  3TD4 A;  2Q1Y A;  3G71 F;  4B5C A;  4ZI7 B;  5G4V C;  1QD9 A;  1RLU A;  2B33 A;  3ERN A;  5KMG A;  5LA6 A;  1W59 A;  3JAM M;  5EO3 A;  5BMV A;  5HY0 A;  4G4Y A;  3J81 M;  3VMF B;  4BW0 B;  1FFX A;  1W5F A;  2CVL A;  2FC3 A;  1VQ6 F;  4I4T B;  2OZB A;  4EI8 A;  3NK6 A;  3F0G A;  5JQG A;  4O2A A;  3JAS B;  3NK7 A;  1VQ9 F;  4NUT A;  5C8Y A;  4G4X A;  2QA4 F;  1VQL F;  4EI7 A;  3QHD A;  1UFY A;  1YIJ F;  3RYF B;  3I7T A;  3LFO A;  2GZL A;  3RYC B;  1XV2 A;  1QAH A;  1IPA A;  2W8B C;  3K2X A;  3LME A;  3LWR C;  3AGK A;  5AVM A;  3N2K A;  3CCR F;  2HQS C;  1GO1 A;  5LXT B;  3CXC F;  3HKC A;  5G4U C;  1VQN F;  4BT2 A;  4G4V A;  3RYI A;  2KTU A;  3PAF A;  2QI2 A;  5MN4 A;  3NVK E;  2Q1X A;  3JVH A;  2CHT A;  1W58 1;  3OON A;  1NJI H;  5HP7 A;  3V7E A;  5FLX M;  1QVF F;  2CWJ A;  1Q82 H;  3JAL A;  2H8C A;  4O4H A;  5JCO C;  3WGJ A;  2RHO A;  3VIU A;  5B8F A;  1SA0 B;  4X20 A;  3ESJ A;  3ZO8 A;  1RQ7 A;  2UZH A;  3Q8H A;  3F0D A;  3WJR A;  1U3P A;  2ZF8 A;  2LBT A;  1Z5V A;  3N4Z A;  5MN5 A;  1VQM F;  2AIF A;  3CCL F;  4C8E A;  1YQN A;  1YJN F;  1YJ9 F;  4X1K B;  1GO0 A;  4U3J B;  5JH7 A;  4IIJ B;  1H7M A;  4TV8 A;  3VYS C;  5CB4 A;  5HY1 A;  5GON B;  1H47 A;  2IG8 A;  3VYU C;  1W55 A;  2F9Z C;  2BTU A;  5GIO C;  3CCM F;  3VO8 A;  4O4J B;  2RHH A;  5CA1 B;  4IHJ A;  4O4I A;  3WGN A;  2UYK A;  2BTO A;  2KGW A;  2Z1T A;  2HVY D;  3C9R A;  4FFB B;  2IAF A;  4O2B B;  4C81 A;  5JVD A;  1TUB B;  2WAL A;  5IJ9 A;  2ZVY A;  2I6D A;  3DDN A;  4TUY A;  5CA0 B;  3LWP C;  4LCK A;  5JVD B;  1PF5 A;  4YJ3 B;  4LNU B;  3ZOP A;  5J2U A;  1W41 A;  4ZHQ A;  3NMU C;  1QU9 A;  3C8L A;  1VQ5 F;  2H8E A;  5KX5 B;  2VGN A;  1X7O A;  3KJK A;  1X52 A;  4BT6 A;  4TZZ A;  3RA5 A;  1RQ2 A;  3JAK A;  2VAP A;  3HKB A;  1FNJ A;  3I55 F;  3HKD B;  1NQ3 A;  3GYQ A;  5KX5 A;  1K8A H;  5DCV A;  4YJ2 A;  4C4W C;  3VCZ A;  1DBF A;  2RB9 A;  1M1K H;  1W3E X;  2GLZ A;  3VI6 A;  2UYN B;  3EOR A;  4BT7 A; 
#chains in the Genus database with same CATH homology
 4ZHY B;  3CYQ A;  5EAZ A;  4G4W A;  2N48 A;  2MQE A;  2W8B C;  4G4Y A;  3S02 A;  3TD3 A;  4B62 A;  2AIZ P;  3WPX A;  3S0W A;  2HQS C;  2KGW A;  3S0H A;  3TD5 A;  4ERH A;  3S06 A;  2ZF8 A;  3S03 A;  2LBT A;  1OAP A;  2L26 A;  4PWT A;  3LDT A;  2ZOV A;  3CYP B;  2K1S A;  2ZVY A;  3KHN A;  1R1M A;  2LCA A;  4G4V A;  3IMP A;  4G4X A;  3OON A;  5EB0 A;  4G4Z A;  3TD4 A;  4G88 A;  4B5C A;  4ZHW A;  3S0Y A;  5EB1 B;  3WPW A;  4ZHV A;  2ZVZ A;  4RHA A;  4R40 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...